F386400

General Info

Members Datasets Scaffolds Average Seq Length
284 200 284 178

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0162343|Ga0495602_0162343_537_1163
Length 208
Sequence MIVVGALAMFRTSAASGTVAYDGDLHREYEMGRFHWKPDTYAELIRSEVPRYDELQAQAIAAIPFAPERVLELGMGTGETTRRLIEAYPDAWVIGLDSSADMVFRARENYDDVQLARIEDPLPEGPWDLVIGVLSIHHLRSEQKKNLFRQVQAQARSFVIGDIVKADVQVAPIDEDYDFPETAEDLAEWCGGEIAWQADDLAVVRAVY

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 7.75
Rhizosphere 81.69
Stem 0
Stem Tuber 0
Unclassified 7.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005084 3300001979 Bacteria 5585
2 JGI25406J46586_10025849 3300003203 Bacteria 2272
3 JGI25404J52841_10062324 3300003659 Unclassified 781
4 Ga0070658_10550740 3300005327 Unclassified 998
5 Ga0070683_100057120 3300005329 Bacteria 3625
6 Ga0070683_100174328 3300005329 Bacteria 2042
7 Ga0070683_100213428 3300005329 Bacteria 1834
8 Ga0070683_100829442 3300005329 Bacteria 887
9 Ga0070690_100148151 3300005330 Unclassified 1599
10 Ga0070666_10058756 3300005335 Bacteria 2601
11 Ga0070666_10080898 3300005335 Bacteria 2220
12 Ga0070680_101050349 3300005336 Bacteria 704
13 Ga0070682_100000093 3300005337 Bacteria 81568
14 Ga0068868_100000954 3300005338 Bacteria 19677
15 Ga0070689_100159044 3300005340 Unclassified 1825
16 Ga0070661_100000223 3300005344 Bacteria 46956
17 Ga0070661_101457545 3300005344 Unclassified 577
18 Ga0070692_10014722 3300005345 Bacteria 3682
19 Ga0070668_100010228 3300005347 Bacteria 6960
20 Ga0070668_100133371 3300005347 Unclassified 1995
21 Ga0070675_100000028 3300005354 Bacteria 103914
22 Ga0070688_100008903 3300005365 Bacteria 5465
23 Ga0070688_100009114 3300005365 Bacteria 5412
24 Ga0070688_100050577 3300005365 Bacteria 2589
25 Ga0070659_100009280 3300005366 Bacteria 7221
26 Ga0070667_100003792 3300005367 Bacteria 12859
27 Ga0070667_100025536 3300005367 Bacteria 4911
28 Ga0070713_100000079 3300005436 Bacteria 60238
29 Ga0070711_100053891 3300005439 Bacteria 2774
30 Ga0070663_100001353 3300005455 Bacteria 13394
31 Ga0070678_100002218 3300005456 Bacteria 10560
32 Ga0070681_10183569 3300005458 Bacteria 2013
33 Ga0070685_10000139 3300005466 Bacteria 46837
34 Ga0070685_10007283 3300005466 Bacteria 5658
35 Ga0070679_100004881 3300005530 Bacteria 12369
36 Ga0070684_100068043 3300005535 Bacteria 3129
37 Ga0070672_100000478 3300005543 Bacteria 23263
38 Ga0070665_100053277 3300005548 Bacteria 4057
39 Ga0070665_100082196 3300005548 Bacteria 3226
40 Ga0070665_100160048 3300005548 Bacteria 2253
41 Ga0070665_100521456 3300005548 Bacteria 1200
42 Ga0070665_101037928 3300005548 Unclassified 832
43 Ga0070704_100403534 3300005549 Unclassified 1167
44 Ga0068855_101133457 3300005563 Unclassified 816
45 Ga0070664_100045538 3300005564 Bacteria 3704
46 Ga0068857_101336570 3300005577 Unclassified 696
47 Ga0068854_100000065 3300005578 Bacteria 76046
48 Ga0068856_100010580 3300005614 Bacteria 8961
49 Ga0068856_100020967 3300005614 Bacteria 6350
50 Ga0068856_101326775 3300005614 Unclassified 735
51 Ga0068852_100000094 3300005616 Bacteria 59653
52 Ga0068852_101098042 3300005616 Bacteria 816
53 Ga0068851_10031956 3300005834 Bacteria 2617
54 Ga0068851_10059982 3300005834 Bacteria 1947
55 Ga0068863_100351222 3300005841 Unclassified 1436
56 Ga0068858_100423151 3300005842 Bacteria 1281
57 Ga0068860_100082859 3300005843 Bacteria 3050
58 Ga0068862_100000891 3300005844 Bacteria 28985
59 Ga0081455_10037133 3300005937 Bacteria 4330
60 Ga0081540_1000063 3300005983 Bacteria 119510
61 Ga0081540_1062369 3300005983 Bacteria 1771
62 Ga0081539_10002182 3300005985 Bacteria 28755
63 Ga0075365_10152042 3300006038 Bacteria 1610
64 Ga0075363_100086583 3300006048 Bacteria 1720
65 Ga0070715_10079727 3300006163 Bacteria 1483
66 Ga0070712_100037115 3300006175 Bacteria 3319
67 Ga0075367_10289361 3300006178 Bacteria 1031
68 Ga0075430_100019946 3300006846 Bacteria 5705
69 Ga0068865_100000013 3300006881 Bacteria 141352
70 Ga0105245_10000353 3300009098 Bacteria 42813
71 Ga0105245_10006607 3300009098 Bacteria 10182
72 Ga0105247_10001040 3300009101 Bacteria 20849
73 Ga0105247_10161895 3300009101 Bacteria 1482
74 Ga0105247_10291545 3300009101 Bacteria 1129
75 Ga0105243_10025053 3300009148 Bacteria 4556
76 Ga0105241_10174345 3300009174 Bacteria 1778
77 Ga0105242_10001790 3300009176 Bacteria 16949
78 Ga0105248_10000008 3300009177 Bacteria 403910
79 Ga0105237_10093605 3300009545 Bacteria 2994
80 Ga0105238_10950779 3300009551 Unclassified 879
81 Ga0105249_10004494 3300009553 Bacteria 12059
82 Ga0105239_10036617 3300010375 Bacteria 5387
83 Ga0105239_10244813 3300010375 Bacteria 2013
84 Ga0157371_10074925 3300013102 Bacteria 2397
85 Ga0157369_10000078 3300013105 Bacteria 135173
86 Ga0157369_10900452 3300013105 Bacteria 907
87 Ga0157378_10004090 3300013297 Bacteria 12887
88 Ga0157378_10061319 3300013297 Bacteria 3356
89 Ga0157378_10141409 3300013297 Bacteria 2235
90 Ga0163162_10651797 3300013306 Unclassified 1177
91 Ga0157372_10000882 3300013307 Bacteria 32603
92 Ga0157380_10000048 3300014326 Bacteria 71591
93 Ga0157380_10321048 3300014326 Archaea 1436
94 Ga0157379_10052131 3300014968 Bacteria 3654
95 Ga0157379_10119476 3300014968 Bacteria 2370
96 Ga0157379_10521777 3300014968 Bacteria 1103
97 Ga0157376_10210519 3300014969 Bacteria 1795
98 Ga0207656_10068994 3300025321 Unclassified 1568
99 Ga0207710_10000461 3300025900 Bacteria 26087
100 Ga0207710_10469466 3300025900 Unclassified 651
101 Ga0207710_10503653 3300025900 Archaea 628
102 Ga0207680_10052862 3300025903 Bacteria 2436
103 Ga0207680_10064227 3300025903 Bacteria 2250
104 Ga0207645_10530659 3300025907 Bacteria 798
105 Ga0207705_10565588 3300025909 Unclassified 884
106 Ga0207705_10675051 3300025909 Unclassified 803
107 Ga0207654_10240899 3300025911 Bacteria 1208
108 Ga0207707_10093034 3300025912 Bacteria 2634
109 Ga0207693_10150451 3300025915 Bacteria 1830
110 Ga0207663_10082886 3300025916 Bacteria 2105
111 Ga0207660_10582951 3300025917 Bacteria 910
112 Ga0207649_10000028 3300025920 Bacteria 161482
113 Ga0207652_10016040 3300025921 Bacteria 6109
114 Ga0207650_10436431 3300025925 Unclassified 1088
115 Ga0207659_10000022 3300025926 Bacteria 143432
116 Ga0207687_10000031 3300025927 Bacteria 150246
117 Ga0207687_10000412 3300025927 Bacteria 29013
118 Ga0207700_10000007 3300025928 Bacteria 345720
119 Ga0207700_10024646 3300025928 Bacteria 4167
120 Ga0207690_10113184 3300025932 Bacteria 1958
121 Ga0207686_10001902 3300025934 Bacteria 11565
122 Ga0207709_10013481 3300025935 Bacteria 4509
123 Ga0207670_10179525 3300025936 Unclassified 1594
124 Ga0207704_10000040 3300025938 Bacteria 90178
125 Ga0207691_10002148 3300025940 Bacteria 19308
126 Ga0207711_10000006 3300025941 Bacteria 792692
127 Ga0207661_10000932 3300025944 Bacteria 19219
128 Ga0207661_10001689 3300025944 Bacteria 15060
129 Ga0207661_10146288 3300025944 Bacteria 2039
130 Ga0207661_11002215 3300025944 Bacteria 769
131 Ga0207679_10064387 3300025945 Bacteria 2740
132 Ga0207667_10813599 3300025949 Unclassified 930
133 Ga0207712_10008727 3300025961 Bacteria 6412
134 Ga0207668_10001873 3300025972 Bacteria 12291
135 Ga0207640_10000076 3300025981 Bacteria 76366
136 Ga0207677_10020718 3300026023 Bacteria 3999
137 Ga0207639_10165889 3300026041 Bacteria 1866
138 Ga0207678_10013933 3300026067 Bacteria 7066
139 Ga0207678_10268249 3300026067 Viruses 1463
140 Ga0207702_10002433 3300026078 Bacteria 17660
141 Ga0207702_10004702 3300026078 Bacteria 12068
142 Ga0207674_10313145 3300026116 Unclassified 1519
143 Ga0207683_10110891 3300026121 Bacteria 2456
144 Ga0207698_10000013 3300026142 Bacteria 255414
145 Ga0268266_10000114 3300028379 Bacteria 166519
146 Ga0268266_10009265 3300028379 Bacteria 8683
147 Ga0268266_10125077 3300028379 Bacteria 2293
148 Ga0268265_10010990 3300028380 Bacteria 6115
149 Ga0268264_10042767 3300028381 Bacteria 3751
150 Ga0316575_10161080 3300031665 Bacteria 928
151 Ga0307415_100156368 3300032126 Bacteria 1761
152 Ga0395901_1347845 3300038443 Unclassified 674
153 Ga0466968_0397704 3300044735 Unclassified 675
154 Ga0466957_0078283 3300044842 Bacteria 2055
155 Ga0466958_0283552 3300045836 Unclassified 1062
156 Ga0466967_0000019 3300045976 Bacteria 79629
157 Ga0495592_0286633 3300046454 Bacteria 1075
158 Ga0495629_0043972 3300046459 Bacteria 3135
159 Ga0495638_0033423 3300046460 Bacteria 3290
160 Ga0495594_0000010 3300046499 Bacteria 118481
161 Ga0495606_0000108 3300046507 Bacteria 140473
162 Ga0495608_0000023 3300046511 Bacteria 160090
163 Ga0495628_0162299 3300046516 Unclassified 1698
164 Ga0495630_0000012 3300046517 Bacteria 223330
165 Ga0495632_0109363 3300046519 Unclassified 1299
166 Ga0495652_0000023 3300046529 Bacteria 168049
167 Ga0495622_0000319 3300046557 Bacteria 35466
168 Ga0495668_0200031 3300046616 Bacteria 1094
169 Ga0495588_0000149 3300046674 Bacteria 100598
170 Ga0495657_0000020 3300046675 Bacteria 160089
171 Ga0495658_0210985 3300046683 Bacteria 1213
172 Ga0495613_0000973 3300046689 Bacteria 21857
173 Ga0495624_0004206 3300046690 Bacteria 10575
174 Ga0495600_0008221 3300046809 Bacteria 6406
175 Ga0495604_0000395 3300047317 Bacteria 39441
176 Ga0495676_0148945 3300047321 Unclassified 1668
177 Ga0495680_0015878 3300047322 Bacteria 6482
178 Ga0495675_0000103 3300047444 Bacteria 61353
179 Ga0495686_0251137 3300047472 Unclassified 994
180 Ga0495686_0325702 3300047472 Unclassified 841
181 Ga0495602_0000055 3300048088 Bacteria 110084
182 Ga0495602_0162343 3300048088 Unclassified 1743
183 Ga0496102_0260911 3300048905 Unclassified 1633
184 Ga0496103_0040226 3300048906 Bacteria 2873
185 Ga0496103_0068145 3300048906 Bacteria 2223
186 Ga0496104_0000004 3300048907 Bacteria 641830
187 Ga0496104_0068030 3300048907 Bacteria 3384
188 Ga0496105_0000001 3300048908 Bacteria 1328178
189 Ga0496105_0122380 3300048908 Bacteria 2145
190 Ga0496106_0208084 3300048909 Bacteria 1558
191 Ga0496107_0043855 3300048910 Bacteria 3214
192 Ga0496108_0000005 3300048911 Bacteria 535059
193 Ga0496108_0334414 3300048911 Unclassified 1321
194 Ga0496109_0000002 3300048912 Bacteria 443393
195 Ga0496109_0000115 3300048912 Bacteria 82707
196 Ga0496110_0002910 3300048913 Bacteria 12960
197 Ga0496110_0336082 3300048913 Bacteria 1376
198 Ga0496111_0000014 3300048914 Bacteria 80292
199 Ga0496111_0197067 3300048914 Bacteria 1497
200 Ga0496112_0263690 3300048915 Bacteria 1672
201 Ga0496113_0000052 3300048916 Bacteria 49918
202 Ga0496113_0051254 3300048916 Bacteria 3080
203 Ga0496114_0768458 3300048917 Bacteria 841
204 Ga0496115_1155624 3300048918 Unclassified 584
205 Ga0496116_0000360 3300048919 Bacteria 70849
206 Ga0496117_0002489 3300048920 Bacteria 23114
207 Ga0496118_0000128 3300048921 Bacteria 134661
208 Ga0496118_0088815 3300048921 Bacteria 2136
209 Ga0496118_0159090 3300048921 Bacteria 1400
210 Ga0496119_0002427 3300048922 Bacteria 20470
211 Ga0496119_0025734 3300048922 Bacteria 4102
212 Ga0496119_0040179 3300048922 Bacteria 2996
213 Ga0496119_0043135 3300048922 Bacteria 2854
214 Ga0496120_0012461 3300048923 Bacteria 5787
215 Ga0496120_0377867 3300048923 Bacteria 631
216 Ga0496121_0028137 3300048924 Bacteria 5239
217 Ga0496121_0044545 3300048924 Bacteria 3825
218 Ga0496121_0117843 3300048924 Bacteria 2011
219 Ga0496121_0178381 3300048924 Bacteria 1536
220 Ga0496124_0230348 3300048927 Bacteria 1386
221 Ga0496125_0036796 3300048928 Bacteria 4266
222 Ga0496125_0212712 3300048928 Bacteria 1254
223 Ga0496126_0141148 3300048929 Unclassified 2073
224 Ga0496126_0592208 3300048929 Bacteria 875
225 Ga0501031_0000834 3300049568 Bacteria 18544
226 Ga0501032_0002751 3300049569 Bacteria 13687
227 Ga0501033_0003940 3300049570 Bacteria 12042
228 Ga0501034_0042144 3300049571 Bacteria 4620
229 Ga0501036_0003861 3300049572 Bacteria 12026
230 Ga0501037_0075145 3300049573 Bacteria 2454
231 Ga0501038_0009658 3300049574 Bacteria 8849
232 Ga0501039_0036943 3300049575 Bacteria 3769
233 Ga0501040_0061462 3300049576 Bacteria 2584
234 Ga0501042_0078111 3300049578 Bacteria 2371
235 Ga0501043_0010659 3300049579 Bacteria 7199
236 Ga0501043_0210323 3300049579 Unclassified 1508
237 Ga0501043_0281313 3300049579 Unclassified 1275
238 Ga0501046_0000245 3300049580 Bacteria 55502
239 Ga0501046_0380181 3300049580 Unclassified 1022
240 Ga0501047_0000452 3300049581 Bacteria 45366
241 Ga0501047_0019852 3300049581 Bacteria 6450
242 Ga0501047_0186844 3300049581 Bacteria 1937
243 Ga0501047_0212476 3300049581 Bacteria 1792
244 Ga0501048_0001368 3300049582 Bacteria 18447
245 Ga0501048_0132167 3300049582 Bacteria 1764
246 Ga0501068_0102710 3300049584 Bacteria 1773
247 Ga0501068_0320577 3300049584 Bacteria 993
248 Ga0501069_0006249 3300049585 Bacteria 6225
249 Ga0501069_0007365 3300049585 Bacteria 5773
250 Ga0501070_0001768 3300049586 Bacteria 19118
251 Ga0501070_0013089 3300049586 Bacteria 6994
252 Ga0501070_0149314 3300049586 Bacteria 1928
253 Ga0501071_0034558 3300049587 Bacteria 3599
254 Ga0501072_0233930 3300049588 Unclassified 1464
255 Ga0501073_0001310 3300049589 Bacteria 18310
256 Ga0501074_0049531 3300049590 Bacteria 3033
257 Ga0501074_0117190 3300049590 Bacteria 1905
258 Ga0501074_0273222 3300049590 Bacteria 1201
259 Ga0501079_0034995 3300049741 Bacteria 3864
260 Ga0501079_0072947 3300049741 Bacteria 2653
261 Ga0501080_0051989 3300049742 Bacteria 3813
262 Ga0501080_0293301 3300049742 Bacteria 1476
263 Ga0501081_0585248 3300049743 Bacteria 835
264 Ga0501083_0025776 3300049744 Bacteria 4069
265 Ga0501083_0056479 3300049744 Bacteria 2630
266 Ga0501083_0068077 3300049744 Bacteria 2369
267 Ga0501035_0000251 3300049822 Bacteria 64622
268 Ga0501044_0006200 3300049823 Bacteria 13214
269 Ga0501044_0068800 3300049823 Bacteria 3606
270 Ga0501044_0326242 3300049823 Bacteria 1459
271 nmdc:mga03n38_41228_c1 3300050490 Bacteria 2011
272 nmdc:mga00v17_134536_c1 3300050491 Bacteria 1582
273 nmdc:mga0yw44_257822_c1 3300050492 Bacteria 1162
274 nmdc:mga0qj67_7433_c1 3300050509 Bacteria 8095
275 Ga0495601_0000027 3300053077 Bacteria 116790
276 Ga0495595_0000022 3300053084 Bacteria 110598
277 Ga0495595_0340459 3300053084 Bacteria 756
278 Ga0495619_0000037 3300053085 Bacteria 124007
279 Ga0495619_0000070 3300053085 Bacteria 80588
280 Ga0500566_0095733 3300053094 Bacteria 1635
281 Ga0500641_0060886 3300053096 Bacteria 1571
282 Ga0500595_117354 3300053119 Bacteria 753
283 Ga0500658_0160019 3300053134 Bacteria 1019
284 Ga0501082_0046460 3300060353 Bacteria 3742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047322 Ga0495680_0015878 Ga0495680_0015878_5937_6458 164
2 3300048918 Ga0496115_1155624 Ga0496115_1155624_33_569 169
3 3300048929 Ga0496126_0141148 Ga0496126_0141148_824_1360 169
4 3300046516 Ga0495628_0162299 Ga0495628_0162299_812_1342 176
5 3300001979 JGI24740J21852_10005084 JGI24740J21852_100050847 178
6 3300003203 JGI25406J46586_10025849 JGI25406J46586_100258492 178
7 3300003659 JGI25404J52841_10062324 JGI25404J52841_100623242 178
8 3300005327 Ga0070658_10550740 Ga0070658_105507402 178
9 3300005329 Ga0070683_100057120 Ga0070683_1000571205 178
10 3300005329 Ga0070683_100174328 Ga0070683_1001743281 178
11 3300005329 Ga0070683_100213428 Ga0070683_1002134282 178
12 3300005329 Ga0070683_100829442 Ga0070683_1008294421 178
13 3300005330 Ga0070690_100148151 Ga0070690_1001481512 178
14 3300005335 Ga0070666_10058756 Ga0070666_100587563 178
15 3300005335 Ga0070666_10080898 Ga0070666_100808983 178
16 3300005336 Ga0070680_101050349 Ga0070680_1010503492 178
17 3300005337 Ga0070682_100000093 Ga0070682_10000009386 178
18 3300005338 Ga0068868_100000954 Ga0068868_10000095415 178
19 3300005340 Ga0070689_100159044 Ga0070689_1001590442 178
20 3300005344 Ga0070661_100000223 Ga0070661_10000022326 178
21 3300005344 Ga0070661_101457545 Ga0070661_1014575451 178
22 3300005345 Ga0070692_10014722 Ga0070692_100147224 178
23 3300005347 Ga0070668_100010228 Ga0070668_1000102283 178
24 3300005347 Ga0070668_100133371 Ga0070668_1001333714 178
25 3300005354 Ga0070675_100000028 Ga0070675_10000002887 178
26 3300005365 Ga0070688_100008903 Ga0070688_1000089036 178
27 3300005365 Ga0070688_100009114 Ga0070688_1000091142 178
28 3300005365 Ga0070688_100050577 Ga0070688_1000505774 178
29 3300005366 Ga0070659_100009280 Ga0070659_1000092802 178
30 3300005367 Ga0070667_100003792 Ga0070667_10000379213 178
31 3300005367 Ga0070667_100025536 Ga0070667_1000255363 178
32 3300005436 Ga0070713_100000079 Ga0070713_1000000795 178
33 3300005439 Ga0070711_100053891 Ga0070711_1000538915 178
34 3300005455 Ga0070663_100001353 Ga0070663_1000013537 178
35 3300005456 Ga0070678_100002218 Ga0070678_1000022185 178
36 3300005458 Ga0070681_10183569 Ga0070681_101835693 178
37 3300005466 Ga0070685_10000139 Ga0070685_1000013958 178
38 3300005466 Ga0070685_10007283 Ga0070685_100072833 178
39 3300005530 Ga0070679_100004881 Ga0070679_1000048819 178
40 3300005535 Ga0070684_100068043 Ga0070684_1000680434 178
41 3300005543 Ga0070672_100000478 Ga0070672_10000047823 178
42 3300005548 Ga0070665_100053277 Ga0070665_1000532773 178
43 3300005548 Ga0070665_100082196 Ga0070665_1000821966 178
44 3300005548 Ga0070665_100160048 Ga0070665_1001600483 178
45 3300005548 Ga0070665_100521456 Ga0070665_1005214562 178
46 3300005548 Ga0070665_101037928 Ga0070665_1010379282 178
47 3300005549 Ga0070704_100403534 Ga0070704_1004035342 178
48 3300005563 Ga0068855_101133457 Ga0068855_1011334572 178
49 3300005564 Ga0070664_100045538 Ga0070664_1000455384 178
50 3300005577 Ga0068857_101336570 Ga0068857_1013365701 178
51 3300005578 Ga0068854_100000065 Ga0068854_10000006563 178
52 3300005614 Ga0068856_100010580 Ga0068856_1000105807 178
53 3300005614 Ga0068856_100020967 Ga0068856_1000209676 178
54 3300005614 Ga0068856_101326775 Ga0068856_1013267751 178
55 3300005616 Ga0068852_100000094 Ga0068852_10000009448 178
56 3300005616 Ga0068852_101098042 Ga0068852_1010980421 178
57 3300005834 Ga0068851_10031956 Ga0068851_100319563 178
58 3300005834 Ga0068851_10059982 Ga0068851_100599823 178
59 3300005841 Ga0068863_100351222 Ga0068863_1003512223 178
60 3300005842 Ga0068858_100423151 Ga0068858_1004231512 178
61 3300005843 Ga0068860_100082859 Ga0068860_1000828595 178
62 3300005844 Ga0068862_100000891 Ga0068862_10000089113 178
63 3300005937 Ga0081455_10037133 Ga0081455_100371335 178
64 3300005983 Ga0081540_1000063 Ga0081540_1000063132 178
65 3300005983 Ga0081540_1062369 Ga0081540_10623693 178
66 3300005985 Ga0081539_10002182 Ga0081539_1000218224 178
67 3300006038 Ga0075365_10152042 Ga0075365_101520422 178
68 3300006048 Ga0075363_100086583 Ga0075363_1000865833 178
69 3300006163 Ga0070715_10079727 Ga0070715_100797273 178
70 3300006175 Ga0070712_100037115 Ga0070712_1000371153 178
71 3300006178 Ga0075367_10289361 Ga0075367_102893611 178
72 3300006846 Ga0075430_100019946 Ga0075430_1000199465 178
73 3300006881 Ga0068865_100000013 Ga0068865_10000001376 178
74 3300009098 Ga0105245_10000353 Ga0105245_100003533 178
75 3300009098 Ga0105245_10006607 Ga0105245_100066073 178
76 3300009101 Ga0105247_10001040 Ga0105247_1000104022 178
77 3300009101 Ga0105247_10161895 Ga0105247_101618951 178
78 3300009101 Ga0105247_10291545 Ga0105247_102915452 178
79 3300009148 Ga0105243_10025053 Ga0105243_100250536 178
80 3300009174 Ga0105241_10174345 Ga0105241_101743452 178
81 3300009176 Ga0105242_10001790 Ga0105242_1000179012 178
82 3300009177 Ga0105248_10000008 Ga0105248_10000008111 178
83 3300009545 Ga0105237_10093605 Ga0105237_100936053 178
84 3300009551 Ga0105238_10950779 Ga0105238_109507791 178
85 3300009553 Ga0105249_10004494 Ga0105249_100044942 178
86 3300010375 Ga0105239_10036617 Ga0105239_100366174 178
87 3300010375 Ga0105239_10244813 Ga0105239_102448133 178
88 3300013102 Ga0157371_10074925 Ga0157371_100749253 178
89 3300013105 Ga0157369_10000078 Ga0157369_100000788 178
90 3300013105 Ga0157369_10900452 Ga0157369_109004522 178
91 3300013297 Ga0157378_10004090 Ga0157378_1000409013 178
92 3300013297 Ga0157378_10061319 Ga0157378_100613194 178
93 3300013297 Ga0157378_10141409 Ga0157378_101414094 178
94 3300013306 Ga0163162_10651797 Ga0163162_106517972 178
95 3300013307 Ga0157372_10000882 Ga0157372_1000088224 178
96 3300014326 Ga0157380_10000048 Ga0157380_1000004877 178
97 3300014326 Ga0157380_10321048 Ga0157380_103210482 178
98 3300014968 Ga0157379_10052131 Ga0157379_100521313 178
99 3300014968 Ga0157379_10119476 Ga0157379_101194763 178
100 3300014968 Ga0157379_10521777 Ga0157379_105217771 178
101 3300014969 Ga0157376_10210519 Ga0157376_102105193 178
102 3300025321 Ga0207656_10068994 Ga0207656_100689942 178
103 3300025900 Ga0207710_10000461 Ga0207710_1000046124 178
104 3300025900 Ga0207710_10469466 Ga0207710_104694661 178
105 3300025900 Ga0207710_10503653 Ga0207710_105036531 178
106 3300025903 Ga0207680_10052862 Ga0207680_100528623 178
107 3300025903 Ga0207680_10064227 Ga0207680_100642272 178
108 3300025907 Ga0207645_10530659 Ga0207645_105306591 178
109 3300025909 Ga0207705_10565588 Ga0207705_105655882 178
110 3300025909 Ga0207705_10675051 Ga0207705_106750511 178
111 3300025911 Ga0207654_10240899 Ga0207654_102408992 178
112 3300025912 Ga0207707_10093034 Ga0207707_100930343 178
113 3300025915 Ga0207693_10150451 Ga0207693_101504513 178
114 3300025916 Ga0207663_10082886 Ga0207663_100828863 178
115 3300025917 Ga0207660_10582951 Ga0207660_105829511 178
116 3300025920 Ga0207649_10000028 Ga0207649_1000002827 178
117 3300025921 Ga0207652_10016040 Ga0207652_100160406 178
118 3300025925 Ga0207650_10436431 Ga0207650_104364312 178
119 3300025926 Ga0207659_10000022 Ga0207659_1000002245 178
120 3300025927 Ga0207687_10000031 Ga0207687_1000003125 178
121 3300025927 Ga0207687_10000412 Ga0207687_1000041222 178
122 3300025928 Ga0207700_10000007 Ga0207700_10000007117 178
123 3300025928 Ga0207700_10024646 Ga0207700_100246463 178
124 3300025932 Ga0207690_10113184 Ga0207690_101131842 178
125 3300025934 Ga0207686_10001902 Ga0207686_100019027 178
126 3300025935 Ga0207709_10013481 Ga0207709_100134813 178
127 3300025936 Ga0207670_10179525 Ga0207670_101795252 178
128 3300025938 Ga0207704_10000040 Ga0207704_1000004072 178
129 3300025940 Ga0207691_10002148 Ga0207691_1000214814 178
130 3300025941 Ga0207711_10000006 Ga0207711_10000006507 178
131 3300025944 Ga0207661_10000932 Ga0207661_1000093221 178
132 3300025944 Ga0207661_10001689 Ga0207661_100016899 178
133 3300025944 Ga0207661_10146288 Ga0207661_101462883 178
134 3300025944 Ga0207661_11002215 Ga0207661_110022152 178
135 3300025945 Ga0207679_10064387 Ga0207679_100643873 178
136 3300025949 Ga0207667_10813599 Ga0207667_108135992 178
137 3300025961 Ga0207712_10008727 Ga0207712_100087276 178
138 3300025972 Ga0207668_10001873 Ga0207668_1000187312 178
139 3300025981 Ga0207640_10000076 Ga0207640_1000007619 178
140 3300026023 Ga0207677_10020718 Ga0207677_100207186 178
141 3300026041 Ga0207639_10165889 Ga0207639_101658893 178
142 3300026067 Ga0207678_10013933 Ga0207678_100139336 178
143 3300026067 Ga0207678_10268249 Ga0207678_102682493 178
144 3300026078 Ga0207702_10002433 Ga0207702_100024338 178
145 3300026078 Ga0207702_10004702 Ga0207702_100047026 178
146 3300026116 Ga0207674_10313145 Ga0207674_103131452 178
147 3300026121 Ga0207683_10110891 Ga0207683_101108911 178
148 3300026142 Ga0207698_10000013 Ga0207698_10000013234 178
149 3300028379 Ga0268266_10000114 Ga0268266_10000114129 178
150 3300028379 Ga0268266_10009265 Ga0268266_100092653 178
151 3300028379 Ga0268266_10125077 Ga0268266_101250773 178
152 3300028380 Ga0268265_10010990 Ga0268265_100109905 178
153 3300028381 Ga0268264_10042767 Ga0268264_100427676 178
154 3300031665 Ga0316575_10161080 Ga0316575_101610802 178
155 3300032126 Ga0307415_100156368 Ga0307415_1001563682 178
156 3300038443 Ga0395901_1347845 Ga0395901_1347845_60_608 178
157 3300044735 Ga0466968_0397704 Ga0466968_0397704_54_590 178
158 3300044842 Ga0466957_0078283 Ga0466957_0078283_569_1105 178
159 3300045836 Ga0466958_0283552 Ga0466958_0283552_328_864 178
160 3300045976 Ga0466967_0000019 Ga0466967_0000019_50251_50787 178
161 3300046454 Ga0495592_0286633 Ga0495592_0286633_479_1015 178
162 3300046459 Ga0495629_0043972 Ga0495629_0043972_2573_3109 178
163 3300046460 Ga0495638_0033423 Ga0495638_0033423_51_587 178
164 3300046499 Ga0495594_0000010 Ga0495594_0000010_18933_19469 178
165 3300046507 Ga0495606_0000108 Ga0495606_0000108_21814_22350 178
166 3300046511 Ga0495608_0000023 Ga0495608_0000023_87643_88179 178
167 3300046517 Ga0495630_0000012 Ga0495630_0000012_98191_98727 178
168 3300046519 Ga0495632_0109363 Ga0495632_0109363_617_1153 178
169 3300046529 Ga0495652_0000023 Ga0495652_0000023_764_1300 178
170 3300046557 Ga0495622_0000319 Ga0495622_0000319_34088_34624 178
171 3300046616 Ga0495668_0200031 Ga0495668_0200031_432_968 178
172 3300046674 Ga0495588_0000149 Ga0495588_0000149_97537_98073 178
173 3300046675 Ga0495657_0000020 Ga0495657_0000020_87643_88179 178
174 3300046683 Ga0495658_0210985 Ga0495658_0210985_49_585 178
175 3300046689 Ga0495613_0000973 Ga0495613_0000973_11639_12175 178
176 3300046690 Ga0495624_0004206 Ga0495624_0004206_5706_6242 178
177 3300046809 Ga0495600_0008221 Ga0495600_0008221_5135_5671 178
178 3300047317 Ga0495604_0000395 Ga0495604_0000395_27432_27968 178
179 3300047321 Ga0495676_0148945 Ga0495676_0148945_649_1185 178
180 3300047444 Ga0495675_0000103 Ga0495675_0000103_22407_22943 178
181 3300047472 Ga0495686_0251137 Ga0495686_0251137_357_893 178
182 3300047472 Ga0495686_0325702 Ga0495686_0325702_18_554 178
183 3300048088 Ga0495602_0000055 Ga0495602_0000055_17398_17934 178
184 3300048088 Ga0495602_0162343 Ga0495602_0162343_537_1163 178
185 3300048905 Ga0496102_0260911 Ga0496102_0260911_919_1455 178
186 3300048906 Ga0496103_0040226 Ga0496103_0040226_1296_1832 178
187 3300048906 Ga0496103_0068145 Ga0496103_0068145_938_1474 178
188 3300048907 Ga0496104_0000004 Ga0496104_0000004_542649_543185 178
189 3300048907 Ga0496104_0068030 Ga0496104_0068030_2133_2669 178
190 3300048908 Ga0496105_0000001 Ga0496105_0000001_98646_99182 178
191 3300048908 Ga0496105_0122380 Ga0496105_0122380_627_1163 178
192 3300048909 Ga0496106_0208084 Ga0496106_0208084_431_970 178
193 3300048910 Ga0496107_0043855 Ga0496107_0043855_352_888 178
194 3300048911 Ga0496108_0000005 Ga0496108_0000005_96524_97060 178
195 3300048911 Ga0496108_0334414 Ga0496108_0334414_536_1072 178
196 3300048912 Ga0496109_0000002 Ga0496109_0000002_438032_438568 178
197 3300048912 Ga0496109_0000115 Ga0496109_0000115_47053_47589 178
198 3300048913 Ga0496110_0002910 Ga0496110_0002910_2528_3064 178
199 3300048913 Ga0496110_0336082 Ga0496110_0336082_197_733 178
200 3300048914 Ga0496111_0000014 Ga0496111_0000014_55180_55716 178
201 3300048914 Ga0496111_0197067 Ga0496111_0197067_241_777 178
202 3300048915 Ga0496112_0263690 Ga0496112_0263690_960_1499 178
203 3300048916 Ga0496113_0000052 Ga0496113_0000052_54_593 178
204 3300048916 Ga0496113_0051254 Ga0496113_0051254_2240_2776 178
205 3300048917 Ga0496114_0768458 Ga0496114_0768458_281_817 178
206 3300048919 Ga0496116_0000360 Ga0496116_0000360_8754_9290 178
207 3300048920 Ga0496117_0002489 Ga0496117_0002489_7781_8317 178
208 3300048921 Ga0496118_0000128 Ga0496118_0000128_123160_123696 178
209 3300048921 Ga0496118_0088815 Ga0496118_0088815_711_1247 178
210 3300048921 Ga0496118_0159090 Ga0496118_0159090_691_1227 178
211 3300048922 Ga0496119_0002427 Ga0496119_0002427_8325_8861 178
212 3300048922 Ga0496119_0025734 Ga0496119_0025734_2930_3466 178
213 3300048922 Ga0496119_0040179 Ga0496119_0040179_1979_2515 178
214 3300048922 Ga0496119_0043135 Ga0496119_0043135_2263_2802 178
215 3300048923 Ga0496120_0012461 Ga0496120_0012461_23_559 178
216 3300048923 Ga0496120_0377867 Ga0496120_0377867_79_615 178
217 3300048924 Ga0496121_0028137 Ga0496121_0028137_4483_5019 178
218 3300048924 Ga0496121_0044545 Ga0496121_0044545_698_1234 178
219 3300048924 Ga0496121_0117843 Ga0496121_0117843_1035_1571 178
220 3300048924 Ga0496121_0178381 Ga0496121_0178381_301_837 178
221 3300048927 Ga0496124_0230348 Ga0496124_0230348_664_1200 178
222 3300048928 Ga0496125_0036796 Ga0496125_0036796_695_1231 178
223 3300048928 Ga0496125_0212712 Ga0496125_0212712_655_1191 178
224 3300048929 Ga0496126_0592208 Ga0496126_0592208_215_751 178
225 3300049568 Ga0501031_0000834 Ga0501031_0000834_15336_15872 178
226 3300049569 Ga0501032_0002751 Ga0501032_0002751_2621_3157 178
227 3300049570 Ga0501033_0003940 Ga0501033_0003940_2643_3179 178
228 3300049571 Ga0501034_0042144 Ga0501034_0042144_2868_3404 178
229 3300049572 Ga0501036_0003861 Ga0501036_0003861_2510_3046 178
230 3300049573 Ga0501037_0075145 Ga0501037_0075145_964_1500 178
231 3300049574 Ga0501038_0009658 Ga0501038_0009658_7681_8217 178
232 3300049575 Ga0501039_0036943 Ga0501039_0036943_699_1235 178
233 3300049576 Ga0501040_0061462 Ga0501040_0061462_435_971 178
234 3300049578 Ga0501042_0078111 Ga0501042_0078111_1176_1712 178
235 3300049579 Ga0501043_0010659 Ga0501043_0010659_4059_4595 178
236 3300049579 Ga0501043_0210323 Ga0501043_0210323_162_698 178
237 3300049579 Ga0501043_0281313 Ga0501043_0281313_100_636 178
238 3300049580 Ga0501046_0000245 Ga0501046_0000245_39325_39861 178
239 3300049580 Ga0501046_0380181 Ga0501046_0380181_271_807 178
240 3300049581 Ga0501047_0000452 Ga0501047_0000452_29312_29848 178
241 3300049581 Ga0501047_0019852 Ga0501047_0019852_3549_4085 178
242 3300049581 Ga0501047_0186844 Ga0501047_0186844_1376_1912 178
243 3300049581 Ga0501047_0212476 Ga0501047_0212476_275_811 178
244 3300049582 Ga0501048_0001368 Ga0501048_0001368_2644_3180 178
245 3300049582 Ga0501048_0132167 Ga0501048_0132167_95_631 178
246 3300049584 Ga0501068_0102710 Ga0501068_0102710_260_796 178
247 3300049584 Ga0501068_0320577 Ga0501068_0320577_150_686 178
248 3300049585 Ga0501069_0006249 Ga0501069_0006249_3098_3634 178
249 3300049585 Ga0501069_0007365 Ga0501069_0007365_2748_3284 178
250 3300049586 Ga0501070_0001768 Ga0501070_0001768_15946_16482 178
251 3300049586 Ga0501070_0013089 Ga0501070_0013089_746_1282 178
252 3300049586 Ga0501070_0149314 Ga0501070_0149314_695_1231 178
253 3300049587 Ga0501071_0034558 Ga0501071_0034558_2628_3164 178
254 3300049588 Ga0501072_0233930 Ga0501072_0233930_764_1300 178
255 3300049589 Ga0501073_0001310 Ga0501073_0001310_2507_3043 178
256 3300049590 Ga0501074_0049531 Ga0501074_0049531_929_1465 178
257 3300049590 Ga0501074_0117190 Ga0501074_0117190_363_899 178
258 3300049590 Ga0501074_0273222 Ga0501074_0273222_479_1015 178
259 3300049741 Ga0501079_0034995 Ga0501079_0034995_2376_2912 178
260 3300049741 Ga0501079_0072947 Ga0501079_0072947_641_1177 178
261 3300049742 Ga0501080_0051989 Ga0501080_0051989_655_1191 178
262 3300049742 Ga0501080_0293301 Ga0501080_0293301_482_1018 178
263 3300049743 Ga0501081_0585248 Ga0501081_0585248_185_721 178
264 3300049744 Ga0501083_0025776 Ga0501083_0025776_931_1467 178
265 3300049744 Ga0501083_0056479 Ga0501083_0056479_1953_2489 178
266 3300049744 Ga0501083_0068077 Ga0501083_0068077_572_1108 178
267 3300049822 Ga0501035_0000251 Ga0501035_0000251_15960_16496 178
268 3300049823 Ga0501044_0006200 Ga0501044_0006200_2665_3201 178
269 3300049823 Ga0501044_0068800 Ga0501044_0068800_686_1222 178
270 3300049823 Ga0501044_0326242 Ga0501044_0326242_156_692 178
271 3300050490 nmdc:mga03n38_41228_c1 nmdc:mga03n38_41228_c1_903_1445 178
272 3300050491 nmdc:mga00v17_134536_c1 nmdc:mga00v17_134536_c1_238_780 178
273 3300050492 nmdc:mga0yw44_257822_c1 nmdc:mga0yw44_257822_c1_139_681 178
274 3300050509 nmdc:mga0qj67_7433_c1 nmdc:mga0qj67_7433_c1_2229_2765 178
275 3300053077 Ga0495601_0000027 Ga0495601_0000027_105664_106200 178
276 3300053084 Ga0495595_0000022 Ga0495595_0000022_22420_22956 178
277 3300053084 Ga0495595_0340459 Ga0495595_0340459_60_596 178
278 3300053085 Ga0495619_0000037 Ga0495619_0000037_104316_104852 178
279 3300053085 Ga0495619_0000070 Ga0495619_0000070_22359_22895 178
280 3300053094 Ga0500566_0095733 Ga0500566_0095733_712_1248 178
281 3300053096 Ga0500641_0060886 Ga0500641_0060886_419_955 178
282 3300053119 Ga0500595_117354 Ga0500595_117354_194_730 178
283 3300053134 Ga0500658_0160019 Ga0500658_0160019_85_621 178
284 3300060353 Ga0501082_0046460 Ga0501082_0046460_2569_3105 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

70

157

0.93

PF08241

Methyltransf_11

Methyltransferase domain

71

157

0.9

PF13489

Methyltransf_23

Methyltransferase domain

37

189

0.84

PF08242

Methyltransf_12

Methyltransferase domain

71

157

0.81

PF13847

Methyltransf_31

Methyltransferase domain

65

203

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dtn-assembly1.cif.gz_B crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8764 10 175
3dtn-assembly1.cif.gz_A crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8704 10 175
3dtn-assembly1.cif.gz_B crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8161 10 175
3dtn-assembly1.cif.gz_A crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8102 10 175
8k5l-assembly2.cif.gz_C structure of trna (cmo5u34)-methyltransferase from fusobacterium nucleatum 0.8043 15 178
ID Description Score Start End Superfamily
af_Q9VGY5_27_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9106 25 79 3.40.50.150
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8413 10 175 3.40.50.150
af_F7F172_79_179_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8358 28 79 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8321 25 137 3.40.50.150
af_A0A1D6HKL4_97_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7982 27 134 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Q7WWT5-F1-model_v4 Methyltransferase domain-containing protein 0.9804 1 178 GO:0008168
AF-A0A1Q7WWT5-F1-model_v4 Methyltransferase domain-containing protein 0.9749 1 178 GO:0008168
AF-A0A7W0N3J8-F1-model_v4 Class I SAM-dependent methyltransferase 0.9342 1 177 GO:0008168
GO:0032259
AF-A0A7W0N3J8-F1-model_v4 Class I SAM-dependent methyltransferase 0.9241 1 177 GO:0008168
GO:0032259
AF-A0A7W0SU16-F1-model_v4 Class I SAM-dependent methyltransferase 0.912 17 168 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.66 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map