F386325

General Info

Members Datasets Scaffolds Average Seq Length
284 186 263 120

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0701009|Ga0451855_0701009_285_689
Length 134
Sequence MDPGVRQDDDWISGPILMTTLYGLKNCDTCKKATKWLDRFGVAYSFVDYRDDKRSPETLLEWSKQAGGWDTLINKSSTTWRQLPENRKTPGSEAEWKLLLREYPQLIRRPVVVTNDGVMTQGFSDNGFKKLFGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221559 Lysobacter sp. Root559 Isolate Unclassified
3 2643221573 Lysobacter sp. Root604 Isolate Unclassified
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
6 2643221586 Lysobacter sp. Root667 Isolate Unclassified
7 2643221593 Lysobacter sp. Root690 Isolate Unclassified
8 2643221612 Lysobacter sp. Root76 Isolate Unclassified
9 2643221695 Lysobacter sp. Root494 Isolate Unclassified
10 2643221720 Lysobacter sp. Root916 Isolate Unclassified
11 2643221727 Lysobacter sp. Root96 Isolate Unclassified
12 2643221728 Lysobacter sp. Root983 Isolate Unclassified
13 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
14 2818991457 Xanthomonas translucens 569 Isolate Unclassified
15 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
16 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
17 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
18 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
19 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
20 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
21 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
59 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
60 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
104 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
105 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
126 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
132 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
133 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
134 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
138 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
139 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
140 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
141 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
142 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
145 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
186 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0
Isolates 7.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.56
Nodule 0.35
Rhizoplane 13.03
Rhizosphere 54.58
Stem 0
Stem Tuber 0
Unclassified 21.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_45537 2162886007 Bacteria 3892
2 Ga0055537_1000695 3300003773 Bacteria 17497
3 Ga0055536_1001443 3300003781 Bacteria 14353
4 Ga0055536_1004015 3300003781 Bacteria 7680
5 Ga0055534_1000089 3300003784 Bacteria 71523
6 Ga0055528_1000585 3300003790 Bacteria 27488
7 Ga0055531_10009527 3300003794 Bacteria 4956
8 Ga0055531_10012914 3300003794 Bacteria 3890
9 Ga0055531_10017726 3300003794 Bacteria 2987
10 Ga0055531_10032523 3300003794 Bacteria 1702
11 Ga0058692_1000020 3300003856 Bacteria 250589
12 Ga0065714_10014443 3300005288 Bacteria 2646
13 Ga0065704_10077265 3300005289 Bacteria 4796
14 Ga0065704_10097718 3300005289 Bacteria 2382
15 Ga0065715_10027404 3300005293 Bacteria 2064
16 Ga0065715_10179389 3300005293 Bacteria 1464
17 Ga0070658_11167542 3300005327 Bacteria 669
18 Ga0070683_100606518 3300005329 Bacteria 1048
19 Ga0070670_100002284 3300005331 Bacteria 15790
20 Ga0070670_100425101 3300005331 Bacteria 1175
21 Ga0070670_100574058 3300005331 Bacteria 1008
22 Ga0070680_101420941 3300005336 Bacteria 601
23 Ga0070660_100244639 3300005339 Bacteria 1462
24 Ga0070661_100296053 3300005344 Bacteria 1259
25 Ga0070668_100016377 3300005347 Bacteria 5543
26 Ga0070668_100487614 3300005347 Bacteria 1065
27 Ga0070669_100318906 3300005353 Bacteria 1254
28 Ga0070669_100379742 3300005353 Bacteria 1152
29 Ga0070669_100504399 3300005353 Bacteria 1004
30 Ga0070675_100404968 3300005354 Bacteria 1218
31 Ga0070675_101007349 3300005354 Bacteria 765
32 Ga0070675_101010240 3300005354 Bacteria 764
33 Ga0070671_100548599 3300005355 Bacteria 997
34 Ga0070674_100014421 3300005356 Bacteria 4914
35 Ga0070674_100156286 3300005356 Bacteria 1726
36 Ga0070673_100381264 3300005364 Bacteria 1257
37 Ga0070667_100475243 3300005367 Bacteria 1144
38 Ga0068867_100069149 3300005459 Bacteria 2637
39 Ga0070679_100035870 3300005530 Bacteria 4920
40 Ga0070672_100098904 3300005543 Bacteria 2363
41 Ga0070665_100148805 3300005548 Bacteria 2344
42 Ga0070665_100839479 3300005548 Bacteria 932
43 Ga0070664_100200154 3300005564 Bacteria 1782
44 Ga0070664_100644101 3300005564 Bacteria 985
45 Ga0070664_101856322 3300005564 Bacteria 572
46 Ga0081455_10597569 3300005937 Bacteria 720
47 Ga0075365_10338552 3300006038 Bacteria 1060
48 Ga0075364_10166193 3300006051 Bacteria 1491
49 Ga0075369_10339916 3300006186 Bacteria 704
50 Ga0099826_10293116 3300006948 Bacteria 835
51 Ga0105251_10000010 3300009011 Bacteria 186242
52 Ga0105242_10422781 3300009176 Bacteria 1249
53 Ga0105242_11047910 3300009176 Bacteria 826
54 Ga0105237_12450374 3300009545 Bacteria 532
55 Ga0105249_11127088 3300009553 Bacteria 855
56 Ga0105148_102296 3300009978 Bacteria 1341
57 Ga0105028_104617 3300009993 Bacteria 1435
58 Ga0157327_1021000 3300012512 Bacteria 737
59 Ga0157327_1029941 3300012512 Bacteria 673
60 Ga0157373_10167721 3300013100 Bacteria 1545
61 Ga0157373_10183757 3300013100 Bacteria 1472
62 Ga0157373_10289349 3300013100 Bacteria 1162
63 Ga0157378_11893744 3300013297 Bacteria 645
64 Ga0157372_12865932 3300013307 Bacteria 552
65 Ga0157375_10655073 3300013308 Bacteria 1206
66 Ga0182006_1016167 3300015261 Bacteria 3186
67 Ga0182006_1039474 3300015261 Bacteria 1862
68 Ga0182006_1084283 3300015261 Bacteria 1154
69 Ga0182005_1005941 3300015265 Bacteria 3777
70 Ga0163161_10170424 3300017792 Bacteria 1664
71 Ga0163161_10320104 3300017792 Bacteria 1226
72 Ga0209565_1000014 3300025263 Bacteria 530302
73 Ga0209565_1000081 3300025263 Bacteria 155639
74 Ga0209673_1000904 3300025273 Bacteria 37938
75 Ga0209675_1000021 3300025291 Bacteria 334833
76 Ga0209676_1000024 3300025292 Bacteria 578839
77 Ga0209676_1001141 3300025292 Bacteria 29048
78 Ga0209564_1000263 3300025295 Bacteria 112148
79 Ga0209256_1008445 3300025299 Bacteria 4773
80 Ga0209256_1013844 3300025299 Bacteria 2962
81 Ga0209257_1000148 3300025304 Bacteria 193131
82 Ga0209257_1000180 3300025304 Bacteria 158090
83 Ga0209257_1003198 3300025304 Bacteria 14522
84 Ga0209257_1011237 3300025304 Bacteria 4345
85 Ga0207713_1000292 3300025735 Bacteria 57738
86 Ga0207660_10207486 3300025917 Bacteria 1533
87 Ga0207657_10212621 3300025919 Bacteria 1551
88 Ga0207657_10735056 3300025919 Bacteria 765
89 Ga0207649_10820279 3300025920 Bacteria 727
90 Ga0207652_10207414 3300025921 Bacteria 1764
91 Ga0207681_10163875 3300025923 Bacteria 1679
92 Ga0207681_10303511 3300025923 Bacteria 1264
93 Ga0207650_10017366 3300025925 Bacteria 5038
94 Ga0207650_10506661 3300025925 Bacteria 1009
95 Ga0207659_10070002 3300025926 Bacteria 2557
96 Ga0207659_10606342 3300025926 Bacteria 934
97 Ga0207659_10833893 3300025926 Bacteria 792
98 Ga0207644_10092153 3300025931 Bacteria 2260
99 Ga0207644_11515784 3300025931 Unclassified 563
100 Ga0207686_11212828 3300025934 Bacteria 618
101 Ga0207709_10003032 3300025935 Bacteria 10197
102 Ga0207669_10077698 3300025937 Bacteria 2112
103 Ga0207669_10467496 3300025937 Bacteria 1003
104 Ga0207691_10017313 3300025940 Bacteria 6835
105 Ga0207711_10889524 3300025941 Bacteria 828
106 Ga0207661_10677422 3300025944 Bacteria 948
107 Ga0207679_10160453 3300025945 Bacteria 1840
108 Ga0207679_10281904 3300025945 Bacteria 1425
109 Ga0207651_10517218 3300025960 Bacteria 1034
110 Ga0207668_10033477 3300025972 Bacteria 3404
111 Ga0207678_11529766 3300026067 Bacteria 589
112 Ga0207708_10123664 3300026075 Bacteria 2018
113 Ga0207648_10103781 3300026089 Bacteria 2493
114 Ga0207675_100736177 3300026118 Bacteria 997
115 Ga0207683_10124662 3300026121 Bacteria 2314
116 Ga0207698_11324172 3300026142 Bacteria 735
117 Ga0209371_1000011 3300027312 Bacteria 848456
118 Ga0209974_10016576 3300027876 Bacteria 2446
119 Ga0268266_10502994 3300028379 Bacteria 1157
120 Ga0268256_1000011 3300030500 Bacteria 848625
121 Ga0316177_1088878 3300030731 Bacteria 714
122 Ga0316183_1205388 3300030742 Bacteria 10997
123 Ga0316182_1194389 3300030745 Bacteria 1194
124 Ga0307513_10106433 3300031456 Bacteria 2810
125 Ga0307513_10318043 3300031456 Bacteria 1316
126 Ga0307509_10233423 3300031507 Bacteria 1640
127 Ga0307408_100814137 3300031548 Bacteria 849
128 Ga0307413_10000289 3300031824 Bacteria 15520
129 Ga0307413_10399049 3300031824 Bacteria 1077
130 Ga0307413_12013605 3300031824 Bacteria 521
131 Ga0307406_10054694 3300031901 Bacteria 2548
132 Ga0307412_10452543 3300031911 Bacteria 1058
133 Ga0307412_10462904 3300031911 Bacteria 1048
134 Ga0307414_10000721 3300032004 Bacteria 16939
135 Ga0307414_10005212 3300032004 Bacteria 7139
136 Ga0307414_10036014 3300032004 Bacteria 3299
137 Ga0307414_10098302 3300032004 Bacteria 2195
138 Ga0307414_10126961 3300032004 Bacteria 1972
139 Ga0307414_10202068 3300032004 Bacteria 1617
140 Ga0307414_12094195 3300032004 Bacteria 528
141 Ga0307411_10344972 3300032005 Bacteria 1212
142 Ga0307411_11149772 3300032005 Bacteria 702
143 Ga0373930_0121295 3300034816 Bacteria 637
144 Ga0373950_0057315 3300034818 Bacteria 776
145 Ga0373952_0016301 3300035092 Bacteria 1509
146 Ga0395899_0106209 3300037312 Bacteria 2022
147 Ga0395900_0062529 3300037418 Bacteria 3827
148 Ga0395898_0352564 3300037466 Bacteria 1403
149 Ga0395898_1085083 3300037466 Bacteria 734
150 Ga0395905_0004849 3300037471 Bacteria 13871
151 Ga0395905_0080554 3300037471 Bacteria 3051
152 Ga0395901_0005473 3300038443 Bacteria 12858
153 Ga0439436_0021100 3300041404 Bacteria 1938
154 Ga0439436_0089656 3300041404 Bacteria 856
155 Ga0439439_0021481 3300041406 Bacteria 1608
156 Ga0439465_0003871 3300041413 Bacteria 4883
157 Ga0439465_0005202 3300041413 Bacteria 4169
158 Ga0451787_060824 3300041441 Bacteria 643
159 Ga0451789_0623999 3300041443 Bacteria 527
160 Ga0451789_0933608 3300041443 Bacteria 907
161 Ga0451789_1158698 3300041443 Bacteria 775
162 Ga0451791_0110364 3300041451 Bacteria 899
163 Ga0451791_0433900 3300041451 Bacteria 2396
164 Ga0451791_0966745 3300041451 Bacteria 1141
165 Ga0451791_1834064 3300041451 Bacteria 903
166 Ga0451793_0214991 3300041452 Bacteria 641
167 Ga0451793_1248729 3300041452 Bacteria 897
168 Ga0451793_1306742 3300041452 Bacteria 1134
169 Ga0451793_1840451 3300041452 Bacteria 1179
170 Ga0451797_1011254 3300041453 Bacteria 1150
171 Ga0451797_1338363 3300041453 Bacteria 861
172 Ga0451795_0540838 3300041456 Bacteria 644
173 Ga0451795_0606275 3300041456 Bacteria 769
174 Ga0451795_0611161 3300041456 Bacteria 752
175 Ga0451800_0377454 3300041459 Bacteria 9861
176 Ga0451802_0401666 3300041460 Bacteria 863
177 Ga0451802_1860401 3300041460 Bacteria 1992
178 Ga0451806_022060 3300041462 Bacteria 1185
179 Ga0451804_0068330 3300041463 Bacteria 567
180 Ga0451807_0728605 3300041486 Bacteria 3223
181 Ga0451807_1424668 3300041486 Bacteria 3451
182 Ga0451807_2159426 3300041486 Bacteria 1191
183 Ga0451837_0026769 3300041494 Bacteria 770
184 Ga0451837_0978859 3300041494 Bacteria 1143
185 Ga0451839_0240882 3300041496 Bacteria 1539
186 Ga0451845_0974495 3300041501 Bacteria 912
187 Ga0451849_0536073 3300041505 Bacteria 590
188 Ga0451851_0936658 3300041507 Bacteria 506
189 Ga0451843_0121813 3300041509 Bacteria 693
190 Ga0451843_0618192 3300041509 Bacteria 521
191 Ga0451843_1735662 3300041509 Bacteria 1207
192 Ga0451855_0701009 3300041511 Bacteria 773
193 Ga0439431_0063497 3300041997 Bacteria 975
194 Ga0439433_0023870 3300041999 Bacteria 1377
195 Ga0439432_059151 3300042006 Bacteria 1184
196 Ga0439432_088494 3300042006 Bacteria 933
197 Ga0439449_0038233 3300042007 Bacteria 1785
198 Ga0439449_0067974 3300042007 Bacteria 1313
199 Ga0439449_0142508 3300042007 Bacteria 892
200 Ga0439462_0031002 3300042015 Bacteria 1415
201 Ga0495638_0071458 3300046460 Bacteria 2123
202 Ga0495643_0002788 3300046522 Bacteria 13352
203 Ga0495663_0014559 3300046525 Bacteria 2205
204 Ga0495663_0019984 3300046525 Bacteria 1920
205 Ga0495621_0105583 3300046539 Bacteria 1076
206 Ga0495633_0230209 3300046558 Bacteria 847
207 Ga0495656_0029373 3300046615 Bacteria 2213
208 Ga0495668_0154601 3300046616 Bacteria 1256
209 Ga0495625_0667965 3300046660 Bacteria 617
210 Ga0495661_0134847 3300046665 Bacteria 1349
211 Ga0495660_0008944 3300046810 Bacteria 5851
212 Ga0495636_0229632 3300047318 Bacteria 853
213 Ga0495672_0000308 3300047320 Bacteria 65628
214 Ga0495686_0046914 3300047472 Bacteria 2729
215 Ga0496100_0667586 3300048903 Bacteria 810
216 Ga0496101_0077156 3300048904 Bacteria 2455
217 Ga0496101_0119864 3300048904 Bacteria 1988
218 Ga0496102_0244995 3300048905 Bacteria 1690
219 Ga0496105_0554960 3300048908 Bacteria 896
220 Ga0496107_0456038 3300048910 Bacteria 949
221 Ga0496109_0044164 3300048912 Bacteria 4042
222 Ga0496109_1711119 3300048912 Bacteria 563
223 Ga0496110_0530040 3300048913 Bacteria 1071
224 Ga0496112_0772116 3300048915 Bacteria 886
225 Ga0496112_1023470 3300048915 Bacteria 745
226 Ga0496113_0032447 3300048916 Bacteria 3796
227 Ga0496116_0118807 3300048919 Bacteria 1535
228 Ga0496116_0158201 3300048919 Bacteria 1247
229 Ga0496116_0379477 3300048919 Bacteria 634
230 Ga0496117_0000921 3300048920 Bacteria 45010
231 Ga0496117_0004978 3300048920 Bacteria 14251
232 Ga0496117_0051105 3300048920 Bacteria 2925
233 Ga0496118_0005500 3300048921 Bacteria 14377
234 Ga0496118_0015060 3300048921 Bacteria 7189
235 Ga0496118_0043466 3300048921 Bacteria 3531
236 Ga0496118_0045909 3300048921 Bacteria 3403
237 Ga0496118_0495962 3300048921 Bacteria 608
238 Ga0496119_0000320 3300048922 Bacteria 67229
239 Ga0496120_0000424 3300048923 Bacteria 67451
240 Ga0496122_0000220 3300048925 Bacteria 127065
241 Ga0496122_0000680 3300048925 Bacteria 68089
242 Ga0496122_0007784 3300048925 Bacteria 11783
243 Ga0496122_0089792 3300048925 Bacteria 2099
244 Ga0496122_0234502 3300048925 Bacteria 1040
245 Ga0496123_0000151 3300048926 Bacteria 141062
246 Ga0496123_0000226 3300048926 Bacteria 113889
247 Ga0496123_0050529 3300048926 Bacteria 2777
248 Ga0496123_0076856 3300048926 Bacteria 2053
249 Ga0496123_0100315 3300048926 Bacteria 1687
250 Ga0496124_0000705 3300048927 Bacteria 54667
251 Ga0496124_0029605 3300048927 Bacteria 4875
252 Ga0496124_0032992 3300048927 Bacteria 4562
253 Ga0496124_0139727 3300048927 Bacteria 1913
254 Ga0496124_0158810 3300048927 Bacteria 1764
255 Ga0496125_0002787 3300048928 Bacteria 22098
256 Ga0496125_0017331 3300048928 Bacteria 6875
257 Ga0496126_0282293 3300048929 Bacteria 1375
258 Ga0501034_0000822 3300049571 Bacteria 46209
259 nmdc:mga00v17_354432_c1 3300050491 Bacteria 954
260 nmdc:mga0yw44_654339_c1 3300050492 Bacteria 714
261 nmdc:mga0sz30_180617_c1 3300050516 Bacteria 936
262 Ga0500644_0090554 3300053088 Bacteria 1144
263 Ga0500634_0000101 3300053161 Bacteria 33679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10318043 Ga0307513_103180432 113
2 iso_pu_bacteria 2643221559 2643819014 114
3 iso_pu_bacteria 2643221573 2643879532 114
4 iso_pu_bacteria 2643221586 2643941317 114
5 iso_pu_bacteria 2643221593 2643974419 114
6 iso_pu_bacteria 2643221612 2644080438 114
7 iso_pu_bacteria 2643221695 2644528771 114
8 iso_pu_bacteria 2643221720 2644662857 114
9 iso_pu_bacteria 2643221727 2644697051 114
10 iso_pu_bacteria 2643221728 2644698188 114
11 iso_pu_bacteria 2747842501 2748015931 114
12 iso_pu_bacteria 2818991457 2819663634 114
13 iso_pu_bacteria 2894414249 2894416074 114
14 iso_pu_bacteria 2941489479 2941489622 114
15 iso_pu_bacteria 2987605356 2987608234 114
16 iso_pu_bacteria 2995948881 2995950840 114
17 iso_pu_bacteria 2643221579 2643905681 115
18 iso_pu_bacteria 2643221581 2643913190 115
19 iso_pu_bacteria 2852649853 2852651361 115
20 iso_pu_bacteria 2919130084 2919132445 115
21 iso_pu_bacteria 2929195423 2929197087 115
22 iso_pu_bacteria 8002869464 8002871653 115
23 3300005288 Ga0065714_10014443 Ga0065714_100144432 117
24 3300005293 Ga0065715_10027404 Ga0065715_100274042 117
25 3300005293 Ga0065715_10179389 Ga0065715_101793891 117
26 3300005937 Ga0081455_10597569 Ga0081455_105975691 117
27 3300009978 Ga0105148_102296 Ga0105148_1022962 117
28 3300013308 Ga0157375_10655073 Ga0157375_106550732 117
29 3300025926 Ga0207659_10070002 Ga0207659_100700024 117
30 3300027876 Ga0209974_10016576 Ga0209974_100165762 117
31 3300030731 Ga0316177_1088878 Ga0316177_10888782 117
32 3300031507 Ga0307509_10233423 Ga0307509_102334231 117
33 3300031824 Ga0307413_10000289 Ga0307413_100002899 117
34 3300031911 Ga0307412_10462904 Ga0307412_104629042 117
35 3300032004 Ga0307414_10098302 Ga0307414_100983023 117
36 3300034816 Ga0373930_0121295 Ga0373930_0121295_164_523 117
37 3300034818 Ga0373950_0057315 Ga0373950_0057315_39_398 117
38 3300035092 Ga0373952_0016301 Ga0373952_0016301_884_1243 117
39 3300041456 Ga0451795_0540838 Ga0451795_0540838_74_427 117
40 3300041501 Ga0451845_0974495 Ga0451845_0974495_511_864 117
41 3300041509 Ga0451843_0121813 Ga0451843_0121813_64_417 117
42 3300041511 Ga0451855_0701009 Ga0451855_0701009_285_689 117
43 2162886007 SwRhRL2b_contig_45537 SwRhRL2b_1000.00005460 118
44 3300003773 Ga0055537_1000695 Ga0055537_100069513 118
45 3300003781 Ga0055536_1001443 Ga0055536_10014433 118
46 3300003781 Ga0055536_1004015 Ga0055536_10040156 118
47 3300003784 Ga0055534_1000089 Ga0055534_100008961 118
48 3300003790 Ga0055528_1000585 Ga0055528_10005858 118
49 3300003794 Ga0055531_10009527 Ga0055531_100095272 118
50 3300003794 Ga0055531_10012914 Ga0055531_100129143 118
51 3300003794 Ga0055531_10017726 Ga0055531_100177263 118
52 3300003794 Ga0055531_10032523 Ga0055531_100325232 118
53 3300003856 Ga0058692_1000020 Ga0058692_100002098 118
54 3300005289 Ga0065704_10077265 Ga0065704_100772654 118
55 3300005289 Ga0065704_10097718 Ga0065704_100977183 118
56 3300005327 Ga0070658_11167542 Ga0070658_111675422 118
57 3300005329 Ga0070683_100606518 Ga0070683_1006065182 118
58 3300005331 Ga0070670_100002284 Ga0070670_1000022844 118
59 3300005331 Ga0070670_100425101 Ga0070670_1004251012 118
60 3300005331 Ga0070670_100574058 Ga0070670_1005740582 118
61 3300005336 Ga0070680_101420941 Ga0070680_1014209411 118
62 3300005339 Ga0070660_100244639 Ga0070660_1002446392 118
63 3300005344 Ga0070661_100296053 Ga0070661_1002960531 118
64 3300005347 Ga0070668_100016377 Ga0070668_1000163773 118
65 3300005347 Ga0070668_100487614 Ga0070668_1004876142 118
66 3300005353 Ga0070669_100318906 Ga0070669_1003189061 118
67 3300005353 Ga0070669_100379742 Ga0070669_1003797422 118
68 3300005353 Ga0070669_100504399 Ga0070669_1005043992 118
69 3300005354 Ga0070675_100404968 Ga0070675_1004049682 118
70 3300005354 Ga0070675_101007349 Ga0070675_1010073491 118
71 3300005354 Ga0070675_101010240 Ga0070675_1010102402 118
72 3300005355 Ga0070671_100548599 Ga0070671_1005485992 118
73 3300005356 Ga0070674_100014421 Ga0070674_1000144213 118
74 3300005356 Ga0070674_100156286 Ga0070674_1001562862 118
75 3300005364 Ga0070673_100381264 Ga0070673_1003812642 118
76 3300005367 Ga0070667_100475243 Ga0070667_1004752432 118
77 3300005459 Ga0068867_100069149 Ga0068867_1000691493 118
78 3300005530 Ga0070679_100035870 Ga0070679_1000358703 118
79 3300005543 Ga0070672_100098904 Ga0070672_1000989042 118
80 3300005548 Ga0070665_100148805 Ga0070665_1001488052 118
81 3300005548 Ga0070665_100839479 Ga0070665_1008394792 118
82 3300005564 Ga0070664_100200154 Ga0070664_1002001543 118
83 3300005564 Ga0070664_100644101 Ga0070664_1006441012 118
84 3300005564 Ga0070664_101856322 Ga0070664_1018563222 118
85 3300006038 Ga0075365_10338552 Ga0075365_103385522 118
86 3300006051 Ga0075364_10166193 Ga0075364_101661932 118
87 3300006186 Ga0075369_10339916 Ga0075369_103399162 118
88 3300006948 Ga0099826_10293116 Ga0099826_102931162 118
89 3300009011 Ga0105251_10000010 Ga0105251_10000010121 118
90 3300009176 Ga0105242_10422781 Ga0105242_104227812 118
91 3300009176 Ga0105242_11047910 Ga0105242_110479101 118
92 3300009545 Ga0105237_12450374 Ga0105237_124503741 118
93 3300009553 Ga0105249_11127088 Ga0105249_111270882 118
94 3300009993 Ga0105028_104617 Ga0105028_1046172 118
95 3300012512 Ga0157327_1021000 Ga0157327_10210002 118
96 3300012512 Ga0157327_1029941 Ga0157327_10299412 118
97 3300013100 Ga0157373_10167721 Ga0157373_101677212 118
98 3300013100 Ga0157373_10183757 Ga0157373_101837572 118
99 3300013100 Ga0157373_10289349 Ga0157373_102893492 118
100 3300013297 Ga0157378_11893744 Ga0157378_118937442 118
101 3300013307 Ga0157372_12865932 Ga0157372_128659321 118
102 3300015261 Ga0182006_1016167 Ga0182006_10161672 118
103 3300015261 Ga0182006_1039474 Ga0182006_10394742 118
104 3300015261 Ga0182006_1084283 Ga0182006_10842832 118
105 3300015265 Ga0182005_1005941 Ga0182005_10059413 118
106 3300017792 Ga0163161_10170424 Ga0163161_101704242 118
107 3300017792 Ga0163161_10320104 Ga0163161_103201042 118
108 3300025263 Ga0209565_1000014 Ga0209565_1000014370 118
109 3300025263 Ga0209565_1000081 Ga0209565_1000081121 118
110 3300025273 Ga0209673_1000904 Ga0209673_100090414 118
111 3300025291 Ga0209675_1000021 Ga0209675_1000021119 118
112 3300025292 Ga0209676_1000024 Ga0209676_1000024504 118
113 3300025292 Ga0209676_1001141 Ga0209676_100114113 118
114 3300025295 Ga0209564_1000263 Ga0209564_1000263103 118
115 3300025299 Ga0209256_1008445 Ga0209256_10084452 118
116 3300025299 Ga0209256_1013844 Ga0209256_10138442 118
117 3300025304 Ga0209257_1000148 Ga0209257_100014873 118
118 3300025304 Ga0209257_1000180 Ga0209257_10001802 118
119 3300025304 Ga0209257_1003198 Ga0209257_10031983 118
120 3300025304 Ga0209257_1011237 Ga0209257_10112373 118
121 3300025735 Ga0207713_1000292 Ga0207713_100029248 118
122 3300025917 Ga0207660_10207486 Ga0207660_102074862 118
123 3300025919 Ga0207657_10212621 Ga0207657_102126212 118
124 3300025919 Ga0207657_10735056 Ga0207657_107350561 118
125 3300025920 Ga0207649_10820279 Ga0207649_108202792 118
126 3300025921 Ga0207652_10207414 Ga0207652_102074143 118
127 3300025923 Ga0207681_10163875 Ga0207681_101638752 118
128 3300025923 Ga0207681_10303511 Ga0207681_103035112 118
129 3300025925 Ga0207650_10017366 Ga0207650_100173664 118
130 3300025925 Ga0207650_10506661 Ga0207650_105066612 118
131 3300025926 Ga0207659_10606342 Ga0207659_106063422 118
132 3300025926 Ga0207659_10833893 Ga0207659_108338931 118
133 3300025931 Ga0207644_10092153 Ga0207644_100921532 118
134 3300025931 Ga0207644_11515784 Ga0207644_115157842 118
135 3300025934 Ga0207686_11212828 Ga0207686_112128281 118
136 3300025935 Ga0207709_10003032 Ga0207709_100030326 118
137 3300025937 Ga0207669_10077698 Ga0207669_100776982 118
138 3300025937 Ga0207669_10467496 Ga0207669_104674962 118
139 3300025940 Ga0207691_10017313 Ga0207691_100173132 118
140 3300025941 Ga0207711_10889524 Ga0207711_108895242 118
141 3300025944 Ga0207661_10677422 Ga0207661_106774222 118
142 3300025945 Ga0207679_10160453 Ga0207679_101604532 118
143 3300025945 Ga0207679_10281904 Ga0207679_102819041 118
144 3300025960 Ga0207651_10517218 Ga0207651_105172182 118
145 3300025972 Ga0207668_10033477 Ga0207668_100334773 118
146 3300026067 Ga0207678_11529766 Ga0207678_115297662 118
147 3300026075 Ga0207708_10123664 Ga0207708_101236643 118
148 3300026089 Ga0207648_10103781 Ga0207648_101037812 118
149 3300026118 Ga0207675_100736177 Ga0207675_1007361772 118
150 3300026121 Ga0207683_10124662 Ga0207683_101246623 118
151 3300026142 Ga0207698_11324172 Ga0207698_113241722 118
152 3300027312 Ga0209371_1000011 Ga0209371_1000011363 118
153 3300028379 Ga0268266_10502994 Ga0268266_105029941 118
154 3300030500 Ga0268256_1000011 Ga0268256_1000011363 118
155 3300030742 Ga0316183_1205388 Ga0316183_12053882 118
156 3300030745 Ga0316182_1194389 Ga0316182_11943892 118
157 3300031456 Ga0307513_10106433 Ga0307513_101064333 118
158 3300031548 Ga0307408_100814137 Ga0307408_1008141372 118
159 3300031824 Ga0307413_10399049 Ga0307413_103990492 118
160 3300031824 Ga0307413_12013605 Ga0307413_120136051 118
161 3300031901 Ga0307406_10054694 Ga0307406_100546942 118
162 3300031911 Ga0307412_10452543 Ga0307412_104525432 118
163 3300032004 Ga0307414_10000721 Ga0307414_100007218 118
164 3300032004 Ga0307414_10005212 Ga0307414_100052123 118
165 3300032004 Ga0307414_10036014 Ga0307414_100360142 118
166 3300032004 Ga0307414_10126961 Ga0307414_101269612 118
167 3300032004 Ga0307414_10202068 Ga0307414_102020682 118
168 3300032004 Ga0307414_12094195 Ga0307414_120941952 118
169 3300032005 Ga0307411_10344972 Ga0307411_103449722 118
170 3300032005 Ga0307411_11149772 Ga0307411_111497721 118
171 3300037312 Ga0395899_0106209 Ga0395899_0106209_524_883 118
172 3300037418 Ga0395900_0062529 Ga0395900_0062529_1321_1680 118
173 3300037466 Ga0395898_0352564 Ga0395898_0352564_768_1127 118
174 3300037466 Ga0395898_1085083 Ga0395898_1085083_17_376 118
175 3300037471 Ga0395905_0004849 Ga0395905_0004849_6511_6870 118
176 3300037471 Ga0395905_0080554 Ga0395905_0080554_2164_2526 118
177 3300038443 Ga0395901_0005473 Ga0395901_0005473_7686_8045 118
178 3300041404 Ga0439436_0021100 Ga0439436_0021100_1292_1651 118
179 3300041404 Ga0439436_0089656 Ga0439436_0089656_301_663 118
180 3300041406 Ga0439439_0021481 Ga0439439_0021481_87_446 118
181 3300041413 Ga0439465_0003871 Ga0439465_0003871_1665_2024 118
182 3300041413 Ga0439465_0005202 Ga0439465_0005202_451_810 118
183 3300041441 Ga0451787_060824 Ga0451787_060824_272_631 118
184 3300041443 Ga0451789_0623999 Ga0451789_0623999_50_409 118
185 3300041443 Ga0451789_0933608 Ga0451789_0933608_289_684 118
186 3300041443 Ga0451789_1158698 Ga0451789_1158698_360_719 118
187 3300041451 Ga0451791_0110364 Ga0451791_0110364_284_646 118
188 3300041451 Ga0451791_0433900 Ga0451791_0433900_429_788 118
189 3300041451 Ga0451791_0966745 Ga0451791_0966745_106_465 118
190 3300041451 Ga0451791_1834064 Ga0451791_1834064_431_790 118
191 3300041452 Ga0451793_0214991 Ga0451793_0214991_198_557 118
192 3300041452 Ga0451793_1248729 Ga0451793_1248729_51_410 118
193 3300041452 Ga0451793_1306742 Ga0451793_1306742_286_642 118
194 3300041452 Ga0451793_1840451 Ga0451793_1840451_25_384 118
195 3300041453 Ga0451797_1011254 Ga0451797_1011254_172_534 118
196 3300041453 Ga0451797_1338363 Ga0451797_1338363_350_709 118
197 3300041456 Ga0451795_0606275 Ga0451795_0606275_171_527 118
198 3300041456 Ga0451795_0611161 Ga0451795_0611161_245_604 118
199 3300041459 Ga0451800_0377454 Ga0451800_0377454_7132_7488 118
200 3300041460 Ga0451802_0401666 Ga0451802_0401666_319_678 118
201 3300041460 Ga0451802_1860401 Ga0451802_1860401_1442_1801 118
202 3300041462 Ga0451806_022060 Ga0451806_022060_407_763 118
203 3300041463 Ga0451804_0068330 Ga0451804_0068330_50_412 118
204 3300041486 Ga0451807_0728605 Ga0451807_0728605_1368_1724 118
205 3300041486 Ga0451807_1424668 Ga0451807_1424668_1846_2205 118
206 3300041486 Ga0451807_2159426 Ga0451807_2159426_634_993 118
207 3300041494 Ga0451837_0026769 Ga0451837_0026769_52_411 118
208 3300041494 Ga0451837_0978859 Ga0451837_0978859_45_407 118
209 3300041496 Ga0451839_0240882 Ga0451839_0240882_957_1313 118
210 3300041505 Ga0451849_0536073 Ga0451849_0536073_215_574 118
211 3300041507 Ga0451851_0936658 Ga0451851_0936658_90_449 118
212 3300041509 Ga0451843_0618192 Ga0451843_0618192_117_476 118
213 3300041509 Ga0451843_1735662 Ga0451843_1735662_190_552 118
214 3300041997 Ga0439431_0063497 Ga0439431_0063497_570_929 118
215 3300041999 Ga0439433_0023870 Ga0439433_0023870_509_871 118
216 3300042006 Ga0439432_059151 Ga0439432_059151_229_591 118
217 3300042006 Ga0439432_088494 Ga0439432_088494_313_669 118
218 3300042007 Ga0439449_0038233 Ga0439449_0038233_32_391 118
219 3300042007 Ga0439449_0067974 Ga0439449_0067974_685_1059 118
220 3300042007 Ga0439449_0142508 Ga0439449_0142508_232_591 118
221 3300042015 Ga0439462_0031002 Ga0439462_0031002_987_1346 118
222 3300046460 Ga0495638_0071458 Ga0495638_0071458_1369_1728 118
223 3300046522 Ga0495643_0002788 Ga0495643_0002788_2284_2646 118
224 3300046525 Ga0495663_0014559 Ga0495663_0014559_1249_1641 118
225 3300046525 Ga0495663_0019984 Ga0495663_0019984_815_1171 118
226 3300046539 Ga0495621_0105583 Ga0495621_0105583_143_526 118
227 3300046558 Ga0495633_0230209 Ga0495633_0230209_132_488 118
228 3300046615 Ga0495656_0029373 Ga0495656_0029373_377_739 118
229 3300046616 Ga0495668_0154601 Ga0495668_0154601_474_833 118
230 3300046660 Ga0495625_0667965 Ga0495625_0667965_134_526 118
231 3300046665 Ga0495661_0134847 Ga0495661_0134847_686_1042 118
232 3300046810 Ga0495660_0008944 Ga0495660_0008944_660_1022 118
233 3300047318 Ga0495636_0229632 Ga0495636_0229632_284_646 118
234 3300047320 Ga0495672_0000308 Ga0495672_0000308_23780_24142 118
235 3300047472 Ga0495686_0046914 Ga0495686_0046914_141_503 118
236 3300048903 Ga0496100_0667586 Ga0496100_0667586_136_495 118
237 3300048904 Ga0496101_0077156 Ga0496101_0077156_124_483 118
238 3300048904 Ga0496101_0119864 Ga0496101_0119864_1537_1896 118
239 3300048905 Ga0496102_0244995 Ga0496102_0244995_697_1074 118
240 3300048908 Ga0496105_0554960 Ga0496105_0554960_256_615 118
241 3300048910 Ga0496107_0456038 Ga0496107_0456038_102_464 118
242 3300048912 Ga0496109_0044164 Ga0496109_0044164_3223_3582 118
243 3300048912 Ga0496109_1711119 Ga0496109_1711119_100_498 118
244 3300048913 Ga0496110_0530040 Ga0496110_0530040_548_907 118
245 3300048915 Ga0496112_0772116 Ga0496112_0772116_391_750 118
246 3300048915 Ga0496112_1023470 Ga0496112_1023470_44_403 118
247 3300048916 Ga0496113_0032447 Ga0496113_0032447_3223_3582 118
248 3300048919 Ga0496116_0118807 Ga0496116_0118807_776_1132 118
249 3300048919 Ga0496116_0158201 Ga0496116_0158201_566_928 118
250 3300048919 Ga0496116_0379477 Ga0496116_0379477_72_434 118
251 3300048920 Ga0496117_0000921 Ga0496117_0000921_29998_30354 118
252 3300048920 Ga0496117_0004978 Ga0496117_0004978_3037_3399 118
253 3300048920 Ga0496117_0051105 Ga0496117_0051105_175_537 118
254 3300048921 Ga0496118_0005500 Ga0496118_0005500_4006_4368 118
255 3300048921 Ga0496118_0015060 Ga0496118_0015060_3591_3953 118
256 3300048921 Ga0496118_0043466 Ga0496118_0043466_2645_3001 118
257 3300048921 Ga0496118_0045909 Ga0496118_0045909_2598_2987 118
258 3300048921 Ga0496118_0495962 Ga0496118_0495962_125_487 118
259 3300048922 Ga0496119_0000320 Ga0496119_0000320_37007_37363 118
260 3300048923 Ga0496120_0000424 Ga0496120_0000424_37098_37454 118
261 3300048925 Ga0496122_0000220 Ga0496122_0000220_126277_126633 118
262 3300048925 Ga0496122_0000680 Ga0496122_0000680_29986_30342 118
263 3300048925 Ga0496122_0007784 Ga0496122_0007784_1087_1449 118
264 3300048925 Ga0496122_0089792 Ga0496122_0089792_190_552 118
265 3300048925 Ga0496122_0234502 Ga0496122_0234502_366_725 118
266 3300048926 Ga0496123_0000151 Ga0496123_0000151_422_778 118
267 3300048926 Ga0496123_0000226 Ga0496123_0000226_30046_30402 118
268 3300048926 Ga0496123_0050529 Ga0496123_0050529_1832_2194 118
269 3300048926 Ga0496123_0076856 Ga0496123_0076856_1099_1461 118
270 3300048926 Ga0496123_0100315 Ga0496123_0100315_593_952 118
271 3300048927 Ga0496124_0000705 Ga0496124_0000705_24393_24749 118
272 3300048927 Ga0496124_0029605 Ga0496124_0029605_3347_3709 118
273 3300048927 Ga0496124_0032992 Ga0496124_0032992_808_1170 118
274 3300048927 Ga0496124_0139727 Ga0496124_0139727_535_894 118
275 3300048927 Ga0496124_0158810 Ga0496124_0158810_1050_1412 118
276 3300048928 Ga0496125_0002787 Ga0496125_0002787_17828_18190 118
277 3300048928 Ga0496125_0017331 Ga0496125_0017331_5213_5575 118
278 3300048929 Ga0496126_0282293 Ga0496126_0282293_602_964 118
279 3300049571 Ga0501034_0000822 Ga0501034_0000822_39872_40243 118
280 3300050491 nmdc:mga00v17_354432_c1 nmdc:mga00v17_354432_c1_426_788 118
281 3300050492 nmdc:mga0yw44_654339_c1 nmdc:mga0yw44_654339_c1_337_699 118
282 3300050516 nmdc:mga0sz30_180617_c1 nmdc:mga0sz30_180617_c1_128_490 118
283 3300053088 Ga0500644_0090554 Ga0500644_0090554_73_429 118
284 3300053161 Ga0500634_0000101 Ga0500634_0000101_26473_26829 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

22

131

0.91

PF00462

Glutaredoxin

Glutaredoxin

19

72

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nv6-assembly3.cif.gz_C crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.9094 2 31
6nxv-assembly3.cif.gz_C crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9091 2 31
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9068 1 113
3zmk-assembly1.cif.gz_A anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa 0.8989 1 31
6nxv-assembly1.cif.gz_A crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.8912 2 31
ID Description Score Start End Superfamily
af_A0A1D6IL16_82_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9906 2 31 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9438 1 29 3.40.30.10
af_Q4D776_60_147_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9396 1 30 3.40.30.10
3cbuB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9238 3 31 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9069 1 116 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A126NJT2-F1-model_v4 Arsenate reductase 0.9977 1 118
AF-A0A8A6YAR3-F1-model_v4 deleted 0.9975 1 118
AF-A0A381LNV8-F1-model_v4 deleted 0.9961 1 118
AF-Z9JIK5-F1-model_v4 Arsenate reductase 0.9959 1 118
AF-A0A7Z7J3K0-F1-model_v4 Arsenate reductase 0.995 1 118

Feature Viewer

pLDDT pTM Quality
95.21 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map