F386366

General Info

Members Datasets Scaffolds Average Seq Length
284 184 568 256

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0000004|Ga0495641_0000004_91048_91974
Length 308
Sequence LQTLYDDCRHRLATLLREPGRDRAKRTLSRHRSGLEGRIGPATLAKGRGLQLEIVQGAAKNRLGRSPAAFAAGFACVLAALIVAAWPGAADSAPLGVVVLGKTTTTPPASCPGKVVNNVEVVPCRVEGHVSGYQTKAGGVENPYEVPFDGKIVAWSITLAKPSHTDTKTTTNEIGFFNEFLGKPSEARIGVLRPVEESKPPKFTLVRQSPLELLNPYFGSTPIFTLEHPLSVLRGQIVALTVPTWAPMFAFNVSEEDTWRGSRLEDHCASKEDIQGGHPQQGVGKIKTYGCFYSNARLLYTATLVKKP

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 12.32
Rhizosphere 81.69
Stem 0
Stem Tuber 0
Unclassified 8.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0000004 3300046461 Bacteria 210501
2 JGI25404J52841_10016745 3300003659 Bacteria 1590
3 Ga0070658_10106284 3300005327 Bacteria 2322
4 Ga0070683_100007793 3300005329 Bacteria 9067
5 Ga0070683_100034067 3300005329 Bacteria 4650
6 Ga0070683_100410294 3300005329 Bacteria 1292
7 Ga0070677_10000028 3300005333 Bacteria 43011
8 Ga0070680_100251209 3300005336 Bacteria 1495
9 Ga0068868_100000351 3300005338 Bacteria 31294
10 Ga0068868_100022098 3300005338 Bacteria 4798
11 Ga0070689_100207001 3300005340 Unclassified 1604
12 Ga0070691_10000004 3300005341 Bacteria 80156
13 Ga0070661_100000004 3300005344 Bacteria 243876
14 Ga0070668_100006626 3300005347 Bacteria 8582
15 Ga0070668_100248749 3300005347 Bacteria 1475
16 Ga0070675_100000050 3300005354 Bacteria 72016
17 Ga0070673_100031206 3300005364 Bacteria 3997
18 Ga0070688_100000161 3300005365 Bacteria 35812
19 Ga0070667_100001110 3300005367 Bacteria 24556
20 Ga0070667_100007482 3300005367 Bacteria 9063
21 Ga0070667_100110409 3300005367 Bacteria 2384
22 Ga0070714_100203502 3300005435 Unclassified 1812
23 Ga0070713_100000503 3300005436 Bacteria 24991
24 Ga0070713_100323581 3300005436 Bacteria 1424
25 Ga0070711_100019038 3300005439 Bacteria 4396
26 Ga0070700_100165846 3300005441 Unclassified 1525
27 Ga0070663_100005786 3300005455 Bacteria 7380
28 Ga0070663_100317520 3300005455 Bacteria 1252
29 Ga0070663_100602848 3300005455 Bacteria 924
30 Ga0070678_100197345 3300005456 Bacteria 1658
31 Ga0070662_100000001 3300005457 Bacteria 317995
32 Ga0070681_10013258 3300005458 Bacteria 8190
33 Ga0070685_10000010 3300005466 Bacteria 146946
34 Ga0070685_10000061 3300005466 Bacteria 63408
35 Ga0070685_10092378 3300005466 Bacteria 1834
36 Ga0070685_10473992 3300005466 Unclassified 881
37 Ga0070679_100000424 3300005530 Bacteria 35927
38 Ga0070679_100000471 3300005530 Bacteria 34374
39 Ga0070684_100199106 3300005535 Bacteria 1824
40 Ga0070672_100000031 3300005543 Bacteria 62241
41 Ga0070665_100026842 3300005548 Bacteria 5801
42 Ga0068856_100000417 3300005614 Bacteria 46946
43 Ga0068852_100000966 3300005616 Bacteria 18875
44 Ga0068852_100030458 3300005616 Bacteria 4442
45 Ga0068863_100000261 3300005841 Bacteria 55053
46 Ga0068863_100007352 3300005841 Bacteria 10782
47 Ga0068863_100082213 3300005841 Bacteria 3052
48 Ga0068858_100065985 3300005842 Bacteria 3350
49 Ga0068862_100002784 3300005844 Bacteria 15326
50 Ga0081455_10004942 3300005937 Bacteria 14737
51 Ga0081455_10016046 3300005937 Bacteria 7246
52 Ga0081540_1000868 3300005983 Bacteria 27372
53 Ga0070712_100000841 3300006175 Bacteria 18240
54 Ga0068871_100153167 3300006358 Bacteria 1967
55 Ga0075433_10005003 3300006852 Bacteria 10383
56 Ga0068865_100000499 3300006881 Bacteria 22000
57 Ga0105240_10128716 3300009093 Bacteria 3039
58 Ga0105240_10547926 3300009093 Bacteria 1280
59 Ga0105245_10000040 3300009098 Bacteria 144005
60 Ga0105245_10000314 3300009098 Bacteria 46175
61 Ga0105245_10000857 3300009098 Bacteria 27591
62 Ga0105247_10106196 3300009101 Bacteria 1801
63 Ga0105242_10000063 3300009176 Bacteria 74721
64 Ga0105248_10000037 3300009177 Bacteria 180751
65 Ga0105237_10420660 3300009545 Unclassified 1342
66 Ga0105238_10000033 3300009551 Bacteria 172981
67 Ga0105238_10089889 3300009551 Bacteria 3058
68 Ga0105249_10002088 3300009553 Bacteria 17318
69 Ga0105239_10140054 3300010375 Bacteria 2695
70 Ga0105239_10735750 3300010375 Unclassified 1129
71 Ga0105239_10745504 3300010375 Bacteria 1121
72 Ga0157371_10004888 3300013102 Bacteria 11513
73 Ga0157370_10083432 3300013104 Bacteria 3004
74 Ga0157370_10289341 3300013104 Bacteria 1513
75 Ga0157369_10001730 3300013105 Bacteria 26528
76 Ga0157374_10001797 3300013296 Bacteria 18046
77 Ga0157378_10005003 3300013297 Bacteria 11627
78 Ga0157378_10074081 3300013297 Bacteria 3063
79 Ga0163162_10195767 3300013306 Unclassified 2150
80 Ga0163162_11032126 3300013306 Unclassified 930
81 Ga0157375_10003564 3300013308 Bacteria 13514
82 Ga0157375_10373809 3300013308 Unclassified 1592
83 Ga0163163_10169818 3300014325 Bacteria 2228
84 Ga0157380_10000007 3300014326 Bacteria 157634
85 Ga0157380_11059905 3300014326 Archaea 847
86 Ga0157379_10018096 3300014968 Bacteria 6209
87 Ga0157379_10372521 3300014968 Bacteria 1309
88 Ga0206356_11122065 3300020070 Unclassified 1545
89 Ga0207680_10023503 3300025903 Bacteria 3368
90 Ga0207680_10121156 3300025903 Bacteria 1711
91 Ga0207680_10341017 3300025903 Bacteria 1051
92 Ga0207643_10042790 3300025908 Bacteria 2554
93 Ga0207705_10019730 3300025909 Bacteria 4820
94 Ga0207707_10009995 3300025912 Bacteria 8232
95 Ga0207693_10001350 3300025915 Bacteria 21696
96 Ga0207663_10013276 3300025916 Bacteria 4474
97 Ga0207657_10173758 3300025919 Bacteria 1744
98 Ga0207649_10000003 3300025920 Bacteria 388908
99 Ga0207652_10000232 3300025921 Bacteria 58473
100 Ga0207652_10000412 3300025921 Bacteria 44366
101 Ga0207694_10000012 3300025924 Bacteria 411218
102 Ga0207659_10000055 3300025926 Bacteria 74252
103 Ga0207687_10000040 3300025927 Bacteria 113598
104 Ga0207700_10000003 3300025928 Bacteria 500797
105 Ga0207664_10193710 3300025929 Unclassified 1751
106 Ga0207706_10000003 3300025933 Bacteria 345011
107 Ga0207686_10017669 3300025934 Bacteria 4022
108 Ga0207670_10248437 3300025936 Bacteria 1374
109 Ga0207704_10000104 3300025938 Bacteria 46614
110 Ga0207691_10000178 3300025940 Bacteria 60110
111 Ga0207711_10000011 3300025941 Bacteria 518817
112 Ga0207711_10309780 3300025941 Unclassified 1458
113 Ga0207661_10000858 3300025944 Bacteria 19953
114 Ga0207661_10001136 3300025944 Bacteria 17743
115 Ga0207661_10184311 3300025944 Bacteria 1826
116 Ga0207651_10021679 3300025960 Bacteria 3910
117 Ga0207712_10015646 3300025961 Bacteria 4897
118 Ga0207668_10080153 3300025972 Bacteria 2364
119 Ga0207658_10001811 3300025986 Bacteria 15995
120 Ga0207658_10097473 3300025986 Bacteria 2295
121 Ga0207677_10000304 3300026023 Bacteria 36147
122 Ga0207703_10000042 3300026035 Bacteria 161459
123 Ga0207703_10025893 3300026035 Bacteria 4616
124 Ga0207678_10255964 3300026067 Unclassified 1500
125 Ga0207708_10175343 3300026075 Unclassified 1700
126 Ga0207702_10000105 3300026078 Bacteria 97835
127 Ga0207702_10016153 3300026078 Bacteria 6180
128 Ga0207641_10000062 3300026088 Bacteria 159982
129 Ga0207641_10009398 3300026088 Bacteria 8058
130 Ga0207641_10060082 3300026088 Bacteria 3239
131 Ga0207683_10158196 3300026121 Bacteria 2047
132 Ga0207698_10000015 3300026142 Bacteria 207368
133 Ga0268266_10000526 3300028379 Bacteria 53404
134 Ga0268266_10000990 3300028379 Bacteria 35791
135 Ga0268266_10048218 3300028379 Bacteria 3651
136 Ga0268266_10423273 3300028379 Bacteria 1262
137 Ga0268265_10001768 3300028380 Bacteria 17341
138 Ga0265319_1000010 3300028563 Bacteria 188773
139 Ga0265338_10000287 3300028800 Bacteria 90818
140 Ga0265324_10073761 3300029957 Unclassified 1162
141 Ga0265325_10055681 3300031241 Bacteria 2021
142 Ga0451833_0564927 3300041491 Unclassified 1537
143 Ga0451853_0857924 3300041512 Bacteria 1177
144 Ga0439459_0022040 3300042438 Bacteria 1229
145 Ga0466963_0000141 3300044694 Bacteria 28151
146 Ga0466963_0008048 3300044694 Bacteria 6311
147 Ga0466963_0069678 3300044694 Bacteria 2364
148 Ga0466957_0001268 3300044842 Bacteria 13149
149 Ga0466960_0099545 3300044901 Bacteria 1495
150 Ga0466958_0057059 3300045836 Bacteria 2373
151 Ga0495603_0004342 3300046455 Bacteria 8457
152 Ga0495603_0040037 3300046455 Bacteria 2806
153 Ga0495629_0001042 3300046459 Bacteria 22205
154 Ga0495629_0007304 3300046459 Bacteria 8139
155 Ga0495629_0034537 3300046459 Bacteria 3575
156 Ga0495638_0012940 3300046460 Bacteria 5697
157 Ga0495641_0011142 3300046461 Bacteria 5149
158 Ga0495641_0049328 3300046461 Bacteria 1928
159 Ga0495641_0088351 3300046461 Bacteria 1386
160 Ga0495653_0043003 3300046463 Bacteria 3515
161 Ga0495653_0221132 3300046463 Unclassified 1273
162 Ga0495582_0000003 3300046473 Bacteria 168880
163 Ga0495662_0005283 3300046476 Bacteria 6470
164 Ga0495594_0000009 3300046499 Bacteria 122139
165 Ga0495606_0000017 3300046507 Bacteria 284549
166 Ga0495608_0000013 3300046511 Bacteria 228481
167 Ga0495608_0025985 3300046511 Bacteria 3996
168 Ga0495608_0181455 3300046511 Bacteria 1331
169 Ga0495628_0004134 3300046516 Bacteria 12910
170 Ga0495628_0129994 3300046516 Unclassified 1927
171 Ga0495630_0000032 3300046517 Bacteria 134425
172 Ga0495640_0037707 3300046533 Bacteria 3407
173 Ga0495640_0300306 3300046533 Bacteria 997
174 Ga0495586_0000588 3300046535 Bacteria 21115
175 Ga0495587_0017028 3300046536 Bacteria 4519
176 Ga0495587_0131836 3300046536 Bacteria 1428
177 Ga0495645_0160835 3300046543 Bacteria 1553
178 Ga0495622_0000097 3300046557 Bacteria 76953
179 Ga0495667_0144219 3300046559 Bacteria 1534
180 Ga0495634_0043009 3300046642 Bacteria 3062
181 Ga0495625_0000243 3300046660 Bacteria 85589
182 Ga0495635_0000005 3300046663 Bacteria 302178
183 Ga0495657_0000003 3300046675 Bacteria 279680
184 Ga0495657_0193515 3300046675 Unclassified 1242
185 Ga0495599_0006190 3300046678 Bacteria 7215
186 Ga0495647_0000005 3300046681 Bacteria 125996
187 Ga0495647_0000585 3300046681 Bacteria 10787
188 Ga0495658_0000001 3300046683 Bacteria 385362
189 Ga0495658_0000947 3300046683 Bacteria 15486
190 Ga0495669_0023053 3300046684 Unclassified 2707
191 Ga0495613_0001632 3300046689 Bacteria 17071
192 Ga0495613_0245736 3300046689 Bacteria 1250
193 Ga0495613_0348013 3300046689 Bacteria 1018
194 Ga0495624_0000400 3300046690 Bacteria 34373
195 Ga0495649_0007318 3300046694 Bacteria 6747
196 Ga0495604_0011043 3300047317 Bacteria 7167
197 Ga0495674_0000039 3300047319 Bacteria 97645
198 Ga0495676_0000499 3300047321 Bacteria 32193
199 Ga0495676_0009604 3300047321 Bacteria 8807
200 Ga0495676_0027699 3300047321 Bacteria 4856
201 Ga0495676_0319018 3300047321 Bacteria 1044
202 Ga0495680_0001001 3300047322 Bacteria 31451
203 Ga0495680_0007824 3300047322 Bacteria 9762
204 Ga0495680_0014672 3300047322 Bacteria 6777
205 Ga0495680_0157522 3300047322 Unclassified 1651
206 Ga0495675_0000002 3300047444 Bacteria 216469
207 Ga0495686_0204312 3300047472 Bacteria 1132
208 Ga0495602_0004130 3300048088 Bacteria 15127
209 Ga0495614_0115789 3300048089 Bacteria 1179
210 Ga0496100_0000001 3300048903 Bacteria 530179
211 Ga0496100_0000024 3300048903 Bacteria 116138
212 Ga0496101_0000028 3300048904 Bacteria 198664
213 Ga0496101_0000072 3300048904 Bacteria 116138
214 Ga0496102_0000129 3300048905 Bacteria 104478
215 Ga0496103_0000087 3300048906 Bacteria 104566
216 Ga0496103_0019977 3300048906 Bacteria 4023
217 Ga0496104_0000010 3300048907 Bacteria 475255
218 Ga0496105_0000003 3300048908 Bacteria 713251
219 Ga0496105_0000005 3300048908 Bacteria 475797
220 Ga0496105_0000051 3300048908 Bacteria 90365
221 Ga0496106_0000040 3300048909 Bacteria 108754
222 Ga0496106_0000218 3300048909 Bacteria 40075
223 Ga0496107_0000002 3300048910 Bacteria 320871
224 Ga0496107_0000025 3300048910 Bacteria 116138
225 Ga0496107_0339004 3300048910 Bacteria 1119
226 Ga0496108_0000004 3300048911 Bacteria 545055
227 Ga0496108_0091732 3300048911 Bacteria 2582
228 Ga0496109_0000002 3300048912 Bacteria 443393
229 Ga0496109_0000013 3300048912 Bacteria 227469
230 Ga0496109_0000221 3300048912 Bacteria 56054
231 Ga0496109_0183280 3300048912 Bacteria 1967
232 Ga0496109_0429519 3300048912 Bacteria 1248
233 Ga0496110_0000052 3300048913 Bacteria 58549
234 Ga0496110_0324130 3300048913 Archaea 1403
235 Ga0496111_0000209 3300048914 Bacteria 27572
236 Ga0496111_0053225 3300048914 Bacteria 2924
237 Ga0496112_0001298 3300048915 Bacteria 18986
238 Ga0496113_0000005 3300048916 Bacteria 105956
239 Ga0496113_0020317 3300048916 Bacteria 4667
240 Ga0496113_0041537 3300048916 Bacteria 3394
241 Ga0496114_0000003 3300048917 Bacteria 630981
242 Ga0496114_0252513 3300048917 Unclassified 1552
243 Ga0496114_0263236 3300048917 Unclassified 1519
244 Ga0496115_0000827 3300048918 Bacteria 22678
245 Ga0496116_0001008 3300048919 Bacteria 34374
246 Ga0496117_0005005 3300048920 Bacteria 14213
247 Ga0496118_0001859 3300048921 Bacteria 30197
248 Ga0496118_0124550 3300048921 Bacteria 1671
249 Ga0496119_0016268 3300048922 Bacteria 5671
250 Ga0496119_0042709 3300048922 Bacteria 2872
251 Ga0496121_0034660 3300048924 Bacteria 4540
252 Ga0496124_0072100 3300048927 Bacteria 2861
253 Ga0496125_0034478 3300048928 Bacteria 4461
254 Ga0496126_0049280 3300048929 Bacteria 3846
255 Ga0496126_0059005 3300048929 Bacteria 3457
256 Ga0496126_0534768 3300048929 Unclassified 932
257 Ga0501042_0083910 3300049578 Bacteria 2284
258 Ga0501047_0028630 3300049581 Bacteria 5372
259 Ga0501047_0080012 3300049581 Bacteria 3141
260 Ga0501070_0011670 3300049586 Bacteria 7419
261 Ga0501070_0119252 3300049586 Bacteria 2180
262 Ga0501071_0039163 3300049587 Bacteria 3390
263 Ga0501072_0135569 3300049588 Bacteria 1963
264 Ga0501074_0053349 3300049590 Bacteria 2916
265 Ga0501079_0172713 3300049741 Bacteria 1685
266 Ga0501080_0144474 3300049742 Bacteria 2199
267 Ga0501083_0023359 3300049744 Bacteria 4288
268 Ga0501044_0047186 3300049823 Bacteria 4456
269 Ga0501044_0327166 3300049823 Bacteria 1456
270 Ga0501045_0470319 3300049824 Unclassified 934
271 Ga0495601_0011184 3300053077 Bacteria 5360
272 Ga0495601_0021771 3300053077 Bacteria 3928
273 Ga0495601_0369403 3300053077 Bacteria 932
274 Ga0495612_0005622 3300053078 Bacteria 5180
275 Ga0495655_0000910 3300053083 Bacteria 4599
276 Ga0495595_0000007 3300053084 Bacteria 228504
277 Ga0495619_0000001 3300053085 Bacteria 586054
278 Ga0495619_0000026 3300053085 Bacteria 167387
279 Ga0495619_0000506 3300053085 Bacteria 25971
280 Ga0495619_0005677 3300053085 Bacteria 7913
281 Ga0495619_0009392 3300053085 Bacteria 6171
282 Ga0500566_0016672 3300053094 Bacteria 4311
283 Ga0500641_0020522 3300053096 Bacteria 2509
284 Ga0500614_000156 3300053123 Bacteria 17306
285 Ga0495641_0000004
286 JGI25404J52841_10016745
287 Ga0070658_10106284
288 Ga0070683_100007793
289 Ga0070683_100034067
290 Ga0070683_100410294
291 Ga0070677_10000028
292 Ga0070680_100251209
293 Ga0068868_100000351
294 Ga0068868_100022098
295 Ga0070689_100207001
296 Ga0070691_10000004
297 Ga0070661_100000004
298 Ga0070668_100006626
299 Ga0070668_100248749
300 Ga0070675_100000050
301 Ga0070673_100031206
302 Ga0070688_100000161
303 Ga0070667_100001110
304 Ga0070667_100007482
305 Ga0070667_100110409
306 Ga0070714_100203502
307 Ga0070713_100000503
308 Ga0070713_100323581
309 Ga0070711_100019038
310 Ga0070700_100165846
311 Ga0070663_100005786
312 Ga0070663_100317520
313 Ga0070663_100602848
314 Ga0070678_100197345
315 Ga0070662_100000001
316 Ga0070681_10013258
317 Ga0070685_10000010
318 Ga0070685_10000061
319 Ga0070685_10092378
320 Ga0070685_10473992
321 Ga0070679_100000424
322 Ga0070679_100000471
323 Ga0070684_100199106
324 Ga0070672_100000031
325 Ga0070665_100026842
326 Ga0068856_100000417
327 Ga0068852_100000966
328 Ga0068852_100030458
329 Ga0068863_100000261
330 Ga0068863_100007352
331 Ga0068863_100082213
332 Ga0068858_100065985
333 Ga0068862_100002784
334 Ga0081455_10004942
335 Ga0081455_10016046
336 Ga0081540_1000868
337 Ga0070712_100000841
338 Ga0068871_100153167
339 Ga0075433_10005003
340 Ga0068865_100000499
341 Ga0105240_10128716
342 Ga0105240_10547926
343 Ga0105245_10000040
344 Ga0105245_10000314
345 Ga0105245_10000857
346 Ga0105247_10106196
347 Ga0105242_10000063
348 Ga0105248_10000037
349 Ga0105237_10420660
350 Ga0105238_10000033
351 Ga0105238_10089889
352 Ga0105249_10002088
353 Ga0105239_10140054
354 Ga0105239_10735750
355 Ga0105239_10745504
356 Ga0157371_10004888
357 Ga0157370_10083432
358 Ga0157370_10289341
359 Ga0157369_10001730
360 Ga0157374_10001797
361 Ga0157378_10005003
362 Ga0157378_10074081
363 Ga0163162_10195767
364 Ga0163162_11032126
365 Ga0157375_10003564
366 Ga0157375_10373809
367 Ga0163163_10169818
368 Ga0157380_10000007
369 Ga0157380_11059905
370 Ga0157379_10018096
371 Ga0157379_10372521
372 Ga0206356_11122065
373 Ga0207680_10023503
374 Ga0207680_10121156
375 Ga0207680_10341017
376 Ga0207643_10042790
377 Ga0207705_10019730
378 Ga0207707_10009995
379 Ga0207693_10001350
380 Ga0207663_10013276
381 Ga0207657_10173758
382 Ga0207649_10000003
383 Ga0207652_10000232
384 Ga0207652_10000412
385 Ga0207694_10000012
386 Ga0207659_10000055
387 Ga0207687_10000040
388 Ga0207700_10000003
389 Ga0207664_10193710
390 Ga0207706_10000003
391 Ga0207686_10017669
392 Ga0207670_10248437
393 Ga0207704_10000104
394 Ga0207691_10000178
395 Ga0207711_10000011
396 Ga0207711_10309780
397 Ga0207661_10000858
398 Ga0207661_10001136
399 Ga0207661_10184311
400 Ga0207651_10021679
401 Ga0207712_10015646
402 Ga0207668_10080153
403 Ga0207658_10001811
404 Ga0207658_10097473
405 Ga0207677_10000304
406 Ga0207703_10000042
407 Ga0207703_10025893
408 Ga0207678_10255964
409 Ga0207708_10175343
410 Ga0207702_10000105
411 Ga0207702_10016153
412 Ga0207641_10000062
413 Ga0207641_10009398
414 Ga0207641_10060082
415 Ga0207683_10158196
416 Ga0207698_10000015
417 Ga0268266_10000526
418 Ga0268266_10000990
419 Ga0268266_10048218
420 Ga0268266_10423273
421 Ga0268265_10001768
422 Ga0265319_1000010
423 Ga0265338_10000287
424 Ga0265324_10073761
425 Ga0265325_10055681
426 Ga0451833_0564927
427 Ga0451853_0857924
428 Ga0439459_0022040
429 Ga0466963_0000141
430 Ga0466963_0008048
431 Ga0466963_0069678
432 Ga0466957_0001268
433 Ga0466960_0099545
434 Ga0466958_0057059
435 Ga0495603_0004342
436 Ga0495603_0040037
437 Ga0495629_0001042
438 Ga0495629_0007304
439 Ga0495629_0034537
440 Ga0495638_0012940
441 Ga0495641_0011142
442 Ga0495641_0049328
443 Ga0495641_0088351
444 Ga0495653_0043003
445 Ga0495653_0221132
446 Ga0495582_0000003
447 Ga0495662_0005283
448 Ga0495594_0000009
449 Ga0495606_0000017
450 Ga0495608_0000013
451 Ga0495608_0025985
452 Ga0495608_0181455
453 Ga0495628_0004134
454 Ga0495628_0129994
455 Ga0495630_0000032
456 Ga0495640_0037707
457 Ga0495640_0300306
458 Ga0495586_0000588
459 Ga0495587_0017028
460 Ga0495587_0131836
461 Ga0495645_0160835
462 Ga0495622_0000097
463 Ga0495667_0144219
464 Ga0495634_0043009
465 Ga0495625_0000243
466 Ga0495635_0000005
467 Ga0495657_0000003
468 Ga0495657_0193515
469 Ga0495599_0006190
470 Ga0495647_0000005
471 Ga0495647_0000585
472 Ga0495658_0000001
473 Ga0495658_0000947
474 Ga0495669_0023053
475 Ga0495613_0001632
476 Ga0495613_0245736
477 Ga0495613_0348013
478 Ga0495624_0000400
479 Ga0495649_0007318
480 Ga0495604_0011043
481 Ga0495674_0000039
482 Ga0495676_0000499
483 Ga0495676_0009604
484 Ga0495676_0027699
485 Ga0495676_0319018
486 Ga0495680_0001001
487 Ga0495680_0007824
488 Ga0495680_0014672
489 Ga0495680_0157522
490 Ga0495675_0000002
491 Ga0495686_0204312
492 Ga0495602_0004130
493 Ga0495614_0115789
494 Ga0496100_0000001
495 Ga0496100_0000024
496 Ga0496101_0000028
497 Ga0496101_0000072
498 Ga0496102_0000129
499 Ga0496103_0000087
500 Ga0496103_0019977
501 Ga0496104_0000010
502 Ga0496105_0000003
503 Ga0496105_0000005
504 Ga0496105_0000051
505 Ga0496106_0000040
506 Ga0496106_0000218
507 Ga0496107_0000002
508 Ga0496107_0000025
509 Ga0496107_0339004
510 Ga0496108_0000004
511 Ga0496108_0091732
512 Ga0496109_0000002
513 Ga0496109_0000013
514 Ga0496109_0000221
515 Ga0496109_0183280
516 Ga0496109_0429519
517 Ga0496110_0000052
518 Ga0496110_0324130
519 Ga0496111_0000209
520 Ga0496111_0053225
521 Ga0496112_0001298
522 Ga0496113_0000005
523 Ga0496113_0020317
524 Ga0496113_0041537
525 Ga0496114_0000003
526 Ga0496114_0252513
527 Ga0496114_0263236
528 Ga0496115_0000827
529 Ga0496116_0001008
530 Ga0496117_0005005
531 Ga0496118_0001859
532 Ga0496118_0124550
533 Ga0496119_0016268
534 Ga0496119_0042709
535 Ga0496121_0034660
536 Ga0496124_0072100
537 Ga0496125_0034478
538 Ga0496126_0049280
539 Ga0496126_0059005
540 Ga0496126_0534768
541 Ga0501042_0083910
542 Ga0501047_0028630
543 Ga0501047_0080012
544 Ga0501070_0011670
545 Ga0501070_0119252
546 Ga0501071_0039163
547 Ga0501072_0135569
548 Ga0501074_0053349
549 Ga0501079_0172713
550 Ga0501080_0144474
551 Ga0501083_0023359
552 Ga0501044_0047186
553 Ga0501044_0327166
554 Ga0501045_0470319
555 Ga0495601_0011184
556 Ga0495601_0021771
557 Ga0495601_0369403
558 Ga0495612_0005622
559 Ga0495655_0000910
560 Ga0495595_0000007
561 Ga0495619_0000001
562 Ga0495619_0000026
563 Ga0495619_0000506
564 Ga0495619_0005677
565 Ga0495619_0009392
566 Ga0500566_0016672
567 Ga0500641_0020522
568 Ga0500614_000156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wja-assembly1.cif.gz_A crystal structure of h107a peptidylglycine alpha-hydroxylating monooxygenase (phm) in complex with citrate 0.5758 90 186
7m22-assembly1.cif.gz_N cryo-em structure of the hcmv pentamer bound by human neuropilin 2 0.5732 91 186
3mll-assembly1.cif.gz_A reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound azide 0.5712 90 186
6amp-assembly1.cif.gz_A crystal structure of h172a phm (cuh absent, cum present) 0.5508 90 186
4e4z-assembly1.cif.gz_A oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) in complex with hydrogen peroxide (1.98 a) 0.5403 90 186
ID Description Score Start End Superfamily
af_A6NHM9_346_491_2.60.120.230 Mainly Beta;Sandwich;Jelly Rolls; 0.6177 95 186 2.60.120.230
af_Q9XTQ6_414_569_2.60.120.230 Mainly Beta;Sandwich;Jelly Rolls; 0.6093 90 186 2.60.120.230
af_Q965Y9_1049_1206_2.60.120.820 Mainly Beta;Sandwich;Jelly Rolls;PHR domain 0.6017 90 186 2.60.120.820
af_P09172_367_524_2.60.120.230 Mainly Beta;Sandwich;Jelly Rolls; 0.5834 90 186 2.60.120.230
af_P83388_171_319_2.60.120.230 Mainly Beta;Sandwich;Jelly Rolls; 0.539 90 186 2.60.120.230
ID Description Score Start End GO Terms
AF-A0A7X8XEF6-F1-model_v4 Uncharacterized protein 0.8115 91 186
AF-A0A1M3BF56-F1-model_v4 Uncharacterized protein 0.7918 33 254
AF-A0A7W0RDC9-F1-model_v4 DUF4384 domain-containing protein 0.7835 36 254
AF-A0A7V9GUX4-F1-model_v4 DUF4384 domain-containing protein 0.7821 36 254
AF-A0A7W1RS13-F1-model_v4 Uncharacterized protein 0.7792 36 252

Map