F386404
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 284 | 152 | 568 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0001125|Ga0496102_0001125_22283_23326 |
| Length | 347 |
| Sequence | MWTPVNVQAQSFLISLSRHRQFGVDRPCQSAPHRRVIRMDMRTDLDHLPPIKQRDLERAVEILFEEFKDATSLATGSWKKAGRILKIVLFGSYARGGWVDEPHTAKGYKSDYDLLIIVNDKRLTDRAEFWAKAQERLIREHSIAKSLTAPVNFIVHTLQEVNDALAHGRYFFMDIASDGIALYQSDDTELHTPKPKTPKQALAMAKEYFEEWYPSAGEFFDDFRANVEKRRSKKAAFELHQAAERLLHTVLLVTTFYTSHTHNLDYLRSQAERIDRRLVHVWPRDTRKERAMFEKLKDAYVKARYSKHYRITQDELSWLGAQVEELGRVVHQVCSERIAELEKAARG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 97 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 104 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 105 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 119 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 120 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 121 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 122 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 123 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 124 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 125 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 126 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 127 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 128 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 129 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 130 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 131 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 132 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 133 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 134 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 135 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 136 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 137 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 138 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 139 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 140 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 141 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 142 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 143 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 144 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 145 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 146 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 147 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 148 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 149 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 150 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 151 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 152 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.37 |
| Metatranscriptomes | 0 |
| Isolates | 5.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.93 |
| Nodule | 0 |
| Rhizoplane | 5.63 |
| Rhizosphere | 69.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0001125 | 3300048905 | Bacteria | 24540 |
| 2 | SwRhRL2b_contig_3565797 | 2162886007 | Bacteria | 4074 |
| 3 | LJQas_1009282 | 3300000549 | Bacteria | 1186 |
| 4 | JGI24736J21556_1009535 | 3300001904 | Bacteria | 1599 |
| 5 | JGI24740J21852_10019209 | 3300001979 | Bacteria | 2412 |
| 6 | JGI24739J22299_10001864 | 3300001989 | Bacteria | 8043 |
| 7 | JGI24739J22299_10004570 | 3300001989 | Bacteria | 5291 |
| 8 | JGI24737J22298_10020544 | 3300001990 | Bacteria | 2108 |
| 9 | Ga0055530_10005349 | 3300003791 | Bacteria | 6139 |
| 10 | Ga0055530_10012218 | 3300003791 | Bacteria | 3011 |
| 11 | Ga0065704_10085473 | 3300005289 | Bacteria | 3218 |
| 12 | Ga0070658_10018703 | 3300005327 | Bacteria | 5550 |
| 13 | Ga0070658_10126556 | 3300005327 | Bacteria | 2127 |
| 14 | Ga0070690_100012770 | 3300005330 | Bacteria | 4947 |
| 15 | Ga0070677_10085090 | 3300005333 | Bacteria | 1363 |
| 16 | Ga0070666_10000021 | 3300005335 | Bacteria | 167450 |
| 17 | Ga0070682_100159346 | 3300005337 | Bacteria | 1557 |
| 18 | Ga0070660_100009719 | 3300005339 | Bacteria | 6778 |
| 19 | Ga0070660_100087355 | 3300005339 | Bacteria | 2454 |
| 20 | Ga0070660_100183485 | 3300005339 | Bacteria | 1694 |
| 21 | Ga0070661_100004976 | 3300005344 | Bacteria | 9153 |
| 22 | Ga0070661_100180097 | 3300005344 | Bacteria | 1608 |
| 23 | Ga0070668_100083453 | 3300005347 | Bacteria | 2508 |
| 24 | Ga0070669_100000149 | 3300005353 | Bacteria | 62788 |
| 25 | Ga0070669_100001001 | 3300005353 | Bacteria | 20581 |
| 26 | Ga0070669_100043595 | 3300005353 | Bacteria | 3268 |
| 27 | Ga0070669_100152317 | 3300005353 | Bacteria | 1791 |
| 28 | Ga0070669_100311618 | 3300005353 | Bacteria | 1269 |
| 29 | Ga0070673_100007608 | 3300005364 | Bacteria | 7167 |
| 30 | Ga0070659_100001999 | 3300005366 | Bacteria | 14575 |
| 31 | Ga0070667_100003210 | 3300005367 | Bacteria | 14005 |
| 32 | Ga0070663_100004040 | 3300005455 | Bacteria | 8563 |
| 33 | Ga0070662_100130122 | 3300005457 | Bacteria | 1939 |
| 34 | Ga0070685_10159296 | 3300005466 | Bacteria | 1437 |
| 35 | Ga0070679_100097055 | 3300005530 | Bacteria | 2935 |
| 36 | Ga0068853_100215460 | 3300005539 | Bacteria | 1752 |
| 37 | Ga0070686_100000001 | 3300005544 | Bacteria | 515830 |
| 38 | Ga0068855_100037606 | 3300005563 | Bacteria | 5755 |
| 39 | Ga0068855_100108194 | 3300005563 | Bacteria | 3193 |
| 40 | Ga0068857_100273910 | 3300005577 | Bacteria | 1551 |
| 41 | Ga0068857_100374024 | 3300005577 | Bacteria | 1322 |
| 42 | Ga0068856_100036721 | 3300005614 | Bacteria | 4804 |
| 43 | Ga0068856_100140487 | 3300005614 | Bacteria | 2422 |
| 44 | Ga0068856_100199103 | 3300005614 | Bacteria | 2017 |
| 45 | Ga0068856_100396191 | 3300005614 | Bacteria | 1400 |
| 46 | Ga0068859_100014089 | 3300005617 | Bacteria | 8019 |
| 47 | Ga0068858_100006526 | 3300005842 | Bacteria | 11350 |
| 48 | Ga0068858_100039582 | 3300005842 | Bacteria | 4371 |
| 49 | Ga0068858_100486657 | 3300005842 | Bacteria | 1191 |
| 50 | Ga0068860_100000084 | 3300005843 | Bacteria | 167450 |
| 51 | Ga0068862_100505514 | 3300005844 | Bacteria | 1148 |
| 52 | Ga0075369_10064776 | 3300006186 | Bacteria | 1601 |
| 53 | Ga0068865_100035719 | 3300006881 | Bacteria | 3346 |
| 54 | Ga0097620_100014089 | 3300006931 | Bacteria | 8019 |
| 55 | Ga0105251_10003709 | 3300009011 | Bacteria | 10955 |
| 56 | Ga0105250_10008898 | 3300009092 | Bacteria | 4245 |
| 57 | Ga0105250_10011658 | 3300009092 | Bacteria | 3644 |
| 58 | Ga0105240_10003313 | 3300009093 | Bacteria | 25169 |
| 59 | Ga0105240_10092391 | 3300009093 | Bacteria | 3695 |
| 60 | Ga0105240_10140976 | 3300009093 | Bacteria | 2882 |
| 61 | Ga0105240_10271407 | 3300009093 | Bacteria | 1952 |
| 62 | Ga0105247_10025671 | 3300009101 | Bacteria | 3555 |
| 63 | Ga0105248_10004996 | 3300009177 | Bacteria | 14655 |
| 64 | Ga0105248_10042585 | 3300009177 | Bacteria | 5093 |
| 65 | Ga0105248_10060689 | 3300009177 | Bacteria | 4245 |
| 66 | Ga0105237_10045218 | 3300009545 | Bacteria | 4432 |
| 67 | Ga0105237_10075421 | 3300009545 | Bacteria | 3364 |
| 68 | Ga0105237_10105237 | 3300009545 | Bacteria | 2813 |
| 69 | Ga0105238_10290539 | 3300009551 | Bacteria | 1617 |
| 70 | Ga0105249_10000047 | 3300009553 | Bacteria | 176249 |
| 71 | Ga0105239_10011780 | 3300010375 | Bacteria | 9759 |
| 72 | Ga0105239_10043409 | 3300010375 | Bacteria | 4928 |
| 73 | Ga0105246_10163077 | 3300011119 | Bacteria | 1700 |
| 74 | Ga0157373_10161829 | 3300013100 | Bacteria | 1575 |
| 75 | Ga0157371_10209838 | 3300013102 | Bacteria | 1397 |
| 76 | Ga0157370_10317596 | 3300013104 | Bacteria | 1437 |
| 77 | Ga0157369_10000201 | 3300013105 | Bacteria | 82836 |
| 78 | Ga0157369_10028580 | 3300013105 | Bacteria | 6170 |
| 79 | Ga0157369_10487885 | 3300013105 | Bacteria | 1275 |
| 80 | Ga0157378_10034922 | 3300013297 | Bacteria | 4445 |
| 81 | Ga0163162_10368922 | 3300013306 | Bacteria | 1569 |
| 82 | Ga0207673_1002403 | 3300025290 | Bacteria | 2134 |
| 83 | Ga0209676_1027213 | 3300025292 | Bacteria | 1803 |
| 84 | Ga0209050_1000192 | 3300025298 | Bacteria | 138262 |
| 85 | Ga0209257_1010996 | 3300025304 | Bacteria | 4446 |
| 86 | Ga0207697_10009035 | 3300025315 | Bacteria | 4322 |
| 87 | Ga0207696_1001435 | 3300025711 | Bacteria | 12952 |
| 88 | Ga0207696_1002289 | 3300025711 | Bacteria | 9510 |
| 89 | Ga0207713_1000959 | 3300025735 | Bacteria | 25589 |
| 90 | Ga0207713_1013074 | 3300025735 | Bacteria | 4398 |
| 91 | Ga0207680_10000008 | 3300025903 | Bacteria | 518177 |
| 92 | Ga0207647_10000239 | 3300025904 | Bacteria | 44964 |
| 93 | Ga0207647_10000621 | 3300025904 | Bacteria | 27652 |
| 94 | Ga0207647_10028778 | 3300025904 | Bacteria | 3605 |
| 95 | Ga0207643_10047812 | 3300025908 | Bacteria | 2422 |
| 96 | Ga0207705_10000888 | 3300025909 | Bacteria | 24464 |
| 97 | Ga0207705_10024500 | 3300025909 | Bacteria | 4306 |
| 98 | Ga0207654_10003170 | 3300025911 | Bacteria | 8306 |
| 99 | Ga0207695_10015767 | 3300025913 | Bacteria | 8881 |
| 100 | Ga0207695_10065235 | 3300025913 | Bacteria | 3744 |
| 101 | Ga0207695_10166048 | 3300025913 | Bacteria | 2136 |
| 102 | Ga0207695_10198201 | 3300025913 | Bacteria | 1923 |
| 103 | Ga0207671_10007038 | 3300025914 | Bacteria | 9854 |
| 104 | Ga0207671_10032322 | 3300025914 | Bacteria | 3896 |
| 105 | Ga0207671_10043166 | 3300025914 | Bacteria | 3334 |
| 106 | Ga0207671_10092740 | 3300025914 | Bacteria | 2277 |
| 107 | Ga0207671_10198105 | 3300025914 | Bacteria | 1568 |
| 108 | Ga0207671_10301754 | 3300025914 | Bacteria | 1265 |
| 109 | Ga0207662_10159964 | 3300025918 | Bacteria | 1438 |
| 110 | Ga0207657_10036052 | 3300025919 | Bacteria | 4429 |
| 111 | Ga0207657_10172629 | 3300025919 | Bacteria | 1751 |
| 112 | Ga0207649_10000927 | 3300025920 | Bacteria | 18447 |
| 113 | Ga0207649_10079128 | 3300025920 | Bacteria | 2123 |
| 114 | Ga0207652_10094112 | 3300025921 | Bacteria | 2638 |
| 115 | Ga0207681_10000263 | 3300025923 | Bacteria | 40042 |
| 116 | Ga0207681_10013075 | 3300025923 | Bacteria | 5132 |
| 117 | Ga0207681_10052097 | 3300025923 | Bacteria | 2774 |
| 118 | Ga0207681_10208423 | 3300025923 | Bacteria | 1505 |
| 119 | Ga0207694_10002346 | 3300025924 | Bacteria | 15482 |
| 120 | Ga0207694_10016766 | 3300025924 | Bacteria | 5537 |
| 121 | Ga0207644_10000086 | 3300025931 | Bacteria | 67611 |
| 122 | Ga0207690_10016776 | 3300025932 | Bacteria | 4463 |
| 123 | Ga0207690_10124878 | 3300025932 | Bacteria | 1875 |
| 124 | Ga0207706_10000185 | 3300025933 | Bacteria | 69659 |
| 125 | Ga0207711_10078326 | 3300025941 | Bacteria | 2883 |
| 126 | Ga0207667_10031130 | 3300025949 | Bacteria | 5762 |
| 127 | Ga0207667_10086214 | 3300025949 | Bacteria | 3250 |
| 128 | Ga0207667_10144272 | 3300025949 | Bacteria | 2451 |
| 129 | Ga0207651_10061186 | 3300025960 | Bacteria | 2617 |
| 130 | Ga0207712_10000009 | 3300025961 | Bacteria | 518177 |
| 131 | Ga0207712_10328046 | 3300025961 | Bacteria | 1265 |
| 132 | Ga0207668_10006756 | 3300025972 | Bacteria | 6789 |
| 133 | Ga0207668_10037740 | 3300025972 | Bacteria | 3236 |
| 134 | Ga0207640_10060222 | 3300025981 | Bacteria | 2509 |
| 135 | Ga0207658_10000550 | 3300025986 | Bacteria | 33998 |
| 136 | Ga0207658_10004536 | 3300025986 | Bacteria | 9646 |
| 137 | Ga0207703_10040205 | 3300026035 | Bacteria | 3741 |
| 138 | Ga0207639_10006629 | 3300026041 | Bacteria | 7873 |
| 139 | Ga0207639_10169444 | 3300026041 | Bacteria | 1848 |
| 140 | Ga0207678_10003738 | 3300026067 | Bacteria | 13694 |
| 141 | Ga0207702_10006193 | 3300026078 | Bacteria | 10349 |
| 142 | Ga0207702_10022275 | 3300026078 | Bacteria | 5251 |
| 143 | Ga0207702_10022891 | 3300026078 | Bacteria | 5184 |
| 144 | Ga0207702_10068924 | 3300026078 | Bacteria | 3040 |
| 145 | Ga0207702_10116493 | 3300026078 | Bacteria | 2384 |
| 146 | Ga0207702_10300880 | 3300026078 | Bacteria | 1522 |
| 147 | Ga0207641_10005431 | 3300026088 | Bacteria | 10877 |
| 148 | Ga0207648_10001018 | 3300026089 | Bacteria | 31561 |
| 149 | Ga0207676_10000919 | 3300026095 | Bacteria | 22815 |
| 150 | Ga0207676_10207023 | 3300026095 | Bacteria | 1737 |
| 151 | Ga0207674_10031430 | 3300026116 | Bacteria | 5578 |
| 152 | Ga0207698_10008562 | 3300026142 | Bacteria | 6482 |
| 153 | Ga0268266_10001691 | 3300028379 | Bacteria | 25327 |
| 154 | Ga0268265_10082579 | 3300028380 | Bacteria | 2541 |
| 155 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 156 | Ga0268264_10230212 | 3300028381 | Bacteria | 1711 |
| 157 | Ga0307513_10095055 | 3300031456 | Bacteria | 3023 |
| 158 | Ga0307408_100000504 | 3300031548 | Bacteria | 33924 |
| 159 | Ga0395899_0001276 | 3300037312 | Bacteria | 21890 |
| 160 | Ga0395899_0074484 | 3300037312 | Bacteria | 2480 |
| 161 | Ga0395899_0154399 | 3300037312 | Bacteria | 1625 |
| 162 | Ga0395900_0000130 | 3300037418 | Bacteria | 126231 |
| 163 | Ga0395900_0156743 | 3300037418 | Bacteria | 2325 |
| 164 | Ga0395900_0190791 | 3300037418 | Bacteria | 2078 |
| 165 | Ga0395898_0000618 | 3300037466 | Bacteria | 65182 |
| 166 | Ga0395898_0003840 | 3300037466 | Bacteria | 16653 |
| 167 | Ga0395905_0000366 | 3300037471 | Bacteria | 64169 |
| 168 | Ga0395905_0261844 | 3300037471 | Bacteria | 1614 |
| 169 | Ga0395901_0000613 | 3300038443 | Bacteria | 41465 |
| 170 | Ga0395901_0650655 | 3300038443 | Bacteria | 1057 |
| 171 | Ga0237819_00607 | 3300038705 | Bacteria | 11825 |
| 172 | Ga0466966_0000019 | 3300044684 | Bacteria | 120521 |
| 173 | Ga0495627_001029 | 3300046453 | Bacteria | 18653 |
| 174 | Ga0495650_0000855 | 3300046471 | Bacteria | 36596 |
| 175 | Ga0495596_0000026 | 3300046500 | Bacteria | 104636 |
| 176 | Ga0495607_0045333 | 3300046501 | Bacteria | 2588 |
| 177 | Ga0495610_0000589 | 3300046512 | Bacteria | 36002 |
| 178 | Ga0495610_0015956 | 3300046512 | Bacteria | 4344 |
| 179 | Ga0495616_0000018 | 3300046513 | Bacteria | 167281 |
| 180 | Ga0495616_0000030 | 3300046513 | Bacteria | 132950 |
| 181 | Ga0495616_0000358 | 3300046513 | Bacteria | 35867 |
| 182 | Ga0495620_0018287 | 3300046515 | Bacteria | 3473 |
| 183 | Ga0495632_0000042 | 3300046519 | Bacteria | 145186 |
| 184 | Ga0495643_0001609 | 3300046522 | Bacteria | 19996 |
| 185 | Ga0495643_0009953 | 3300046522 | Bacteria | 5874 |
| 186 | Ga0495663_0000015 | 3300046525 | Bacteria | 145185 |
| 187 | Ga0495633_0000127 | 3300046558 | Bacteria | 101471 |
| 188 | Ga0495633_0002638 | 3300046558 | Bacteria | 12497 |
| 189 | Ga0495671_0146517 | 3300046692 | Bacteria | 1150 |
| 190 | Ga0495681_0000349 | 3300047470 | Bacteria | 36067 |
| 191 | Ga0496102_0000225 | 3300048905 | Bacteria | 74792 |
| 192 | Ga0496102_0000385 | 3300048905 | Bacteria | 52138 |
| 193 | Ga0496102_0000554 | 3300048905 | Bacteria | 40135 |
| 194 | Ga0496102_0002657 | 3300048905 | Bacteria | 15204 |
| 195 | Ga0496102_0006784 | 3300048905 | Bacteria | 9770 |
| 196 | Ga0496102_0088773 | 3300048905 | Bacteria | 2859 |
| 197 | Ga0496103_0000144 | 3300048906 | Bacteria | 74526 |
| 198 | Ga0496103_0000209 | 3300048906 | Bacteria | 58516 |
| 199 | Ga0496103_0000349 | 3300048906 | Bacteria | 42000 |
| 200 | Ga0496103_0000731 | 3300048906 | Bacteria | 24224 |
| 201 | Ga0496103_0003367 | 3300048906 | Bacteria | 9771 |
| 202 | Ga0496103_0004870 | 3300048906 | Bacteria | 8108 |
| 203 | Ga0496103_0039698 | 3300048906 | Bacteria | 2892 |
| 204 | Ga0496105_0002585 | 3300048908 | Bacteria | 13162 |
| 205 | Ga0496105_0189519 | 3300048908 | Bacteria | 1682 |
| 206 | Ga0496116_0000153 | 3300048919 | Bacteria | 141137 |
| 207 | Ga0496116_0000696 | 3300048919 | Bacteria | 43542 |
| 208 | Ga0496116_0001497 | 3300048919 | Bacteria | 26015 |
| 209 | Ga0496116_0002799 | 3300048919 | Bacteria | 17915 |
| 210 | Ga0496116_0045111 | 3300048919 | Bacteria | 2987 |
| 211 | Ga0496116_0059978 | 3300048919 | Bacteria | 2470 |
| 212 | Ga0496117_0000193 | 3300048920 | Bacteria | 123780 |
| 213 | Ga0496117_0000947 | 3300048920 | Bacteria | 44357 |
| 214 | Ga0496117_0000976 | 3300048920 | Bacteria | 43801 |
| 215 | Ga0496117_0001080 | 3300048920 | Bacteria | 41299 |
| 216 | Ga0496117_0001704 | 3300048920 | Bacteria | 30475 |
| 217 | Ga0496117_0011650 | 3300048920 | Bacteria | 7855 |
| 218 | Ga0496118_0000193 | 3300048921 | Bacteria | 107307 |
| 219 | Ga0496118_0000561 | 3300048921 | Bacteria | 61276 |
| 220 | Ga0496118_0000812 | 3300048921 | Bacteria | 49836 |
| 221 | Ga0496118_0001358 | 3300048921 | Bacteria | 36859 |
| 222 | Ga0496118_0001830 | 3300048921 | Bacteria | 30475 |
| 223 | Ga0496118_0003788 | 3300048921 | Bacteria | 18650 |
| 224 | Ga0496118_0005055 | 3300048921 | Bacteria | 15204 |
| 225 | Ga0496119_0004133 | 3300048922 | Bacteria | 14618 |
| 226 | Ga0496119_0016228 | 3300048922 | Bacteria | 5684 |
| 227 | Ga0496119_0028603 | 3300048922 | Bacteria | 3798 |
| 228 | Ga0496119_0066565 | 3300048922 | Bacteria | 2128 |
| 229 | Ga0496119_0091086 | 3300048922 | Bacteria | 1732 |
| 230 | Ga0496120_0070934 | 3300048923 | Bacteria | 1915 |
| 231 | Ga0496120_0082689 | 3300048923 | Bacteria | 1735 |
| 232 | Ga0496120_0090267 | 3300048923 | Bacteria | 1639 |
| 233 | Ga0496121_0004148 | 3300048924 | Bacteria | 19817 |
| 234 | Ga0496122_0000094 | 3300048925 | Bacteria | 202047 |
| 235 | Ga0496123_0000116 | 3300048926 | Bacteria | 161699 |
| 236 | Ga0496123_0012416 | 3300048926 | Bacteria | 7264 |
| 237 | Ga0496124_0000237 | 3300048927 | Bacteria | 107270 |
| 238 | Ga0496124_0000566 | 3300048927 | Bacteria | 62517 |
| 239 | Ga0496124_0000588 | 3300048927 | Bacteria | 61276 |
| 240 | Ga0496124_0000848 | 3300048927 | Bacteria | 49859 |
| 241 | Ga0496124_0001488 | 3300048927 | Bacteria | 34405 |
| 242 | Ga0496124_0001601 | 3300048927 | Bacteria | 32582 |
| 243 | Ga0496124_0001742 | 3300048927 | Bacteria | 30475 |
| 244 | Ga0496124_0004977 | 3300048927 | Bacteria | 15204 |
| 245 | Ga0496125_0000663 | 3300048928 | Bacteria | 57400 |
| 246 | Ga0496125_0004644 | 3300048928 | Bacteria | 15677 |
| 247 | Ga0496126_0000058 | 3300048929 | Bacteria | 272530 |
| 248 | Ga0496126_0001697 | 3300048929 | Bacteria | 32726 |
| 249 | Ga0501201_002529 | 3300049651 | Bacteria | 1676 |
| 250 | Ga0501206_004556 | 3300049653 | Bacteria | 1765 |
| 251 | Ga0501206_015049 | 3300049653 | Bacteria | 1068 |
| 252 | Ga0501211_000554 | 3300049658 | Bacteria | 3695 |
| 253 | Ga0501211_001151 | 3300049658 | Bacteria | 2806 |
| 254 | Ga0501211_002051 | 3300049658 | Bacteria | 2149 |
| 255 | Ga0501235_001570 | 3300049669 | Bacteria | 4895 |
| 256 | Ga0501235_003528 | 3300049669 | Bacteria | 3385 |
| 257 | Ga0501235_008577 | 3300049669 | Bacteria | 2231 |
| 258 | Ga0501225_0004017 | 3300049705 | Bacteria | 4403 |
| 259 | Ga0501225_0016594 | 3300049705 | Bacteria | 2048 |
| 260 | Ga0501245_004880 | 3300049708 | Bacteria | 1850 |
| 261 | Ga0500643_000287 | 3300053087 | Bacteria | 43495 |
| 262 | Ga0500643_000322 | 3300053087 | Bacteria | 38615 |
| 263 | Ga0500643_000361 | 3300053087 | Bacteria | 36161 |
| 264 | Ga0500556_0000021 | 3300053104 | Bacteria | 184159 |
| 265 | Ga0500608_000042 | 3300053122 | Bacteria | 56626 |
| 266 | Ga0500573_0088146 | 3300053140 | Bacteria | 1756 |
| 267 | Ga0500627_0000156 | 3300053158 | Bacteria | 20300 |
| 268 | Ga0500627_0001669 | 3300053158 | Bacteria | 6283 |
| 269 | 2738712250 | 2738541275 | Bacteria | 4830863 |
| 270 | 2738850675 | 2738541301 | Bacteria | 4834102 |
| 271 | 2738866404 | 2738541304 | Bacteria | 4833665 |
| 272 | 2739298922 | 2738543022 | Bacteria | 4835059 |
| 273 | 2739360600 | 2738543033 | Bacteria | 4833336 |
| 274 | 2739652100 | 2739367664 | Bacteria | 4114334 |
| 275 | 2740030574 | 2739367865 | Bacteria | 4114482 |
| 276 | 2819553683 | 2818991438 | Bacteria | 5793701 |
| 277 | 2919143375 | 2919138771 | Bacteria | 5281312 |
| 278 | 2919143552 | 2919138771 | Bacteria | 5281312 |
| 279 | 2928103070 | 2928100450 | Bacteria | 4837635 |
| 280 | 2928104281 | 2928100450 | Bacteria | 4837635 |
| 281 | 2928104732 | 2928100450 | Bacteria | 4837635 |
| 282 | 2928960060 | 2928959182 | Bacteria | 4725774 |
| 283 | 2928962880 | 2928959182 | Bacteria | 4725774 |
| 284 | 2928963366 | 2928959182 | Bacteria | 4725774 |
| 285 | Ga0496102_0001125 | |||
| 286 | SwRhRL2b_contig_3565797 | |||
| 287 | LJQas_1009282 | |||
| 288 | JGI24736J21556_1009535 | |||
| 289 | JGI24740J21852_10019209 | |||
| 290 | JGI24739J22299_10001864 | |||
| 291 | JGI24739J22299_10004570 | |||
| 292 | JGI24737J22298_10020544 | |||
| 293 | Ga0055530_10005349 | |||
| 294 | Ga0055530_10012218 | |||
| 295 | Ga0065704_10085473 | |||
| 296 | Ga0070658_10018703 | |||
| 297 | Ga0070658_10126556 | |||
| 298 | Ga0070690_100012770 | |||
| 299 | Ga0070677_10085090 | |||
| 300 | Ga0070666_10000021 | |||
| 301 | Ga0070682_100159346 | |||
| 302 | Ga0070660_100009719 | |||
| 303 | Ga0070660_100087355 | |||
| 304 | Ga0070660_100183485 | |||
| 305 | Ga0070661_100004976 | |||
| 306 | Ga0070661_100180097 | |||
| 307 | Ga0070668_100083453 | |||
| 308 | Ga0070669_100000149 | |||
| 309 | Ga0070669_100001001 | |||
| 310 | Ga0070669_100043595 | |||
| 311 | Ga0070669_100152317 | |||
| 312 | Ga0070669_100311618 | |||
| 313 | Ga0070673_100007608 | |||
| 314 | Ga0070659_100001999 | |||
| 315 | Ga0070667_100003210 | |||
| 316 | Ga0070663_100004040 | |||
| 317 | Ga0070662_100130122 | |||
| 318 | Ga0070685_10159296 | |||
| 319 | Ga0070679_100097055 | |||
| 320 | Ga0068853_100215460 | |||
| 321 | Ga0070686_100000001 | |||
| 322 | Ga0068855_100037606 | |||
| 323 | Ga0068855_100108194 | |||
| 324 | Ga0068857_100273910 | |||
| 325 | Ga0068857_100374024 | |||
| 326 | Ga0068856_100036721 | |||
| 327 | Ga0068856_100140487 | |||
| 328 | Ga0068856_100199103 | |||
| 329 | Ga0068856_100396191 | |||
| 330 | Ga0068859_100014089 | |||
| 331 | Ga0068858_100006526 | |||
| 332 | Ga0068858_100039582 | |||
| 333 | Ga0068858_100486657 | |||
| 334 | Ga0068860_100000084 | |||
| 335 | Ga0068862_100505514 | |||
| 336 | Ga0075369_10064776 | |||
| 337 | Ga0068865_100035719 | |||
| 338 | Ga0097620_100014089 | |||
| 339 | Ga0105251_10003709 | |||
| 340 | Ga0105250_10008898 | |||
| 341 | Ga0105250_10011658 | |||
| 342 | Ga0105240_10003313 | |||
| 343 | Ga0105240_10092391 | |||
| 344 | Ga0105240_10140976 | |||
| 345 | Ga0105240_10271407 | |||
| 346 | Ga0105247_10025671 | |||
| 347 | Ga0105248_10004996 | |||
| 348 | Ga0105248_10042585 | |||
| 349 | Ga0105248_10060689 | |||
| 350 | Ga0105237_10045218 | |||
| 351 | Ga0105237_10075421 | |||
| 352 | Ga0105237_10105237 | |||
| 353 | Ga0105238_10290539 | |||
| 354 | Ga0105249_10000047 | |||
| 355 | Ga0105239_10011780 | |||
| 356 | Ga0105239_10043409 | |||
| 357 | Ga0105246_10163077 | |||
| 358 | Ga0157373_10161829 | |||
| 359 | Ga0157371_10209838 | |||
| 360 | Ga0157370_10317596 | |||
| 361 | Ga0157369_10000201 | |||
| 362 | Ga0157369_10028580 | |||
| 363 | Ga0157369_10487885 | |||
| 364 | Ga0157378_10034922 | |||
| 365 | Ga0163162_10368922 | |||
| 366 | Ga0207673_1002403 | |||
| 367 | Ga0209676_1027213 | |||
| 368 | Ga0209050_1000192 | |||
| 369 | Ga0209257_1010996 | |||
| 370 | Ga0207697_10009035 | |||
| 371 | Ga0207696_1001435 | |||
| 372 | Ga0207696_1002289 | |||
| 373 | Ga0207713_1000959 | |||
| 374 | Ga0207713_1013074 | |||
| 375 | Ga0207680_10000008 | |||
| 376 | Ga0207647_10000239 | |||
| 377 | Ga0207647_10000621 | |||
| 378 | Ga0207647_10028778 | |||
| 379 | Ga0207643_10047812 | |||
| 380 | Ga0207705_10000888 | |||
| 381 | Ga0207705_10024500 | |||
| 382 | Ga0207654_10003170 | |||
| 383 | Ga0207695_10015767 | |||
| 384 | Ga0207695_10065235 | |||
| 385 | Ga0207695_10166048 | |||
| 386 | Ga0207695_10198201 | |||
| 387 | Ga0207671_10007038 | |||
| 388 | Ga0207671_10032322 | |||
| 389 | Ga0207671_10043166 | |||
| 390 | Ga0207671_10092740 | |||
| 391 | Ga0207671_10198105 | |||
| 392 | Ga0207671_10301754 | |||
| 393 | Ga0207662_10159964 | |||
| 394 | Ga0207657_10036052 | |||
| 395 | Ga0207657_10172629 | |||
| 396 | Ga0207649_10000927 | |||
| 397 | Ga0207649_10079128 | |||
| 398 | Ga0207652_10094112 | |||
| 399 | Ga0207681_10000263 | |||
| 400 | Ga0207681_10013075 | |||
| 401 | Ga0207681_10052097 | |||
| 402 | Ga0207681_10208423 | |||
| 403 | Ga0207694_10002346 | |||
| 404 | Ga0207694_10016766 | |||
| 405 | Ga0207644_10000086 | |||
| 406 | Ga0207690_10016776 | |||
| 407 | Ga0207690_10124878 | |||
| 408 | Ga0207706_10000185 | |||
| 409 | Ga0207711_10078326 | |||
| 410 | Ga0207667_10031130 | |||
| 411 | Ga0207667_10086214 | |||
| 412 | Ga0207667_10144272 | |||
| 413 | Ga0207651_10061186 | |||
| 414 | Ga0207712_10000009 | |||
| 415 | Ga0207712_10328046 | |||
| 416 | Ga0207668_10006756 | |||
| 417 | Ga0207668_10037740 | |||
| 418 | Ga0207640_10060222 | |||
| 419 | Ga0207658_10000550 | |||
| 420 | Ga0207658_10004536 | |||
| 421 | Ga0207703_10040205 | |||
| 422 | Ga0207639_10006629 | |||
| 423 | Ga0207639_10169444 | |||
| 424 | Ga0207678_10003738 | |||
| 425 | Ga0207702_10006193 | |||
| 426 | Ga0207702_10022275 | |||
| 427 | Ga0207702_10022891 | |||
| 428 | Ga0207702_10068924 | |||
| 429 | Ga0207702_10116493 | |||
| 430 | Ga0207702_10300880 | |||
| 431 | Ga0207641_10005431 | |||
| 432 | Ga0207648_10001018 | |||
| 433 | Ga0207676_10000919 | |||
| 434 | Ga0207676_10207023 | |||
| 435 | Ga0207674_10031430 | |||
| 436 | Ga0207698_10008562 | |||
| 437 | Ga0268266_10001691 | |||
| 438 | Ga0268265_10082579 | |||
| 439 | Ga0268264_10000003 | |||
| 440 | Ga0268264_10230212 | |||
| 441 | Ga0307513_10095055 | |||
| 442 | Ga0307408_100000504 | |||
| 443 | Ga0395899_0001276 | |||
| 444 | Ga0395899_0074484 | |||
| 445 | Ga0395899_0154399 | |||
| 446 | Ga0395900_0000130 | |||
| 447 | Ga0395900_0156743 | |||
| 448 | Ga0395900_0190791 | |||
| 449 | Ga0395898_0000618 | |||
| 450 | Ga0395898_0003840 | |||
| 451 | Ga0395905_0000366 | |||
| 452 | Ga0395905_0261844 | |||
| 453 | Ga0395901_0000613 | |||
| 454 | Ga0395901_0650655 | |||
| 455 | Ga0237819_00607 | |||
| 456 | Ga0466966_0000019 | |||
| 457 | Ga0495627_001029 | |||
| 458 | Ga0495650_0000855 | |||
| 459 | Ga0495596_0000026 | |||
| 460 | Ga0495607_0045333 | |||
| 461 | Ga0495610_0000589 | |||
| 462 | Ga0495610_0015956 | |||
| 463 | Ga0495616_0000018 | |||
| 464 | Ga0495616_0000030 | |||
| 465 | Ga0495616_0000358 | |||
| 466 | Ga0495620_0018287 | |||
| 467 | Ga0495632_0000042 | |||
| 468 | Ga0495643_0001609 | |||
| 469 | Ga0495643_0009953 | |||
| 470 | Ga0495663_0000015 | |||
| 471 | Ga0495633_0000127 | |||
| 472 | Ga0495633_0002638 | |||
| 473 | Ga0495671_0146517 | |||
| 474 | Ga0495681_0000349 | |||
| 475 | Ga0496102_0000225 | |||
| 476 | Ga0496102_0000385 | |||
| 477 | Ga0496102_0000554 | |||
| 478 | Ga0496102_0002657 | |||
| 479 | Ga0496102_0006784 | |||
| 480 | Ga0496102_0088773 | |||
| 481 | Ga0496103_0000144 | |||
| 482 | Ga0496103_0000209 | |||
| 483 | Ga0496103_0000349 | |||
| 484 | Ga0496103_0000731 | |||
| 485 | Ga0496103_0003367 | |||
| 486 | Ga0496103_0004870 | |||
| 487 | Ga0496103_0039698 | |||
| 488 | Ga0496105_0002585 | |||
| 489 | Ga0496105_0189519 | |||
| 490 | Ga0496116_0000153 | |||
| 491 | Ga0496116_0000696 | |||
| 492 | Ga0496116_0001497 | |||
| 493 | Ga0496116_0002799 | |||
| 494 | Ga0496116_0045111 | |||
| 495 | Ga0496116_0059978 | |||
| 496 | Ga0496117_0000193 | |||
| 497 | Ga0496117_0000947 | |||
| 498 | Ga0496117_0000976 | |||
| 499 | Ga0496117_0001080 | |||
| 500 | Ga0496117_0001704 | |||
| 501 | Ga0496117_0011650 | |||
| 502 | Ga0496118_0000193 | |||
| 503 | Ga0496118_0000561 | |||
| 504 | Ga0496118_0000812 | |||
| 505 | Ga0496118_0001358 | |||
| 506 | Ga0496118_0001830 | |||
| 507 | Ga0496118_0003788 | |||
| 508 | Ga0496118_0005055 | |||
| 509 | Ga0496119_0004133 | |||
| 510 | Ga0496119_0016228 | |||
| 511 | Ga0496119_0028603 | |||
| 512 | Ga0496119_0066565 | |||
| 513 | Ga0496119_0091086 | |||
| 514 | Ga0496120_0070934 | |||
| 515 | Ga0496120_0082689 | |||
| 516 | Ga0496120_0090267 | |||
| 517 | Ga0496121_0004148 | |||
| 518 | Ga0496122_0000094 | |||
| 519 | Ga0496123_0000116 | |||
| 520 | Ga0496123_0012416 | |||
| 521 | Ga0496124_0000237 | |||
| 522 | Ga0496124_0000566 | |||
| 523 | Ga0496124_0000588 | |||
| 524 | Ga0496124_0000848 | |||
| 525 | Ga0496124_0001488 | |||
| 526 | Ga0496124_0001601 | |||
| 527 | Ga0496124_0001742 | |||
| 528 | Ga0496124_0004977 | |||
| 529 | Ga0496125_0000663 | |||
| 530 | Ga0496125_0004644 | |||
| 531 | Ga0496126_0000058 | |||
| 532 | Ga0496126_0001697 | |||
| 533 | Ga0501201_002529 | |||
| 534 | Ga0501206_004556 | |||
| 535 | Ga0501206_015049 | |||
| 536 | Ga0501211_000554 | |||
| 537 | Ga0501211_001151 | |||
| 538 | Ga0501211_002051 | |||
| 539 | Ga0501235_001570 | |||
| 540 | Ga0501235_003528 | |||
| 541 | Ga0501235_008577 | |||
| 542 | Ga0501225_0004017 | |||
| 543 | Ga0501225_0016594 | |||
| 544 | Ga0501245_004880 | |||
| 545 | Ga0500643_000287 | |||
| 546 | Ga0500643_000322 | |||
| 547 | Ga0500643_000361 | |||
| 548 | Ga0500556_0000021 | |||
| 549 | Ga0500608_000042 | |||
| 550 | Ga0500573_0088146 | |||
| 551 | Ga0500627_0000156 | |||
| 552 | Ga0500627_0001669 | |||
| 553 | 2738712250 | |||
| 554 | 2738850675 | |||
| 555 | 2738866404 | |||
| 556 | 2739298922 | |||
| 557 | 2739360600 | |||
| 558 | 2739652100 | |||
| 559 | 2740030574 | |||
| 560 | 2819553683 | |||
| 561 | 2919143375 | |||
| 562 | 2919143552 | |||
| 563 | 2928103070 | |||
| 564 | 2928104281 | |||
| 565 | 2928104732 | |||
| 566 | 2928960060 | |||
| 567 | 2928962880 | |||
| 568 | 2928963366 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nqf-assembly1.cif.gz_A | crystal structure of hepn domain protein | 0.9723 | 156 | 295 |
| 4nqf-assembly1.cif.gz_A | crystal structure of hepn domain protein | 0.9332 | 156 | 295 |
| 1ufb-assembly1.cif.gz_A | crystal structure of tt1696 from thermus thermophilus hb8 | 0.7489 | 168 | 292 |
| 2hsb-assembly1.cif.gz_A | crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution | 0.7473 | 167 | 294 |
| 1ufb-assembly1.cif.gz_A | crystal structure of tt1696 from thermus thermophilus hb8 | 0.7217 | 168 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nqfA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.9669 | 156 | 295 | 1.20.120.330 |
| 4nqfA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.9273 | 156 | 295 | 1.20.120.330 |
| af_Q58022_9_132_1.20.120.330 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.8013 | 165 | 292 | 1.20.120.330 |
| af_Q57607_11_134_1.20.120.330 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.7943 | 166 | 292 | 1.20.120.330 |
| af_Q58022_9_132_1.20.120.330 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.7722 | 165 | 292 | 1.20.120.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3B7A4-F1-model_v4 | Nucleotidyltransferase | 0.9948 | 199 | 303 |
GO:0016740
|
| AF-W4LJ61-F1-model_v4 | HEPN domain-containing protein | 0.9942 | 178 | 301 |
|
| AF-A0A7Y9VNN5-F1-model_v4 | deleted | 0.9903 | 192 | 303 |
|
| AF-A0A4V6NHZ9-F1-model_v4 | HEPN domain-containing protein | 0.9901 | 163 | 304 |
|
| AF-A0A249Q0C4-F1-model_v4 | deleted | 0.9898 | 177 | 303 |
|