F385836

General Info

Members Datasets Scaffolds Average Seq Length
283 211 238 358

Family's Representative Sequence

Representative Sequence 3300049513|Ga0501290_002300|Ga0501290_002300_263_1459
Length 398
Sequence MSDAPDQKKKRTKPAGATQVATASRRQGSVATRVAPATPASPMLAPRYAARLLAWFDVSGRHDLPWQHPRTPYRVWLSEIMLQQTQVRVVIPYFERFVAALPDLPALAAASQDEVMALWSGLGYYARARNLHAAAKRCVDLHGGDLPRDLDALIALPGIGRSTAGAILSQAWGDPFPILDGNVRRVLSRVFGIEGWPGLPANEKTLWTIAESLLPKARLADYTQAQMDFGATLCTRHDPACVLCPLQDDCIARRDGRTDELPTPKPGKPLPERWAVMLLLSDADGRVLLQRRPSTGIWAALWSLPEAPDHDAARHWFDAHVDGDYDDATTLDDVHHGFTHYRLLMHPRAWRGVALRGAPGEKVGDNAGDAPPLRWVSRTEFDALGIPAPIRTLITRHS

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
10 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
11 2519103095 Burkholderia sp. KJ006 Isolate Nodule
12 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
13 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
14 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
15 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
16 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
19 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
20 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
21 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
22 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
23 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
24 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
25 2818991452 Burkholderia cepacia 561 Isolate Unclassified
26 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
27 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
28 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
29 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
30 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
31 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
32 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
33 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
34 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
35 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
36 2919513703 Luteimonas sp. 3794 Isolate Unclassified
37 2919675420 Luteimonas terrae 4099 Isolate Unclassified
38 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
39 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
40 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
109 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
207 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
208 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
209 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
210 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
211 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.1
Metatranscriptomes 0
Isolates 15.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 2.83
Rhizoplane 3.18
Rhizosphere 76.33
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10002744 3300001990 Bacteria 6230
2 JGI25152J39213_1000407 3300002773 Bacteria 26106
3 JGI25150J39212_1000372 3300002774 Bacteria 21629
4 JGI25151J46595_10000558 3300003187 Bacteria 33861
5 JGI25153J46596_10000334 3300003215 Bacteria 33861
6 Ga0058692_1000006 3300003856 Bacteria 398109
7 Ga0065714_10005565 3300005288 Bacteria 4588
8 Ga0065704_10070393 3300005289 Bacteria 27063
9 Ga0065715_10193260 3300005293 Bacteria 1399
10 Ga0070658_10140899 3300005327 Bacteria 2014
11 Ga0070670_100079890 3300005331 Bacteria 2811
12 Ga0070670_100089141 3300005331 Bacteria 2652
13 Ga0070668_100036496 3300005347 Bacteria 3751
14 Ga0070668_100125371 3300005347 Bacteria 2056
15 Ga0070669_100080024 3300005353 Bacteria 2431
16 Ga0070681_10121730 3300005458 Bacteria 2544
17 Ga0070679_100035430 3300005530 Bacteria 4952
18 Ga0070679_100139197 3300005530 Bacteria 2407
19 Ga0070693_100001735 3300005547 Bacteria 9913
20 Ga0070693_100072883 3300005547 Bacteria 2027
21 Ga0070664_100295916 3300005564 Bacteria 1462
22 Ga0068852_100292425 3300005616 Bacteria 1574
23 Ga0068863_100139879 3300005841 Bacteria 2313
24 Ga0075364_10010087 3300006051 Bacteria 5695
25 Ga0075364_10170691 3300006051 Bacteria 1470
26 Ga0105251_10000048 3300009011 Bacteria 110218
27 Ga0105243_10014071 3300009148 Bacteria 6054
28 Ga0105248_10176260 3300009177 Bacteria 2409
29 Ga0105239_10011626 3300010375 Bacteria 9822
30 Ga0157318_1000767 3300012482 Bacteria 1479
31 Ga0157371_10040883 3300013102 Bacteria 3310
32 Ga0157371_10112469 3300013102 Bacteria 1933
33 Ga0157369_10000817 3300013105 Bacteria 39779
34 Ga0157369_10017754 3300013105 Bacteria 7989
35 Ga0157369_10300533 3300013105 Bacteria 1670
36 Ga0163162_10038425 3300013306 Bacteria 4776
37 Ga0207425_1000030 3300025245 Bacteria 268200
38 Ga0209129_1000597 3300025258 Bacteria 24626
39 Ga0209025_1000054 3300025294 Bacteria 317002
40 Ga0209758_1000062 3300025297 Bacteria 317002
41 Ga0209050_1024368 3300025298 Bacteria 2096
42 Ga0209257_1000150 3300025304 Bacteria 191487
43 Ga0209257_1000530 3300025304 Bacteria 66163
44 Ga0207657_10004447 3300025919 Bacteria 14830
45 Ga0207657_10233126 3300025919 Bacteria 1472
46 Ga0207681_10026472 3300025923 Bacteria 3741
47 Ga0207659_10227474 3300025926 Bacteria 1503
48 Ga0207711_10163483 3300025941 Bacteria 2016
49 Ga0207668_10099291 3300025972 Bacteria 2159
50 Ga0207702_10022797 3300026078 Bacteria 5193
51 Ga0209371_1000016 3300027312 Bacteria 646301
52 Ga0209970_1000068 3300027614 Bacteria 14109
53 Ga0209983_1000087 3300027665 Bacteria 14885
54 Ga0209971_1003392 3300027682 Bacteria 3780
55 Ga0209974_10016566 3300027876 Bacteria 2447
56 Ga0209974_10019287 3300027876 Bacteria 2260
57 Ga0268266_10075718 3300028379 Bacteria 2924
58 Ga0268256_1000015 3300030500 Bacteria 646300
59 Ga0314311_1055305 3300030733 Bacteria 2259
60 Ga0307513_10026353 3300031456 Bacteria 6704
61 Ga0307513_10065165 3300031456 Bacteria 3833
62 Ga0307513_10101369 3300031456 Bacteria 2901
63 Ga0307408_100001314 3300031548 Bacteria 18632
64 Ga0307408_100081765 3300031548 Bacteria 2416
65 Ga0316576_10049557 3300031727 Bacteria 3051
66 Ga0316576_10128301 3300031727 Bacteria 1907
67 Ga0307413_10057718 3300031824 Bacteria 2375
68 Ga0307406_10030880 3300031901 Bacteria 3258
69 Ga0307407_10079180 3300031903 Bacteria 1982
70 Ga0307412_10006688 3300031911 Bacteria 6536
71 Ga0307412_10040550 3300031911 Bacteria 3013
72 Ga0307416_100116106 3300032002 Bacteria 2372
73 Ga0307414_10002238 3300032004 Bacteria 10095
74 Ga0307414_10182762 3300032004 Bacteria 1688
75 Ga0307411_10038638 3300032005 Bacteria 3013
76 Ga0316574_0017659 3300035398 Bacteria 4180
77 Ga0316574_0055596 3300035398 Bacteria 2474
78 Ga0316574_0105412 3300035398 Bacteria 1806
79 Ga0395900_0000057 3300037418 Bacteria 212535
80 Ga0395900_0111418 3300037418 Bacteria 2811
81 Ga0395900_0178566 3300037418 Bacteria 2159
82 Ga0395898_0007346 3300037466 Bacteria 11695
83 Ga0395898_0049107 3300037466 Bacteria 4136
84 Ga0395905_0017565 3300037471 Bacteria 6789
85 Ga0395905_0020000 3300037471 Bacteria 6343
86 Ga0395905_0257406 3300037471 Bacteria 1630
87 Ga0395901_0000002 3300038443 Bacteria 761045
88 Ga0395901_0001810 3300038443 Bacteria 22075
89 Ga0395901_0004171 3300038443 Bacteria 14590
90 Ga0439436_0003241 3300041404 Bacteria 4935
91 Ga0439439_0014042 3300041406 Bacteria 1947
92 Ga0439465_0001006 3300041413 Bacteria 8961
93 Ga0439465_0005438 3300041413 Bacteria 4065
94 Ga0451791_1047196 3300041451 Bacteria 1180
95 Ga0451791_1830083 3300041451 Bacteria 1914
96 Ga0451802_1583159 3300041460 Bacteria 2535
97 Ga0451843_0236904 3300041509 Bacteria 2241
98 Ga0439445_0013284 3300042004 Bacteria 1992
99 Ga0439449_0000046 3300042007 Bacteria 37723
100 Ga0451577_0016036 3300042876 Bacteria 6951
101 Ga0466969_0021460 3300044656 Bacteria 3338
102 Ga0466977_0000028 3300044666 Bacteria 23042
103 Ga0466966_0000265 3300044684 Bacteria 34719
104 Ga0466966_0047304 3300044684 Bacteria 2743
105 Ga0466961_0008430 3300044693 Bacteria 6563
106 Ga0466961_0202393 3300044693 Bacteria 1227
107 Ga0466963_0003082 3300044694 Bacteria 9444
108 Ga0466964_0037479 3300044706 Bacteria 1947
109 Ga0466971_0049152 3300044719 Bacteria 1897
110 Ga0466968_0058082 3300044735 Bacteria 1664
111 Ga0466970_0010212 3300044765 Bacteria 4758
112 Ga0466957_0015482 3300044842 Bacteria 4454
113 Ga0466958_0051888 3300045836 Bacteria 2484
114 Ga0466958_0060103 3300045836 Bacteria 2313
115 Ga0466967_0304514 3300045976 Bacteria 1534
116 Ga0495592_0013382 3300046454 Bacteria 6243
117 Ga0495592_0015232 3300046454 Bacteria 5837
118 Ga0495591_000791 3300046458 Bacteria 22446
119 Ga0495629_0006571 3300046459 Bacteria 8615
120 Ga0495629_0010495 3300046459 Bacteria 6738
121 Ga0495651_0018143 3300046462 Bacteria 5448
122 Ga0495653_0006657 3300046463 Bacteria 9483
123 Ga0495653_0033930 3300046463 Bacteria 4039
124 Ga0495650_0008359 3300046471 Bacteria 6051
125 Ga0495580_0005205 3300046472 Bacteria 10808
126 Ga0495580_0018821 3300046472 Bacteria 5139
127 Ga0495582_0006485 3300046473 Bacteria 6495
128 Ga0495582_0007350 3300046473 Bacteria 6103
129 Ga0495662_0057963 3300046476 Bacteria 1871
130 Ga0495664_0000289 3300046477 Bacteria 24107
131 Ga0495664_0015875 3300046477 Bacteria 4285
132 Ga0495594_0040842 3300046499 Bacteria 2540
133 Ga0495596_0002433 3300046500 Bacteria 10025
134 Ga0495606_0020813 3300046507 Bacteria 4823
135 Ga0495606_0021686 3300046507 Bacteria 4700
136 Ga0495608_0019446 3300046511 Bacteria 4673
137 Ga0495616_0081176 3300046513 Bacteria 1551
138 Ga0495618_0004337 3300046514 Bacteria 8725
139 Ga0495618_0008551 3300046514 Bacteria 6181
140 Ga0495628_0002241 3300046516 Bacteria 17484
141 Ga0495628_0069169 3300046516 Bacteria 2753
142 Ga0495630_0005328 3300046517 Bacteria 9077
143 Ga0495630_0019220 3300046517 Bacteria 5021
144 Ga0495648_0012574 3300046524 Bacteria 6302
145 Ga0495648_0017907 3300046524 Bacteria 5044
146 Ga0495663_0001437 3300046525 Bacteria 7519
147 Ga0495666_0001052 3300046526 Bacteria 13084
148 Ga0495666_0005126 3300046526 Bacteria 6622
149 Ga0495665_0012302 3300046531 Bacteria 4631
150 Ga0495640_0009820 3300046533 Bacteria 7428
151 Ga0495640_0012365 3300046533 Bacteria 6523
152 Ga0495587_0006587 3300046536 Bacteria 7562
153 Ga0495645_0000279 3300046543 Bacteria 37572
154 Ga0495633_0006586 3300046558 Bacteria 6860
155 Ga0495634_0007351 3300046642 Bacteria 8288
156 Ga0495635_0007562 3300046663 Bacteria 7580
157 Ga0495659_0104221 3300046664 Bacteria 1102
158 Ga0495661_0006176 3300046665 Bacteria 8432
159 Ga0495661_0044731 3300046665 Bacteria 2711
160 Ga0495588_0017313 3300046674 Bacteria 3496
161 Ga0495599_0081738 3300046678 Bacteria 2018
162 Ga0495599_0129104 3300046678 Bacteria 1570
163 Ga0495623_0005676 3300046679 Bacteria 8148
164 Ga0495623_0006491 3300046679 Bacteria 7612
165 Ga0495646_0010805 3300046680 Bacteria 5799
166 Ga0495646_0024873 3300046680 Bacteria 3767
167 Ga0495613_0003657 3300046689 Bacteria 11524
168 Ga0495613_0045275 3300046689 Bacteria 3254
169 Ga0495624_0008821 3300046690 Bacteria 7010
170 Ga0495624_0015575 3300046690 Bacteria 5131
171 Ga0495624_0043291 3300046690 Bacteria 2872
172 Ga0495624_0077026 3300046690 Bacteria 2068
173 Ga0495671_0010423 3300046692 Bacteria 5150
174 Ga0495589_0004853 3300046794 Bacteria 7134
175 Ga0495589_0036133 3300046794 Bacteria 2477
176 Ga0495600_0003995 3300046809 Bacteria 8766
177 Ga0495600_0130035 3300046809 Bacteria 1637
178 Ga0495581_0007985 3300047315 Bacteria 6130
179 Ga0495581_0028564 3300047315 Bacteria 3232
180 Ga0495604_0016705 3300047317 Bacteria 5869
181 Ga0495604_0020115 3300047317 Bacteria 5334
182 Ga0495676_0030612 3300047321 Bacteria 4563
183 Ga0495676_0031317 3300047321 Bacteria 4500
184 Ga0495680_0007388 3300047322 Bacteria 10079
185 Ga0495680_0099150 3300047322 Bacteria 2172
186 Ga0495683_0009473 3300047323 Bacteria 5186
187 Ga0495675_0009236 3300047444 Bacteria 6132
188 Ga0495675_0018699 3300047444 Bacteria 4400
189 Ga0495679_003128 3300047446 Bacteria 8094
190 Ga0495673_0013302 3300047469 Bacteria 4327
191 Ga0495593_0012475 3300047673 Bacteria 4857
192 Ga0495593_0027588 3300047673 Bacteria 3124
193 Ga0495602_0014366 3300048088 Bacteria 8041
194 Ga0495602_0075753 3300048088 Bacteria 2854
195 Ga0495602_0100200 3300048088 Bacteria 2379
196 Ga0495614_0004081 3300048089 Bacteria 6568
197 Ga0495614_0022544 3300048089 Bacteria 2717
198 Ga0496107_0237080 3300048910 Bacteria 1358
199 Ga0496108_0055021 3300048911 Bacteria 3340
200 Ga0496111_0051114 3300048914 Bacteria 2983
201 Ga0496111_0287074 3300048914 Bacteria 1220
202 Ga0496112_0097878 3300048915 Bacteria 2904
203 Ga0496118_0039830 3300048921 Bacteria 3744
204 Ga0496122_0000372 3300048925 Bacteria 96314
205 Ga0496122_0060696 3300048925 Bacteria 2782
206 Ga0496123_0003662 3300048926 Bacteria 16955
207 Ga0496123_0008803 3300048926 Bacteria 9202
208 Ga0496123_0050330 3300048926 Bacteria 2784
209 Ga0496124_0000018 3300048927 Bacteria 442940
210 Ga0496124_0075412 3300048927 Bacteria 2786
211 Ga0496125_0120844 3300048928 Bacteria 1869
212 Ga0496126_0025795 3300048929 Bacteria 5647
213 Ga0501290_002300 3300049513 Bacteria 2477
214 Ga0501031_0175686 3300049568 Bacteria 1399
215 Ga0501032_0018931 3300049569 Bacteria 4818
216 Ga0501032_0022931 3300049569 Bacteria 4322
217 Ga0501033_0237629 3300049570 Bacteria 1293
218 Ga0501034_0012485 3300049571 Bacteria 8773
219 Ga0501034_0430808 3300049571 Bacteria 1239
220 Ga0501037_0034536 3300049573 Bacteria 3731
221 Ga0501037_0186232 3300049573 Bacteria 1471
222 Ga0501039_0012152 3300049575 Bacteria 6565
223 Ga0501039_0053481 3300049575 Bacteria 3125
224 Ga0501043_0120661 3300049579 Bacteria 2056
225 Ga0501046_0040019 3300049580 Bacteria 3749
226 Ga0501047_0027447 3300049581 Bacteria 5485
227 Ga0501070_0075139 3300049586 Bacteria 2797
228 Ga0501073_0024270 3300049589 Bacteria 4354
229 Ga0501080_0007742 3300049742 Bacteria 9712
230 Ga0501083_0054382 3300049744 Bacteria 2687
231 Ga0501275_000719 3300049772 Bacteria 3614
232 Ga0501035_0015182 3300049822 Bacteria 7109
233 Ga0501044_0023773 3300049823 Bacteria 6516
234 nmdc:mga00v17_38806_c1 3300050491 Bacteria 2850
235 Ga0500568_0000438 3300053139 Bacteria 31351
236 Ga0501084_0125899 3300054114 Bacteria 2156
237 Ga0501082_0102507 3300060353 Bacteria 2475
238 Ga0466962_0000527 3300061719 Bacteria 16722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10176260 Ga0105248_101762603 302
2 3300044719 Ga0466971_0049152 Ga0466971_0049152_33_992 311
3 3300046678 Ga0495599_0129104 Ga0495599_0129104_590_1543 311
4 3300046507 Ga0495606_0020813 Ga0495606_0020813_299_1285 317
5 3300031727 Ga0316576_10128301 Ga0316576_101283011 318
6 3300027614 Ga0209970_1000068 Ga0209970_10000683 321
7 3300048926 Ga0496123_0008803 Ga0496123_0008803_400_1497 324
8 3300048929 Ga0496126_0025795 Ga0496126_0025795_4225_5343 324
9 3300041460 Ga0451802_1583159 Ga0451802_1583159_101_1144 332
10 3300044693 Ga0466961_0008430 Ga0466961_0008430_2877_4064 332
11 3300048925 Ga0496122_0060696 Ga0496122_0060696_364_1407 332
12 3300048926 Ga0496123_0050330 Ga0496123_0050330_1099_2142 332
13 3300048927 Ga0496124_0075412 Ga0496124_0075412_642_1685 332
14 3300031727 Ga0316576_10049557 Ga0316576_100495572 333
15 3300031901 Ga0307406_10030880 Ga0307406_100308802 333
16 3300031903 Ga0307407_10079180 Ga0307407_100791802 333
17 3300035398 Ga0316574_0017659 Ga0316574_0017659_2370_3425 333
18 3300035398 Ga0316574_0055596 Ga0316574_0055596_1056_2111 333
19 3300035398 Ga0316574_0105412 Ga0316574_0105412_348_1403 333
20 3300005289 Ga0065704_10070393 Ga0065704_1007039326 334
21 3300025926 Ga0207659_10227474 Ga0207659_102274741 334
22 3300046664 Ga0495659_0104221 Ga0495659_0104221_14_1063 334
23 iso_pu_bacteria 2987605356 2987606293 334
24 3300002773 JGI25152J39213_1000407 JGI25152J39213_100040727 335
25 3300002774 JGI25150J39212_1000372 JGI25150J39212_100037222 335
26 3300003187 JGI25151J46595_10000558 JGI25151J46595_1000055824 335
27 3300003215 JGI25153J46596_10000334 JGI25153J46596_1000033424 335
28 3300025245 Ga0207425_1000030 Ga0207425_10000304 335
29 3300025258 Ga0209129_1000597 Ga0209129_100059723 335
30 3300025294 Ga0209025_1000054 Ga0209025_1000054263 335
31 3300025297 Ga0209758_1000062 Ga0209758_1000062263 335
32 3300025304 Ga0209257_1000530 Ga0209257_100053060 335
33 3300031456 Ga0307513_10101369 Ga0307513_101013692 335
34 3300032002 Ga0307416_100116106 Ga0307416_1001161064 335
35 3300041406 Ga0439439_0014042 Ga0439439_0014042_399_1457 335
36 3300041413 Ga0439465_0005438 Ga0439465_0005438_339_1406 335
37 3300044666 Ga0466977_0000028 Ga0466977_0000028_5577_6743 335
38 3300046513 Ga0495616_0081176 Ga0495616_0081176_105_1172 335
39 3300046525 Ga0495663_0001437 Ga0495663_0001437_1643_2701 335
40 3300046558 Ga0495633_0006586 Ga0495633_0006586_1112_2170 335
41 iso_pu_bacteria 2643221579 2643905582 335
42 3300005331 Ga0070670_100089141 Ga0070670_1000891412 336
43 3300005347 Ga0070668_100125371 Ga0070668_1001253712 336
44 3300005841 Ga0068863_100139879 Ga0068863_1001398791 336
45 3300006051 Ga0075364_10010087 Ga0075364_100100872 336
46 3300006051 Ga0075364_10170691 Ga0075364_101706912 336
47 3300012482 Ga0157318_1000767 Ga0157318_10007671 336
48 3300041404 Ga0439436_0003241 Ga0439436_0003241_1727_2776 336
49 3300041413 Ga0439465_0001006 Ga0439465_0001006_2433_3482 336
50 3300042004 Ga0439445_0013284 Ga0439445_0013284_360_1409 336
51 3300042007 Ga0439449_0000046 Ga0439449_0000046_3014_4063 336
52 3300042876 Ga0451577_0016036 Ga0451577_0016036_1203_2246 336
53 3300048910 Ga0496107_0237080 Ga0496107_0237080_276_1316 336
54 3300048911 Ga0496108_0055021 Ga0496108_0055021_1425_2465 336
55 3300048914 Ga0496111_0051114 Ga0496111_0051114_1664_2704 336
56 3300048914 Ga0496111_0287074 Ga0496111_0287074_124_1164 336
57 3300048915 Ga0496112_0097878 Ga0496112_0097878_1277_2317 336
58 3300048925 Ga0496122_0000372 Ga0496122_0000372_29617_30672 336
59 3300048926 Ga0496123_0003662 Ga0496123_0003662_5455_6510 336
60 3300049569 Ga0501032_0018931 Ga0501032_0018931_378_1439 336
61 3300049571 Ga0501034_0012485 Ga0501034_0012485_3149_4189 336
62 3300049575 Ga0501039_0012152 Ga0501039_0012152_2512_3573 336
63 3300049581 Ga0501047_0027447 Ga0501047_0027447_1660_2721 336
64 3300049589 Ga0501073_0024270 Ga0501073_0024270_2704_3765 336
65 3300049742 Ga0501080_0007742 Ga0501080_0007742_5591_6652 336
66 3300049822 Ga0501035_0015182 Ga0501035_0015182_475_1536 336
67 3300049823 Ga0501044_0023773 Ga0501044_0023773_2858_3919 336
68 3300050491 nmdc:mga00v17_38806_c1 nmdc:mga00v17_38806_c1_1458_2537 336
69 iso_pu_bacteria 2919513703 2919515282 336
70 iso_pu_bacteria 2919675420 2919678297 336
71 3300003856 Ga0058692_1000006 Ga0058692_1000006335 337
72 3300005327 Ga0070658_10140899 Ga0070658_101408992 337
73 3300005458 Ga0070681_10121730 Ga0070681_101217302 337
74 3300005530 Ga0070679_100035430 Ga0070679_1000354309 337
75 3300005530 Ga0070679_100139197 Ga0070679_1001391972 337
76 3300005547 Ga0070693_100072883 Ga0070693_1000728832 337
77 3300005564 Ga0070664_100295916 Ga0070664_1002959162 337
78 3300013102 Ga0157371_10040883 Ga0157371_100408832 337
79 3300013102 Ga0157371_10112469 Ga0157371_101124692 337
80 3300013105 Ga0157369_10017754 Ga0157369_100177548 337
81 3300025919 Ga0207657_10004447 Ga0207657_100044474 337
82 3300025919 Ga0207657_10233126 Ga0207657_102331262 337
83 3300026078 Ga0207702_10022797 Ga0207702_100227973 337
84 3300027312 Ga0209371_1000016 Ga0209371_1000016331 337
85 3300030500 Ga0268256_1000015 Ga0268256_1000015239 337
86 3300032004 Ga0307414_10002238 Ga0307414_100022386 337
87 3300037418 Ga0395900_0178566 Ga0395900_0178566_695_1744 337
88 3300037471 Ga0395905_0017565 Ga0395905_0017565_5089_6159 337
89 3300037471 Ga0395905_0257406 Ga0395905_0257406_88_1140 337
90 3300045976 Ga0466967_0304514 Ga0466967_0304514_197_1246 337
91 3300049571 Ga0501034_0430808 Ga0501034_0430808_14_1072 337
92 iso_pu_bacteria 2643221581 2643913285 337
93 iso_pu_bacteria 2747842501 2748016455 337
94 iso_pu_bacteria 2919130084 2919130694 337
95 iso_pu_bacteria 8002869464 8002871530 337
96 3300005331 Ga0070670_100079890 Ga0070670_1000798902 338
97 3300009011 Ga0105251_10000048 Ga0105251_1000004824 338
98 3300009148 Ga0105243_10014071 Ga0105243_100140712 338
99 iso_pu_bacteria 8021622325 8021626448 338
100 3300025298 Ga0209050_1024368 Ga0209050_10243682 339
101 3300025304 Ga0209257_1000150 Ga0209257_100015033 339
102 3300031456 Ga0307513_10026353 Ga0307513_100263538 339
103 3300031456 Ga0307513_10065165 Ga0307513_100651652 339
104 3300032004 Ga0307414_10182762 Ga0307414_101827623 339
105 3300048927 Ga0496124_0000018 Ga0496124_0000018_4184_5242 339
106 iso_pu_bacteria 2842780639 2842781258 339
107 3300005288 Ga0065714_10005565 Ga0065714_100055656 340
108 3300005293 Ga0065715_10193260 Ga0065715_101932602 340
109 3300005347 Ga0070668_100036496 Ga0070668_1000364962 340
110 3300005547 Ga0070693_100001735 Ga0070693_1000017353 340
111 3300025972 Ga0207668_10099291 Ga0207668_100992912 340
112 3300027665 Ga0209983_1000087 Ga0209983_100008714 340
113 3300027682 Ga0209971_1003392 Ga0209971_10033922 340
114 3300027876 Ga0209974_10016566 Ga0209974_100165662 340
115 3300027876 Ga0209974_10019287 Ga0209974_100192872 340
116 3300030733 Ga0314311_1055305 Ga0314311_10553053 340
117 3300031548 Ga0307408_100081765 Ga0307408_1000817652 340
118 3300031824 Ga0307413_10057718 Ga0307413_100577183 340
119 3300031911 Ga0307412_10040550 Ga0307412_100405502 340
120 3300032005 Ga0307411_10038638 Ga0307411_100386382 340
121 3300041451 Ga0451791_1047196 Ga0451791_1047196_13_1077 340
122 3300041451 Ga0451791_1830083 Ga0451791_1830083_734_1804 340
123 3300041509 Ga0451843_0236904 Ga0451843_0236904_1059_2129 340
124 3300049568 Ga0501031_0175686 Ga0501031_0175686_125_1210 340
125 3300049569 Ga0501032_0022931 Ga0501032_0022931_205_1290 340
126 3300049579 Ga0501043_0120661 Ga0501043_0120661_222_1307 340
127 3300049586 Ga0501070_0075139 Ga0501070_0075139_732_1817 340
128 3300005353 Ga0070669_100080024 Ga0070669_1000800242 341
129 3300025923 Ga0207681_10026472 Ga0207681_100264722 341
130 3300048928 Ga0496125_0120844 Ga0496125_0120844_170_1252 341
131 3300049573 Ga0501037_0034536 Ga0501037_0034536_2447_3598 341
132 3300049580 Ga0501046_0040019 Ga0501046_0040019_52_1122 341
133 3300049744 Ga0501083_0054382 Ga0501083_0054382_967_2037 341
134 3300054114 Ga0501084_0125899 Ga0501084_0125899_656_1726 341
135 3300060353 Ga0501082_0102507 Ga0501082_0102507_564_1634 341
136 iso_pu_bacteria 2734482258 2735816450 341
137 3300049513 Ga0501290_002300 Ga0501290_002300_263_1459 342
138 3300049573 Ga0501037_0186232 Ga0501037_0186232_378_1451 342
139 3300049772 Ga0501275_000719 Ga0501275_000719_2081_3277 342
140 3300053139 Ga0500568_0000438 Ga0500568_0000438_28936_30051 343
141 iso_pu_bacteria 2751185846 2753566245 343
142 iso_pu_bacteria 2842324504 2842331850 343
143 iso_pu_bacteria 2842348783 2842356163 343
144 iso_pu_bacteria 2842454564 2842459363 343
145 iso_pu_bacteria 2894414249 2894416193 343
146 3300010375 Ga0105239_10011626 Ga0105239_100116264 344
147 3300028379 Ga0268266_10075718 Ga0268266_100757183 344
148 3300049570 Ga0501033_0237629 Ga0501033_0237629_92_1264 344
149 3300049575 Ga0501039_0053481 Ga0501039_0053481_973_2091 344
150 3300031548 Ga0307408_100001314 Ga0307408_10000131413 347
151 3300031911 Ga0307412_10006688 Ga0307412_100066883 347
152 3300046454 Ga0495592_0013382 Ga0495592_0013382_1324_2385 347
153 3300046459 Ga0495629_0006571 Ga0495629_0006571_3676_4737 347
154 3300046463 Ga0495653_0006657 Ga0495653_0006657_3856_4917 347
155 3300046472 Ga0495580_0005205 Ga0495580_0005205_3884_4945 347
156 3300046472 Ga0495580_0018821 Ga0495580_0018821_199_1260 347
157 3300046473 Ga0495582_0006485 Ga0495582_0006485_4576_5637 347
158 3300046476 Ga0495662_0057963 Ga0495662_0057963_344_1405 347
159 3300046477 Ga0495664_0000289 Ga0495664_0000289_1966_3027 347
160 3300046499 Ga0495594_0040842 Ga0495594_0040842_910_1971 347
161 3300046514 Ga0495618_0004337 Ga0495618_0004337_2946_4007 347
162 3300046516 Ga0495628_0002241 Ga0495628_0002241_2128_3189 347
163 3300046516 Ga0495628_0069169 Ga0495628_0069169_1509_2570 347
164 3300046517 Ga0495630_0005328 Ga0495630_0005328_3866_4927 347
165 3300046524 Ga0495648_0012574 Ga0495648_0012574_971_2032 347
166 3300046524 Ga0495648_0017907 Ga0495648_0017907_3264_4325 347
167 3300046526 Ga0495666_0001052 Ga0495666_0001052_4572_5633 347
168 3300046526 Ga0495666_0005126 Ga0495666_0005126_3862_4923 347
169 3300046531 Ga0495665_0012302 Ga0495665_0012302_1391_2452 347
170 3300046533 Ga0495640_0009820 Ga0495640_0009820_1883_2944 347
171 3300046543 Ga0495645_0000279 Ga0495645_0000279_14187_15248 347
172 3300046642 Ga0495634_0007351 Ga0495634_0007351_2579_3640 347
173 3300046663 Ga0495635_0007562 Ga0495635_0007562_4027_5088 347
174 3300046665 Ga0495661_0006176 Ga0495661_0006176_2824_3885 347
175 3300046665 Ga0495661_0044731 Ga0495661_0044731_260_1321 347
176 3300046674 Ga0495588_0017313 Ga0495588_0017313_522_1583 347
177 3300046678 Ga0495599_0081738 Ga0495599_0081738_697_1758 347
178 3300046679 Ga0495623_0005676 Ga0495623_0005676_2648_3709 347
179 3300046680 Ga0495646_0024873 Ga0495646_0024873_149_1210 347
180 3300046689 Ga0495613_0003657 Ga0495613_0003657_3025_4086 347
181 3300046689 Ga0495613_0045275 Ga0495613_0045275_931_1992 347
182 3300046690 Ga0495624_0015575 Ga0495624_0015575_3125_4186 347
183 3300046690 Ga0495624_0077026 Ga0495624_0077026_859_1920 347
184 3300046794 Ga0495589_0004853 Ga0495589_0004853_3310_4371 347
185 3300046809 Ga0495600_0003995 Ga0495600_0003995_7523_8584 347
186 3300046809 Ga0495600_0130035 Ga0495600_0130035_262_1323 347
187 3300047315 Ga0495581_0028564 Ga0495581_0028564_1389_2450 347
188 3300047317 Ga0495604_0020115 Ga0495604_0020115_2557_3618 347
189 3300047321 Ga0495676_0031317 Ga0495676_0031317_796_1857 347
190 3300047322 Ga0495680_0007388 Ga0495680_0007388_7431_8492 347
191 3300047444 Ga0495675_0018699 Ga0495675_0018699_910_1971 347
192 3300047446 Ga0495679_003128 Ga0495679_003128_1671_2732 347
193 3300047469 Ga0495673_0013302 Ga0495673_0013302_2445_3506 347
194 3300047673 Ga0495593_0027588 Ga0495593_0027588_1197_2258 347
195 3300048088 Ga0495602_0014366 Ga0495602_0014366_1325_2386 347
196 3300048088 Ga0495602_0075753 Ga0495602_0075753_661_1722 347
197 3300048088 Ga0495602_0100200 Ga0495602_0100200_56_1117 347
198 3300048089 Ga0495614_0004081 Ga0495614_0004081_2256_3317 347
199 iso_pu_bacteria 2519103095 2519459838 349
200 iso_pu_bacteria 2582581311 2585290658 349
201 iso_pu_bacteria 2599185239 2599740253 349
202 iso_pu_bacteria 2816332253 2817262122 349
203 iso_pu_bacteria 2816332256 2817279823 349
204 iso_pu_bacteria 2816332286 2817455571 349
205 iso_pu_bacteria 2818991452 2819633717 349
206 iso_pu_bacteria 2981990288 2981992781 349
207 iso_pu_bacteria 8020807995 8020814271 349
208 iso_pu_bacteria 8040167225 8040172126 349
209 iso_pu_bacteria 8040173305 8040173965 349
210 3300005616 Ga0068852_100292425 Ga0068852_1002924252 350
211 3300013105 Ga0157369_10000817 Ga0157369_100008177 350
212 3300025941 Ga0207711_10163483 Ga0207711_101634832 350
213 3300037418 Ga0395900_0111418 Ga0395900_0111418_1108_2226 350
214 3300037466 Ga0395898_0007346 Ga0395898_0007346_2052_3179 350
215 3300037466 Ga0395898_0049107 Ga0395898_0049107_408_1526 350
216 3300038443 Ga0395901_0001810 Ga0395901_0001810_17705_18823 350
217 3300038443 Ga0395901_0004171 Ga0395901_0004171_249_1376 350
218 3300044656 Ga0466969_0021460 Ga0466969_0021460_262_1374 350
219 3300044684 Ga0466966_0000265 Ga0466966_0000265_29208_30320 350
220 3300044684 Ga0466966_0047304 Ga0466966_0047304_939_2051 350
221 3300044693 Ga0466961_0202393 Ga0466961_0202393_34_1146 350
222 3300044694 Ga0466963_0003082 Ga0466963_0003082_5194_6306 350
223 3300044706 Ga0466964_0037479 Ga0466964_0037479_145_1257 350
224 3300044735 Ga0466968_0058082 Ga0466968_0058082_458_1570 350
225 3300044765 Ga0466970_0010212 Ga0466970_0010212_2609_3721 350
226 3300044842 Ga0466957_0015482 Ga0466957_0015482_315_1427 350
227 3300045836 Ga0466958_0051888 Ga0466958_0051888_57_1169 350
228 3300045836 Ga0466958_0060103 Ga0466958_0060103_691_1803 350
229 3300046454 Ga0495592_0015232 Ga0495592_0015232_2573_3757 350
230 3300046458 Ga0495591_000791 Ga0495591_000791_8052_9221 350
231 3300046459 Ga0495629_0010495 Ga0495629_0010495_1837_3021 350
232 3300046462 Ga0495651_0018143 Ga0495651_0018143_2937_4121 350
233 3300046463 Ga0495653_0033930 Ga0495653_0033930_1263_2447 350
234 3300046471 Ga0495650_0008359 Ga0495650_0008359_4274_5353 350
235 3300046473 Ga0495582_0007350 Ga0495582_0007350_893_2077 350
236 3300046477 Ga0495664_0015875 Ga0495664_0015875_2923_4107 350
237 3300046500 Ga0495596_0002433 Ga0495596_0002433_384_1553 350
238 3300046507 Ga0495606_0021686 Ga0495606_0021686_1680_2864 350
239 3300046511 Ga0495608_0019446 Ga0495608_0019446_2227_3411 350
240 3300046514 Ga0495618_0008551 Ga0495618_0008551_2917_4101 350
241 3300046517 Ga0495630_0019220 Ga0495630_0019220_3015_4199 350
242 3300046533 Ga0495640_0012365 Ga0495640_0012365_3875_5059 350
243 3300046536 Ga0495587_0006587 Ga0495587_0006587_2499_3683 350
244 3300046679 Ga0495623_0006491 Ga0495623_0006491_1820_3004 350
245 3300046680 Ga0495646_0010805 Ga0495646_0010805_2796_3980 350
246 3300046690 Ga0495624_0043291 Ga0495624_0043291_52_1236 350
247 3300046692 Ga0495671_0010423 Ga0495671_0010423_2128_3312 350
248 3300047315 Ga0495581_0007985 Ga0495581_0007985_3283_4467 350
249 3300047317 Ga0495604_0016705 Ga0495604_0016705_3236_4405 350
250 3300047321 Ga0495676_0030612 Ga0495676_0030612_3275_4459 350
251 3300047323 Ga0495683_0009473 Ga0495683_0009473_3283_4467 350
252 3300047444 Ga0495675_0009236 Ga0495675_0009236_1557_2741 350
253 3300048089 Ga0495614_0022544 Ga0495614_0022544_1158_2342 350
254 3300048921 Ga0496118_0039830 Ga0496118_0039830_1179_2267 350
255 3300061719 Ga0466962_0000527 Ga0466962_0000527_6682_7794 350
256 iso_pu_bacteria 2501025501 2501070820 350
257 iso_pu_bacteria 2501025502 2501080344 350
258 iso_pu_bacteria 2501025504 2501413653 350
259 iso_pu_bacteria 2510917013 2511089680 350
260 iso_pu_bacteria 2510917014 2511095077 350
261 iso_pu_bacteria 2510917015 2511104736 350
262 iso_pu_bacteria 2513237082 2513551409 350
263 iso_pu_bacteria 2513237083 2513560051 350
264 iso_pu_bacteria 2513237151 2513959195 350
265 iso_pu_bacteria 2515154189 2516016809 350
266 iso_pu_bacteria 2808606384 2808968302 350
267 iso_pu_bacteria 2808606390 2809003133 350
268 iso_pu_bacteria 2808606391 2809010410 350
269 iso_pu_bacteria 2883087390 2883094559 350
270 iso_pu_bacteria 8003955200 8003957316 350
271 iso_pu_bacteria 2856287931 2856293277 351
272 iso_pu_bacteria 2857357740 2857366604 351
273 iso_pu_bacteria 2904434214 2904435165 351
274 3300013306 Ga0163162_10038425 Ga0163162_100384254 352
275 3300037418 Ga0395900_0000057 Ga0395900_0000057_17464_18582 352
276 3300038443 Ga0395901_0000002 Ga0395901_0000002_100327_101457 352
277 3300046794 Ga0495589_0036133 Ga0495589_0036133_535_1596 352
278 3300001990 JGI24737J22298_10002744 JGI24737J22298_100027443 353
279 3300013105 Ga0157369_10300533 Ga0157369_103005332 353
280 3300037471 Ga0395905_0020000 Ga0395905_0020000_1655_2716 353
281 3300046690 Ga0495624_0008821 Ga0495624_0008821_883_1944 353
282 3300047322 Ga0495680_0099150 Ga0495680_0099150_974_2035 353
283 3300047673 Ga0495593_0012475 Ga0495593_0012475_1992_3053 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00633

HHH

Helix-hairpin-helix motif

141

169

0.95

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

77

212

0.95

PF14815

NUDIX_4

NUDIX domain

276

396

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1muy-assembly1.cif.gz_A-2 catalytic domain of muty from escherichia coli 0.974 6 230
1mun-assembly1.cif.gz_A-2 catalytic domain of muty from escherichia coli d138n mutant 0.9733 6 230
1kg6-assembly1.cif.gz_A crystal structure of the k142r mutant of e.coli muty (core fragment) 0.972 5 229
1kg4-assembly1.cif.gz_A crystal structure of the k142a mutant of e. coli muty (core fragment) 0.9709 5 229
1weg-assembly1.cif.gz_A catalytic domain of muty from escherichia coli k142a mutant 0.9704 5 230
ID Description Score Start End Superfamily
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9812 22 133 1.10.340.30
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9791 22 133 1.10.340.30
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9727 22 133 1.10.340.30
af_P9WQ09_31_141_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9718 22 131 1.10.340.30
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9706 22 133 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A536T635-F1-model_v4 A/G-specific adenine glycosylase 0.9945 7 116 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A353Y599-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9903 41 151 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A382TC35-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.986 7 152 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A354W022-F1-model_v4 deleted 0.9856 7 174
AF-A0A7K4E440-F1-model_v4 deleted 0.9853 5 156

Feature Viewer

pLDDT pTM Quality
92.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map