F386347

General Info

Members Datasets Scaffolds Average Seq Length
284 209 569 450

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0066434|Ga0453684_0066434_1780_3288
Length 502
Sequence MVKRIGMEDEKTIITNNSQKEDLLGRNADSLTREINWFVAYLKSRLTGYFEKDKVIVPPEKEPGWVDRIINRKHEIPDPATLKLEASTNGQIIDVAMPDLTDEHSVYADFVNYYKLNSEERLVLMLAMIPNIQPHLLDVFFSVNKSLGRGYSEFGGIKGNRHGGFIPTIETALFLIAGNDLGHRFRMYRFFEPDHIFTAHNILDIDTASGGAEPYYSSSLSVTDEYVDFFTTGVFRKPQFSIDFPAKRLVTGMEWSDLVVDDFTARQLDELRIWLNHGRTLYTDWKMGKKLKPGYKVLFYGPPGTGKTLTASLLGKMFNLDVYRIDLSMVISKYIGETEKNLEKVFKRAENKNWILFFDEADALFGKRTNITDSHDKYANQEIAYLMQRLEDYPGLVIMASNMRNNVDEAFTRRLQSVIYFQKPQPKERLKIWTHAFSEESQPPGTDEMERIAQLYELSGGSIMNVVQYASLMALNRNEKIISTSDVIEGIKREYRKEGKTL

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
119 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
123 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
181 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
182 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
183 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
187 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
188 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
189 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
190 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
191 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
192 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
193 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
194 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
195 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
196 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
197 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
198 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
199 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
200 2818991444 Filimonas endophytica 3197 Isolate Unclassified
201 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
202 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
203 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
204 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
205 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
206 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
207 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
208 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
209 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.9
Metatranscriptomes 0.35
Isolates 7.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.04
Nodule 0.7
Rhizoplane 2.11
Rhizosphere 77.46
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0066434 3300044712 Bacteria 4592
2 JGI24740J21852_10015604 3300001979 Bacteria 2768
3 JGI24739J22299_10000361 3300001989 Bacteria 15587
4 JGI24739J22299_10004322 3300001989 Bacteria 5447
5 JGI24739J22299_10008440 3300001989 Bacteria 3847
6 JGI24737J22298_10000752 3300001990 Bacteria 11454
7 JGI24735J21928_10000006 3300002067 Bacteria 339303
8 JGI25154J39366_1000094 3300002738 Bacteria 79323
9 JGI25153J46596_10001418 3300003215 Bacteria 14355
10 rootH1_10050444 3300003316 Bacteria 5160
11 rootH1_10050444 3300003323 Bacteria 2324
12 rootH2_10079996 3300003320 Bacteria 3400
13 rootH2_10153819 3300003320 Bacteria 3011
14 rootL2_10066659 3300003322 Bacteria 2451
15 rootL2_10142880 3300003322 Bacteria 2896
16 rootL2_10213389 3300003322 Bacteria 3014
17 rootL2_10285628 3300003322 Bacteria 3191
18 rootH1_10167990 3300003323 Bacteria 4743
19 rootH1_10188850 3300003323 Unclassified 3844
20 rootH1_10217062 3300003323 Bacteria 3453
21 rootH1_10298268 3300003323 Bacteria 3335
22 JGI25160J50197_1007279 3300003354 Unclassified 4351
23 Ga0055535_1005603 3300003761 Unclassified 2716
24 Ga0055531_10000144 3300003794 Bacteria 82231
25 Ga0065714_10104988 3300005288 Bacteria 1574
26 Ga0070676_10027085 3300005328 Bacteria 3248
27 Ga0070666_10009708 3300005335 Bacteria 6012
28 Ga0070682_100001224 3300005337 Bacteria 14611
29 Ga0068868_100003358 3300005338 Bacteria 11136
30 Ga0070660_100013379 3300005339 Bacteria 5885
31 Ga0070660_100024410 3300005339 Bacteria 4484
32 Ga0070661_100128443 3300005344 Bacteria 1903
33 Ga0070669_100001110 3300005353 Bacteria 19649
34 Ga0070671_100061410 3300005355 Bacteria 3130
35 Ga0070673_100059976 3300005364 Bacteria 3013
36 Ga0070659_100022150 3300005366 Bacteria 4848
37 Ga0070667_100007207 3300005367 Bacteria 9242
38 Ga0070711_100009952 3300005439 Bacteria 5866
39 Ga0070678_100005857 3300005456 Bacteria 7150
40 Ga0068867_100001008 3300005459 Bacteria 19227
41 Ga0068853_100002044 3300005539 Bacteria 14948
42 Ga0068853_100007725 3300005539 Bacteria 8623
43 Ga0070686_100014391 3300005544 Bacteria 4561
44 Ga0070665_100000104 3300005548 Bacteria 158048
45 Ga0068855_100007468 3300005563 Bacteria 13237
46 Ga0068855_100030284 3300005563 Bacteria 6474
47 Ga0068855_100071281 3300005563 Bacteria 4041
48 Ga0070664_100044331 3300005564 Bacteria 3756
49 Ga0068857_100001016 3300005577 Bacteria 21644
50 Ga0068856_100000715 3300005614 Bacteria 36035
51 Ga0068856_100011321 3300005614 Bacteria 8657
52 Ga0068859_100001730 3300005617 Bacteria 22264
53 Ga0068859_100013175 3300005617 Bacteria 8303
54 Ga0068859_100137458 3300005617 Bacteria 2517
55 Ga0068864_100000848 3300005618 Bacteria 25800
56 Ga0068864_100008122 3300005618 Bacteria 8654
57 Ga0068861_100082209 3300005719 Bacteria 2524
58 Ga0068863_100003385 3300005841 Bacteria 15734
59 Ga0068858_100007377 3300005842 Bacteria 10641
60 Ga0068860_100013003 3300005843 Bacteria 8173
61 Ga0068860_100024454 3300005843 Bacteria 5835
62 Ga0068862_100006947 3300005844 Bacteria 9390
63 Ga0068862_100072053 3300005844 Bacteria 2984
64 Ga0097620_100001730 3300006931 Bacteria 22264
65 Ga0097620_100013175 3300006931 Bacteria 8303
66 Ga0097620_100137448 3300006931 Bacteria 2517
67 Ga0099824_1003034 3300006942 Bacteria 24538
68 Ga0099826_10016658 3300006948 Bacteria 5552
69 Ga0105251_10015788 3300009011 Bacteria 4111
70 Ga0105244_10000007 3300009036 Bacteria 352275
71 Ga0105240_10002097 3300009093 Bacteria 32623
72 Ga0105240_10071043 3300009093 Bacteria 4306
73 Ga0105245_10004250 3300009098 Bacteria 12702
74 Ga0105243_10133844 3300009148 Bacteria 2106
75 Ga0105242_10076675 3300009176 Bacteria 2788
76 Ga0105248_10000521 3300009177 Bacteria 43703
77 Ga0105237_10002056 3300009545 Viruses 25544
78 Ga0105237_10017894 3300009545 Bacteria 7346
79 Ga0105249_10100858 3300009553 Bacteria 2715
80 Ga0105249_10104962 3300009553 Bacteria 2663
81 Ga0105239_10000026 3300010375 Bacteria 248302
82 Ga0105239_10000642 3300010375 Bacteria 49706
83 Ga0105239_10003885 3300010375 Bacteria 18126
84 Ga0105239_10178148 3300010375 Bacteria 2378
85 Ga0105246_10217750 3300011119 Bacteria 1495
86 Ga0157373_10000122 3300013100 Bacteria 59895
87 Ga0157371_10001540 3300013102 Bacteria 23707
88 Ga0157371_10009937 3300013102 Bacteria 7448
89 Ga0157370_10011124 3300013104 Bacteria 9433
90 Ga0157370_10069999 3300013104 Unclassified 3313
91 Ga0157374_10024607 3300013296 Bacteria 5400
92 Ga0163162_10000034 3300013306 Bacteria 149611
93 Ga0163162_10039433 3300013306 Bacteria 4720
94 Ga0163162_10104557 3300013306 Bacteria 2926
95 Ga0163162_10122172 3300013306 Bacteria 2709
96 Ga0157372_10000525 3300013307 Bacteria 42377
97 Ga0157372_10001166 3300013307 Bacteria 28457
98 Ga0163163_10012728 3300014325 Bacteria 7674
99 Ga0182008_10000026 3300014497 Bacteria 182845
100 Ga0182005_1000091 3300015265 Bacteria 67859
101 Ga0213872_10000010 3300021361 Bacteria 194896
102 Ga0213872_10000798 3300021361 Bacteria 22934
103 Ga0213872_10002419 3300021361 Bacteria 10997
104 Ga0213876_10015158 3300021384 Bacteria 4083
105 Ga0209258_100081 3300025242 Bacteria 254564
106 Ga0209646_1000091 3300025246 Bacteria 188727
107 Ga0209026_1000321 3300025250 Bacteria 51102
108 Ga0209758_1013894 3300025297 Unclassified 4339
109 Ga0207426_1000193 3300025302 Bacteria 151669
110 Ga0209257_1000064 3300025304 Bacteria 356803
111 Ga0207697_10011839 3300025315 Bacteria 3677
112 Ga0207655_1000196 3300025728 Bacteria 106283
113 Ga0207688_10000364 3300025901 Bacteria 21070
114 Ga0207647_10004612 3300025904 Bacteria 10208
115 Ga0207645_10028285 3300025907 Bacteria 3619
116 Ga0207695_10073479 3300025913 Unclassified 3484
117 Ga0207695_10175934 3300025913 Bacteria 2063
118 Ga0207671_10001659 3300025914 Viruses 25316
119 Ga0207663_10010490 3300025916 Bacteria 4934
120 Ga0207657_10020111 3300025919 Bacteria 6318
121 Ga0207657_10026059 3300025919 Bacteria 5380
122 Ga0207681_10003540 3300025923 Bacteria 9723
123 Ga0207681_10152382 3300025923 Bacteria 1734
124 Ga0207687_10029302 3300025927 Bacteria 3702
125 Ga0207690_10001015 3300025932 Bacteria 17946
126 Ga0207690_10038046 3300025932 Bacteria 3128
127 Ga0207691_10000794 3300025940 Bacteria 31361
128 Ga0207711_10068516 3300025941 Bacteria 3073
129 Ga0207661_10150719 3300025944 Bacteria 2010
130 Ga0207667_10000218 3300025949 Bacteria 80364
131 Ga0207667_10006375 3300025949 Bacteria 14309
132 Ga0207667_10044986 3300025949 Bacteria 4676
133 Ga0207651_10065493 3300025960 Bacteria 2548
134 Ga0207712_10014614 3300025961 Bacteria 5055
135 Ga0207668_10005608 3300025972 Bacteria 7399
136 Ga0207639_10120160 3300026041 Bacteria 2158
137 Ga0207639_10251421 3300026041 Bacteria 1542
138 Ga0207648_10090236 3300026089 Bacteria 2677
139 Ga0207674_10002811 3300026116 Bacteria 21668
140 Ga0207683_10040091 3300026121 Bacteria 4086
141 Ga0207698_10004464 3300026142 Bacteria 8537
142 Ga0268266_10000108 3300028379 Bacteria 171915
143 Ga0268264_10110938 3300028381 Bacteria 2402
144 Ga0307517_10001231 3300028786 Bacteria 43029
145 Ga0307511_10000312 3300030521 Bacteria 51555
146 Ga0265327_10000232 3300031251 Bacteria 112743
147 Ga0265327_10000527 3300031251 Bacteria 65908
148 Ga0307408_100000322 3300031548 Bacteria 45908
149 Ga0307408_100026711 3300031548 Bacteria 3969
150 Ga0307414_10000273 3300032004 Bacteria 31228
151 Ga0307414_10001943 3300032004 Bacteria 10693
152 Ga0307414_10138174 3300032004 Bacteria 1903
153 Ga0307510_10004900 3300033180 Bacteria 15835
154 Ga0307510_10022601 3300033180 Bacteria 7301
155 Ga0307510_10055784 3300033180 Bacteria 4123
156 Ga0373926_0086475 3300035083 Bacteria 1163
157 Ga0373949_0000021 3300035090 Bacteria 56117
158 Ga0373945_0006094 3300035116 Bacteria 3880
159 Ga0316574_0070869 3300035398 Unclassified 2201
160 Ga0373924_0000108 3300035410 Bacteria 23311
161 Ga0373935_0086309 3300035692 Bacteria 2047
162 Ga0373927_0111888 3300035695 Bacteria 1779
163 Ga0373947_0007086 3300035725 Bacteria 6498
164 Ga0373947_0088578 3300035725 Bacteria 1926
165 Ga0395899_0000001 3300037312 Bacteria 1750322
166 Ga0395899_0000019 3300037312 Bacteria 411777
167 Ga0395900_0048941 3300037418 Bacteria 4354
168 Ga0395900_0091713 3300037418 Bacteria 3122
169 Ga0395905_0000487 3300037471 Bacteria 54767
170 Ga0400484_16274 3300038725 Bacteria 7293
171 Ga0400483_005327 3300039062 Bacteria 4600
172 Ga0436365_0770029 3300039437 Bacteria 32936
173 Ga0436361_0133787 3300039447 Bacteria 26763
174 Ga0436361_0319884 3300039447 Bacteria 25957
175 Ga0436361_0980098 3300039447 Bacteria 48289
176 Ga0439445_0000009 3300042004 Bacteria 25238
177 Ga0439462_0016856 3300042015 Bacteria 1891
178 Ga0451577_0000010 3300042876 Bacteria 616686
179 Ga0451577_0119383 3300042876 Bacteria 2362
180 Ga0451577_0162230 3300042876 Bacteria 2013
181 Ga0466969_0000751 3300044656 Bacteria 17584
182 Ga0453683_0003665 3300044673 Bacteria 11253
183 Ga0453683_0021569 3300044673 Bacteria 4111
184 Ga0466966_0012424 3300044684 Bacteria 5641
185 Ga0453684_0000191 3300044712 Bacteria 267816
186 Ga0453684_0000838 3300044712 Bacteria 103849
187 Ga0453684_0067336 3300044712 Bacteria 4554
188 Ga0466957_0007384 3300044842 Bacteria 6212
189 Ga0466959_0000029 3300045049 Bacteria 112104
190 Ga0451576_0000015 3300045051 Bacteria 579908
191 Ga0451576_0000088 3300045051 Bacteria 234139
192 Ga0451576_0000486 3300045051 Bacteria 87761
193 Ga0495638_0000039 3300046460 Bacteria 247726
194 Ga0495638_0010472 3300046460 Bacteria 6432
195 Ga0495653_0004662 3300046463 Bacteria 11084
196 Ga0495650_0000013 3300046471 Bacteria 611135
197 Ga0495650_0000014 3300046471 Bacteria 581606
198 Ga0495580_0034643 3300046472 Bacteria 3634
199 Ga0495585_0000081 3300046492 Bacteria 99243
200 Ga0495596_0010796 3300046500 Bacteria 3964
201 Ga0495607_0001210 3300046501 Bacteria 23231
202 Ga0495583_0002773 3300046506 Bacteria 14453
203 Ga0495606_0000020 3300046507 Bacteria 274490
204 Ga0495606_0002118 3300046507 Bacteria 24078
205 Ga0495606_0016318 3300046507 Bacteria 5669
206 Ga0495606_0026809 3300046507 Bacteria 4099
207 Ga0495606_0030089 3300046507 Bacteria 3799
208 Ga0495610_0000512 3300046512 Bacteria 39304
209 Ga0495616_0003190 3300046513 Bacteria 10573
210 Ga0495620_0000550 3300046515 Bacteria 23702
211 Ga0495628_0042534 3300046516 Bacteria 3624
212 Ga0495630_0091844 3300046517 Bacteria 2294
213 Ga0495632_0000119 3300046519 Bacteria 81170
214 Ga0495643_0043031 3300046522 Bacteria 2459
215 Ga0495648_0012220 3300046524 Bacteria 6417
216 Ga0495633_0001514 3300046558 Bacteria 17962
217 Ga0495633_0074100 3300046558 Bacteria 1587
218 Ga0495668_0000052 3300046616 Bacteria 212864
219 Ga0495668_0003338 3300046616 Bacteria 12096
220 Ga0495634_0107880 3300046642 Bacteria 1793
221 Ga0495625_0000009 3300046660 Bacteria 404954
222 Ga0495625_0012359 3300046660 Bacteria 6920
223 Ga0495635_0028593 3300046663 Bacteria 3875
224 Ga0495659_0040777 3300046664 Bacteria 1656
225 Ga0495661_0000815 3300046665 Bacteria 29282
226 Ga0495661_0018713 3300046665 Bacteria 4548
227 Ga0495661_0112387 3300046665 Bacteria 1516
228 Ga0495670_0005514 3300046691 Bacteria 6208
229 Ga0495649_0000008 3300046694 Bacteria 483706
230 Ga0495660_0007129 3300046810 Bacteria 6584
231 Ga0495660_0008332 3300046810 Bacteria 6068
232 Ga0495604_0073859 3300047317 Bacteria 2572
233 Ga0495680_0058069 3300047322 Bacteria 2991
234 Ga0495687_005229 3300047443 Bacteria 8366
235 Ga0495677_0012670 3300047445 Bacteria 3073
236 Ga0495673_0023697 3300047469 Bacteria 2980
237 Ga0495602_0036185 3300048088 Bacteria 4597
238 Ga0496105_0040502 3300048908 Bacteria 3842
239 Ga0496112_0001285 3300048915 Bacteria 19042
240 Ga0496113_0002229 3300048916 Bacteria 11190
241 Ga0496114_0000115 3300048917 Bacteria 57909
242 Ga0496115_0005585 3300048918 Bacteria 9153
243 Ga0496121_0017551 3300048924 Bacteria 7301
244 Ga0496126_0055668 3300048929 Bacteria 3577
245 Ga0501309_000079 3300049129 Bacteria 5394
246 Ga0495678_000140 3300049459 Bacteria 86985
247 Ga0501034_0074819 3300049571 Bacteria 3394
248 Ga0501217_000473 3300049661 Bacteria 6611
249 Ga0501236_000313 3300049670 Bacteria 5245
250 Ga0501249_000009 3300049679 Bacteria 173938
251 Ga0501257_000221 3300049686 Bacteria 11270
252 nmdc:mga0k408_6761_c1 3300050493 Bacteria 6116
253 Ga0500644_0000035 3300053088 Bacteria 82815
254 Ga0500562_000014 3300053108 Bacteria 146262
255 Ga0500569_000479 3300053109 Bacteria 6603
256 Ga0500577_0000507 3300053142 Bacteria 10012
257 Ga0500590_049796 3300053148 Unclassified 2132
258 Ga0500616_0000037 3300053153 Bacteria 390473
259 Ga0500622_0000203 3300053156 Bacteria 63042
260 Ga0500622_0000762 3300053156 Bacteria 28118
261 Ga0500622_0016660 3300053156 Unclassified 3925
262 Ga0500633_0005960 3300053160 Bacteria 2948
263 Ga0500611_000012 3300053727 Bacteria 137782
264 2520882509 2519899754 Bacteria 5336938
265 2522553058 2522125168 Bacteria 7376607
266 2553007319 2551306416 Bacteria 6152985
267 2585143259 2582581278 Bacteria 5296881
268 2588215193 2585428183 Bacteria 5166119
269 2588218364 2585428184 Bacteria 4978681
270 2599476934 2599185184 Bacteria 6430550
271 2644371277 2643221667 Bacteria 5627472
272 2644642511 2643221716 Bacteria 4986332
273 2691329835 2690315857 Bacteria 4396207
274 2817416570 2816332280 Bacteria 5109718
275 2819576294 2818991442 Bacteria 8318214
276 2819589052 2818991444 Bacteria 6968812
277 2852624435 2852623160 Bacteria 4376875
278 2884936696 2884933994 Bacteria 4535041
279 2928078845 2928078545 Bacteria 6534839
280 2928151477 2928147474 Bacteria 6512076
281 2929926078 2929921140 Bacteria 8649150
282 2932085504 2932082852 Bacteria 6563563
283 2958462397 2958458903 Bacteria 5301041
284 8003151902 8003151029 Bacteria 8187759
285 8055423783 8055419101 Bacteria 5289643
286 Ga0453684_0066434
287 JGI24740J21852_10015604
288 JGI24739J22299_10000361
289 JGI24739J22299_10004322
290 JGI24739J22299_10008440
291 JGI24737J22298_10000752
292 JGI24735J21928_10000006
293 JGI25154J39366_1000094
294 JGI25153J46596_10001418
295 rootH1_10050444
296 rootH2_10079996
297 rootH2_10153819
298 rootL2_10066659
299 rootL2_10142880
300 rootL2_10213389
301 rootL2_10285628
302 rootH1_10167990
303 rootH1_10188850
304 rootH1_10217062
305 rootH1_10298268
306 JGI25160J50197_1007279
307 Ga0055535_1005603
308 Ga0055531_10000144
309 Ga0065714_10104988
310 Ga0070676_10027085
311 Ga0070666_10009708
312 Ga0070682_100001224
313 Ga0068868_100003358
314 Ga0070660_100013379
315 Ga0070660_100024410
316 Ga0070661_100128443
317 Ga0070669_100001110
318 Ga0070671_100061410
319 Ga0070673_100059976
320 Ga0070659_100022150
321 Ga0070667_100007207
322 Ga0070711_100009952
323 Ga0070678_100005857
324 Ga0068867_100001008
325 Ga0068853_100002044
326 Ga0068853_100007725
327 Ga0070686_100014391
328 Ga0070665_100000104
329 Ga0068855_100007468
330 Ga0068855_100030284
331 Ga0068855_100071281
332 Ga0070664_100044331
333 Ga0068857_100001016
334 Ga0068856_100000715
335 Ga0068856_100011321
336 Ga0068859_100001730
337 Ga0068859_100013175
338 Ga0068859_100137458
339 Ga0068864_100000848
340 Ga0068864_100008122
341 Ga0068861_100082209
342 Ga0068863_100003385
343 Ga0068858_100007377
344 Ga0068860_100013003
345 Ga0068860_100024454
346 Ga0068862_100006947
347 Ga0068862_100072053
348 Ga0097620_100001730
349 Ga0097620_100013175
350 Ga0097620_100137448
351 Ga0099824_1003034
352 Ga0099826_10016658
353 Ga0105251_10015788
354 Ga0105244_10000007
355 Ga0105240_10002097
356 Ga0105240_10071043
357 Ga0105245_10004250
358 Ga0105243_10133844
359 Ga0105242_10076675
360 Ga0105248_10000521
361 Ga0105237_10002056
362 Ga0105237_10017894
363 Ga0105249_10100858
364 Ga0105249_10104962
365 Ga0105239_10000026
366 Ga0105239_10000642
367 Ga0105239_10003885
368 Ga0105239_10178148
369 Ga0105246_10217750
370 Ga0157373_10000122
371 Ga0157371_10001540
372 Ga0157371_10009937
373 Ga0157370_10011124
374 Ga0157370_10069999
375 Ga0157374_10024607
376 Ga0163162_10000034
377 Ga0163162_10039433
378 Ga0163162_10104557
379 Ga0163162_10122172
380 Ga0157372_10000525
381 Ga0157372_10001166
382 Ga0163163_10012728
383 Ga0182008_10000026
384 Ga0182005_1000091
385 Ga0213872_10000010
386 Ga0213872_10000798
387 Ga0213872_10002419
388 Ga0213876_10015158
389 Ga0209258_100081
390 Ga0209646_1000091
391 Ga0209026_1000321
392 Ga0209758_1013894
393 Ga0207426_1000193
394 Ga0209257_1000064
395 Ga0207697_10011839
396 Ga0207655_1000196
397 Ga0207688_10000364
398 Ga0207647_10004612
399 Ga0207645_10028285
400 Ga0207695_10073479
401 Ga0207695_10175934
402 Ga0207671_10001659
403 Ga0207663_10010490
404 Ga0207657_10020111
405 Ga0207657_10026059
406 Ga0207681_10003540
407 Ga0207681_10152382
408 Ga0207687_10029302
409 Ga0207690_10001015
410 Ga0207690_10038046
411 Ga0207691_10000794
412 Ga0207711_10068516
413 Ga0207661_10150719
414 Ga0207667_10000218
415 Ga0207667_10006375
416 Ga0207667_10044986
417 Ga0207651_10065493
418 Ga0207712_10014614
419 Ga0207668_10005608
420 Ga0207639_10120160
421 Ga0207639_10251421
422 Ga0207648_10090236
423 Ga0207674_10002811
424 Ga0207683_10040091
425 Ga0207698_10004464
426 Ga0268266_10000108
427 Ga0268264_10110938
428 Ga0307517_10001231
429 Ga0307511_10000312
430 Ga0265327_10000232
431 Ga0265327_10000527
432 Ga0307408_100000322
433 Ga0307408_100026711
434 Ga0307414_10000273
435 Ga0307414_10001943
436 Ga0307414_10138174
437 Ga0307510_10004900
438 Ga0307510_10022601
439 Ga0307510_10055784
440 Ga0373926_0086475
441 Ga0373949_0000021
442 Ga0373945_0006094
443 Ga0316574_0070869
444 Ga0373924_0000108
445 Ga0373935_0086309
446 Ga0373927_0111888
447 Ga0373947_0007086
448 Ga0373947_0088578
449 Ga0395899_0000001
450 Ga0395899_0000019
451 Ga0395900_0048941
452 Ga0395900_0091713
453 Ga0395905_0000487
454 Ga0400484_16274
455 Ga0400483_005327
456 Ga0436365_0770029
457 Ga0436361_0133787
458 Ga0436361_0319884
459 Ga0436361_0980098
460 Ga0439445_0000009
461 Ga0439462_0016856
462 Ga0451577_0000010
463 Ga0451577_0119383
464 Ga0451577_0162230
465 Ga0466969_0000751
466 Ga0453683_0003665
467 Ga0453683_0021569
468 Ga0466966_0012424
469 Ga0453684_0000191
470 Ga0453684_0000838
471 Ga0453684_0067336
472 Ga0466957_0007384
473 Ga0466959_0000029
474 Ga0451576_0000015
475 Ga0451576_0000088
476 Ga0451576_0000486
477 Ga0495638_0000039
478 Ga0495638_0010472
479 Ga0495653_0004662
480 Ga0495650_0000013
481 Ga0495650_0000014
482 Ga0495580_0034643
483 Ga0495585_0000081
484 Ga0495596_0010796
485 Ga0495607_0001210
486 Ga0495583_0002773
487 Ga0495606_0000020
488 Ga0495606_0002118
489 Ga0495606_0016318
490 Ga0495606_0026809
491 Ga0495606_0030089
492 Ga0495610_0000512
493 Ga0495616_0003190
494 Ga0495620_0000550
495 Ga0495628_0042534
496 Ga0495630_0091844
497 Ga0495632_0000119
498 Ga0495643_0043031
499 Ga0495648_0012220
500 Ga0495633_0001514
501 Ga0495633_0074100
502 Ga0495668_0000052
503 Ga0495668_0003338
504 Ga0495634_0107880
505 Ga0495625_0000009
506 Ga0495625_0012359
507 Ga0495635_0028593
508 Ga0495659_0040777
509 Ga0495661_0000815
510 Ga0495661_0018713
511 Ga0495661_0112387
512 Ga0495670_0005514
513 Ga0495649_0000008
514 Ga0495660_0007129
515 Ga0495660_0008332
516 Ga0495604_0073859
517 Ga0495680_0058069
518 Ga0495687_005229
519 Ga0495677_0012670
520 Ga0495673_0023697
521 Ga0495602_0036185
522 Ga0496105_0040502
523 Ga0496112_0001285
524 Ga0496113_0002229
525 Ga0496114_0000115
526 Ga0496115_0005585
527 Ga0496121_0017551
528 Ga0496126_0055668
529 Ga0501309_000079
530 Ga0495678_000140
531 Ga0501034_0074819
532 Ga0501217_000473
533 Ga0501236_000313
534 Ga0501249_000009
535 Ga0501257_000221
536 nmdc:mga0k408_6761_c1
537 Ga0500644_0000035
538 Ga0500562_000014
539 Ga0500569_000479
540 Ga0500577_0000507
541 Ga0500590_049796
542 Ga0500616_0000037
543 Ga0500622_0000203
544 Ga0500622_0000762
545 Ga0500622_0016660
546 Ga0500633_0005960
547 Ga0500611_000012
548 2520882509
549 2522553058
550 2553007319
551 2585143259
552 2588215193
553 2588218364
554 2599476934
555 2644371277
556 2644642511
557 2691329835
558 2817416570
559 2819576294
560 2819589052
561 2852624435
562 2884936696
563 2928078845
564 2928151477
565 2929926078
566 2932085504
567 2958462397
568 8003151902
569 8055423783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

297

423

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kw6-assembly1.cif.gz_A crystal structure of a domain of 26s proteasome regulatory subunit 8 from homo sapiens. northeast structural genomics consortium target id hr3102a 0.8566 359 432
2dwz-assembly1.cif.gz_B structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome 0.8461 361 431
4eiw-assembly1.cif.gz_A whole cytosolic region of atp-dependent metalloprotease ftsh (g399l) 0.8441 183 432
6hd3-assembly1.cif.gz_C common mode of remodeling aaa atpases p97/cdc48 by their disassembly cofactors aspl/pux1 0.8371 191 430
7zbh-assembly1.cif.gz_A atp-dependent zinc metalloprotease ftsh (bb0789) from borrelia burgdorferi 0.8367 190 436
ID Description Score Start End Superfamily
4eiwE02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9005 361 432 1.10.8.60
af_Q55GV8_331_404_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8961 361 432 1.10.8.60
6b5cA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8912 361 428 1.10.8.60
af_P9WQN3_333_414_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8901 361 432 1.10.8.60
af_A4ICH8_266_341_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8852 361 432 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A7J4PLV0-F1-model_v4 ATP-binding protein 0.9463 183 439 GO:0005524
GO:0016887
AF-A0A6P1MNL9-F1-model_v4 AAA family ATPase 0.9401 182 439 GO:0005524
GO:0016887
AF-A0A535N1Y7-F1-model_v4 AAA family ATPase 0.9316 183 436 GO:0005524
GO:0016887
AF-A0A132NM25-F1-model_v4 AAA+ ATPase domain-containing protein 0.9261 182 439 GO:0005524
GO:0016887
AF-A0A3A8KYM3-F1-model_v4 ATP-binding protein 0.9249 182 436 GO:0005524
GO:0016887

Map