F386404

General Info

Members Datasets Scaffolds Average Seq Length
284 152 568 308

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0001125|Ga0496102_0001125_22283_23326
Length 347
Sequence MWTPVNVQAQSFLISLSRHRQFGVDRPCQSAPHRRVIRMDMRTDLDHLPPIKQRDLERAVEILFEEFKDATSLATGSWKKAGRILKIVLFGSYARGGWVDEPHTAKGYKSDYDLLIIVNDKRLTDRAEFWAKAQERLIREHSIAKSLTAPVNFIVHTLQEVNDALAHGRYFFMDIASDGIALYQSDDTELHTPKPKTPKQALAMAKEYFEEWYPSAGEFFDDFRANVEKRRSKKAAFELHQAAERLLHTVLLVTTFYTSHTHNLDYLRSQAERIDRRLVHVWPRDTRKERAMFEKLKDAYVKARYSKHYRITQDELSWLGAQVEELGRVVHQVCSERIAELEKAARG

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
132 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
133 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
134 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
135 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
136 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
137 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
142 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
143 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
144 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
145 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
146 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
147 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
148 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
149 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
150 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
151 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
152 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 0
Isolates 5.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 5.63
Rhizosphere 69.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0001125 3300048905 Bacteria 24540
2 SwRhRL2b_contig_3565797 2162886007 Bacteria 4074
3 LJQas_1009282 3300000549 Bacteria 1186
4 JGI24736J21556_1009535 3300001904 Bacteria 1599
5 JGI24740J21852_10019209 3300001979 Bacteria 2412
6 JGI24739J22299_10001864 3300001989 Bacteria 8043
7 JGI24739J22299_10004570 3300001989 Bacteria 5291
8 JGI24737J22298_10020544 3300001990 Bacteria 2108
9 Ga0055530_10005349 3300003791 Bacteria 6139
10 Ga0055530_10012218 3300003791 Bacteria 3011
11 Ga0065704_10085473 3300005289 Bacteria 3218
12 Ga0070658_10018703 3300005327 Bacteria 5550
13 Ga0070658_10126556 3300005327 Bacteria 2127
14 Ga0070690_100012770 3300005330 Bacteria 4947
15 Ga0070677_10085090 3300005333 Bacteria 1363
16 Ga0070666_10000021 3300005335 Bacteria 167450
17 Ga0070682_100159346 3300005337 Bacteria 1557
18 Ga0070660_100009719 3300005339 Bacteria 6778
19 Ga0070660_100087355 3300005339 Bacteria 2454
20 Ga0070660_100183485 3300005339 Bacteria 1694
21 Ga0070661_100004976 3300005344 Bacteria 9153
22 Ga0070661_100180097 3300005344 Bacteria 1608
23 Ga0070668_100083453 3300005347 Bacteria 2508
24 Ga0070669_100000149 3300005353 Bacteria 62788
25 Ga0070669_100001001 3300005353 Bacteria 20581
26 Ga0070669_100043595 3300005353 Bacteria 3268
27 Ga0070669_100152317 3300005353 Bacteria 1791
28 Ga0070669_100311618 3300005353 Bacteria 1269
29 Ga0070673_100007608 3300005364 Bacteria 7167
30 Ga0070659_100001999 3300005366 Bacteria 14575
31 Ga0070667_100003210 3300005367 Bacteria 14005
32 Ga0070663_100004040 3300005455 Bacteria 8563
33 Ga0070662_100130122 3300005457 Bacteria 1939
34 Ga0070685_10159296 3300005466 Bacteria 1437
35 Ga0070679_100097055 3300005530 Bacteria 2935
36 Ga0068853_100215460 3300005539 Bacteria 1752
37 Ga0070686_100000001 3300005544 Bacteria 515830
38 Ga0068855_100037606 3300005563 Bacteria 5755
39 Ga0068855_100108194 3300005563 Bacteria 3193
40 Ga0068857_100273910 3300005577 Bacteria 1551
41 Ga0068857_100374024 3300005577 Bacteria 1322
42 Ga0068856_100036721 3300005614 Bacteria 4804
43 Ga0068856_100140487 3300005614 Bacteria 2422
44 Ga0068856_100199103 3300005614 Bacteria 2017
45 Ga0068856_100396191 3300005614 Bacteria 1400
46 Ga0068859_100014089 3300005617 Bacteria 8019
47 Ga0068858_100006526 3300005842 Bacteria 11350
48 Ga0068858_100039582 3300005842 Bacteria 4371
49 Ga0068858_100486657 3300005842 Bacteria 1191
50 Ga0068860_100000084 3300005843 Bacteria 167450
51 Ga0068862_100505514 3300005844 Bacteria 1148
52 Ga0075369_10064776 3300006186 Bacteria 1601
53 Ga0068865_100035719 3300006881 Bacteria 3346
54 Ga0097620_100014089 3300006931 Bacteria 8019
55 Ga0105251_10003709 3300009011 Bacteria 10955
56 Ga0105250_10008898 3300009092 Bacteria 4245
57 Ga0105250_10011658 3300009092 Bacteria 3644
58 Ga0105240_10003313 3300009093 Bacteria 25169
59 Ga0105240_10092391 3300009093 Bacteria 3695
60 Ga0105240_10140976 3300009093 Bacteria 2882
61 Ga0105240_10271407 3300009093 Bacteria 1952
62 Ga0105247_10025671 3300009101 Bacteria 3555
63 Ga0105248_10004996 3300009177 Bacteria 14655
64 Ga0105248_10042585 3300009177 Bacteria 5093
65 Ga0105248_10060689 3300009177 Bacteria 4245
66 Ga0105237_10045218 3300009545 Bacteria 4432
67 Ga0105237_10075421 3300009545 Bacteria 3364
68 Ga0105237_10105237 3300009545 Bacteria 2813
69 Ga0105238_10290539 3300009551 Bacteria 1617
70 Ga0105249_10000047 3300009553 Bacteria 176249
71 Ga0105239_10011780 3300010375 Bacteria 9759
72 Ga0105239_10043409 3300010375 Bacteria 4928
73 Ga0105246_10163077 3300011119 Bacteria 1700
74 Ga0157373_10161829 3300013100 Bacteria 1575
75 Ga0157371_10209838 3300013102 Bacteria 1397
76 Ga0157370_10317596 3300013104 Bacteria 1437
77 Ga0157369_10000201 3300013105 Bacteria 82836
78 Ga0157369_10028580 3300013105 Bacteria 6170
79 Ga0157369_10487885 3300013105 Bacteria 1275
80 Ga0157378_10034922 3300013297 Bacteria 4445
81 Ga0163162_10368922 3300013306 Bacteria 1569
82 Ga0207673_1002403 3300025290 Bacteria 2134
83 Ga0209676_1027213 3300025292 Bacteria 1803
84 Ga0209050_1000192 3300025298 Bacteria 138262
85 Ga0209257_1010996 3300025304 Bacteria 4446
86 Ga0207697_10009035 3300025315 Bacteria 4322
87 Ga0207696_1001435 3300025711 Bacteria 12952
88 Ga0207696_1002289 3300025711 Bacteria 9510
89 Ga0207713_1000959 3300025735 Bacteria 25589
90 Ga0207713_1013074 3300025735 Bacteria 4398
91 Ga0207680_10000008 3300025903 Bacteria 518177
92 Ga0207647_10000239 3300025904 Bacteria 44964
93 Ga0207647_10000621 3300025904 Bacteria 27652
94 Ga0207647_10028778 3300025904 Bacteria 3605
95 Ga0207643_10047812 3300025908 Bacteria 2422
96 Ga0207705_10000888 3300025909 Bacteria 24464
97 Ga0207705_10024500 3300025909 Bacteria 4306
98 Ga0207654_10003170 3300025911 Bacteria 8306
99 Ga0207695_10015767 3300025913 Bacteria 8881
100 Ga0207695_10065235 3300025913 Bacteria 3744
101 Ga0207695_10166048 3300025913 Bacteria 2136
102 Ga0207695_10198201 3300025913 Bacteria 1923
103 Ga0207671_10007038 3300025914 Bacteria 9854
104 Ga0207671_10032322 3300025914 Bacteria 3896
105 Ga0207671_10043166 3300025914 Bacteria 3334
106 Ga0207671_10092740 3300025914 Bacteria 2277
107 Ga0207671_10198105 3300025914 Bacteria 1568
108 Ga0207671_10301754 3300025914 Bacteria 1265
109 Ga0207662_10159964 3300025918 Bacteria 1438
110 Ga0207657_10036052 3300025919 Bacteria 4429
111 Ga0207657_10172629 3300025919 Bacteria 1751
112 Ga0207649_10000927 3300025920 Bacteria 18447
113 Ga0207649_10079128 3300025920 Bacteria 2123
114 Ga0207652_10094112 3300025921 Bacteria 2638
115 Ga0207681_10000263 3300025923 Bacteria 40042
116 Ga0207681_10013075 3300025923 Bacteria 5132
117 Ga0207681_10052097 3300025923 Bacteria 2774
118 Ga0207681_10208423 3300025923 Bacteria 1505
119 Ga0207694_10002346 3300025924 Bacteria 15482
120 Ga0207694_10016766 3300025924 Bacteria 5537
121 Ga0207644_10000086 3300025931 Bacteria 67611
122 Ga0207690_10016776 3300025932 Bacteria 4463
123 Ga0207690_10124878 3300025932 Bacteria 1875
124 Ga0207706_10000185 3300025933 Bacteria 69659
125 Ga0207711_10078326 3300025941 Bacteria 2883
126 Ga0207667_10031130 3300025949 Bacteria 5762
127 Ga0207667_10086214 3300025949 Bacteria 3250
128 Ga0207667_10144272 3300025949 Bacteria 2451
129 Ga0207651_10061186 3300025960 Bacteria 2617
130 Ga0207712_10000009 3300025961 Bacteria 518177
131 Ga0207712_10328046 3300025961 Bacteria 1265
132 Ga0207668_10006756 3300025972 Bacteria 6789
133 Ga0207668_10037740 3300025972 Bacteria 3236
134 Ga0207640_10060222 3300025981 Bacteria 2509
135 Ga0207658_10000550 3300025986 Bacteria 33998
136 Ga0207658_10004536 3300025986 Bacteria 9646
137 Ga0207703_10040205 3300026035 Bacteria 3741
138 Ga0207639_10006629 3300026041 Bacteria 7873
139 Ga0207639_10169444 3300026041 Bacteria 1848
140 Ga0207678_10003738 3300026067 Bacteria 13694
141 Ga0207702_10006193 3300026078 Bacteria 10349
142 Ga0207702_10022275 3300026078 Bacteria 5251
143 Ga0207702_10022891 3300026078 Bacteria 5184
144 Ga0207702_10068924 3300026078 Bacteria 3040
145 Ga0207702_10116493 3300026078 Bacteria 2384
146 Ga0207702_10300880 3300026078 Bacteria 1522
147 Ga0207641_10005431 3300026088 Bacteria 10877
148 Ga0207648_10001018 3300026089 Bacteria 31561
149 Ga0207676_10000919 3300026095 Bacteria 22815
150 Ga0207676_10207023 3300026095 Bacteria 1737
151 Ga0207674_10031430 3300026116 Bacteria 5578
152 Ga0207698_10008562 3300026142 Bacteria 6482
153 Ga0268266_10001691 3300028379 Bacteria 25327
154 Ga0268265_10082579 3300028380 Bacteria 2541
155 Ga0268264_10000003 3300028381 Bacteria 1141976
156 Ga0268264_10230212 3300028381 Bacteria 1711
157 Ga0307513_10095055 3300031456 Bacteria 3023
158 Ga0307408_100000504 3300031548 Bacteria 33924
159 Ga0395899_0001276 3300037312 Bacteria 21890
160 Ga0395899_0074484 3300037312 Bacteria 2480
161 Ga0395899_0154399 3300037312 Bacteria 1625
162 Ga0395900_0000130 3300037418 Bacteria 126231
163 Ga0395900_0156743 3300037418 Bacteria 2325
164 Ga0395900_0190791 3300037418 Bacteria 2078
165 Ga0395898_0000618 3300037466 Bacteria 65182
166 Ga0395898_0003840 3300037466 Bacteria 16653
167 Ga0395905_0000366 3300037471 Bacteria 64169
168 Ga0395905_0261844 3300037471 Bacteria 1614
169 Ga0395901_0000613 3300038443 Bacteria 41465
170 Ga0395901_0650655 3300038443 Bacteria 1057
171 Ga0237819_00607 3300038705 Bacteria 11825
172 Ga0466966_0000019 3300044684 Bacteria 120521
173 Ga0495627_001029 3300046453 Bacteria 18653
174 Ga0495650_0000855 3300046471 Bacteria 36596
175 Ga0495596_0000026 3300046500 Bacteria 104636
176 Ga0495607_0045333 3300046501 Bacteria 2588
177 Ga0495610_0000589 3300046512 Bacteria 36002
178 Ga0495610_0015956 3300046512 Bacteria 4344
179 Ga0495616_0000018 3300046513 Bacteria 167281
180 Ga0495616_0000030 3300046513 Bacteria 132950
181 Ga0495616_0000358 3300046513 Bacteria 35867
182 Ga0495620_0018287 3300046515 Bacteria 3473
183 Ga0495632_0000042 3300046519 Bacteria 145186
184 Ga0495643_0001609 3300046522 Bacteria 19996
185 Ga0495643_0009953 3300046522 Bacteria 5874
186 Ga0495663_0000015 3300046525 Bacteria 145185
187 Ga0495633_0000127 3300046558 Bacteria 101471
188 Ga0495633_0002638 3300046558 Bacteria 12497
189 Ga0495671_0146517 3300046692 Bacteria 1150
190 Ga0495681_0000349 3300047470 Bacteria 36067
191 Ga0496102_0000225 3300048905 Bacteria 74792
192 Ga0496102_0000385 3300048905 Bacteria 52138
193 Ga0496102_0000554 3300048905 Bacteria 40135
194 Ga0496102_0002657 3300048905 Bacteria 15204
195 Ga0496102_0006784 3300048905 Bacteria 9770
196 Ga0496102_0088773 3300048905 Bacteria 2859
197 Ga0496103_0000144 3300048906 Bacteria 74526
198 Ga0496103_0000209 3300048906 Bacteria 58516
199 Ga0496103_0000349 3300048906 Bacteria 42000
200 Ga0496103_0000731 3300048906 Bacteria 24224
201 Ga0496103_0003367 3300048906 Bacteria 9771
202 Ga0496103_0004870 3300048906 Bacteria 8108
203 Ga0496103_0039698 3300048906 Bacteria 2892
204 Ga0496105_0002585 3300048908 Bacteria 13162
205 Ga0496105_0189519 3300048908 Bacteria 1682
206 Ga0496116_0000153 3300048919 Bacteria 141137
207 Ga0496116_0000696 3300048919 Bacteria 43542
208 Ga0496116_0001497 3300048919 Bacteria 26015
209 Ga0496116_0002799 3300048919 Bacteria 17915
210 Ga0496116_0045111 3300048919 Bacteria 2987
211 Ga0496116_0059978 3300048919 Bacteria 2470
212 Ga0496117_0000193 3300048920 Bacteria 123780
213 Ga0496117_0000947 3300048920 Bacteria 44357
214 Ga0496117_0000976 3300048920 Bacteria 43801
215 Ga0496117_0001080 3300048920 Bacteria 41299
216 Ga0496117_0001704 3300048920 Bacteria 30475
217 Ga0496117_0011650 3300048920 Bacteria 7855
218 Ga0496118_0000193 3300048921 Bacteria 107307
219 Ga0496118_0000561 3300048921 Bacteria 61276
220 Ga0496118_0000812 3300048921 Bacteria 49836
221 Ga0496118_0001358 3300048921 Bacteria 36859
222 Ga0496118_0001830 3300048921 Bacteria 30475
223 Ga0496118_0003788 3300048921 Bacteria 18650
224 Ga0496118_0005055 3300048921 Bacteria 15204
225 Ga0496119_0004133 3300048922 Bacteria 14618
226 Ga0496119_0016228 3300048922 Bacteria 5684
227 Ga0496119_0028603 3300048922 Bacteria 3798
228 Ga0496119_0066565 3300048922 Bacteria 2128
229 Ga0496119_0091086 3300048922 Bacteria 1732
230 Ga0496120_0070934 3300048923 Bacteria 1915
231 Ga0496120_0082689 3300048923 Bacteria 1735
232 Ga0496120_0090267 3300048923 Bacteria 1639
233 Ga0496121_0004148 3300048924 Bacteria 19817
234 Ga0496122_0000094 3300048925 Bacteria 202047
235 Ga0496123_0000116 3300048926 Bacteria 161699
236 Ga0496123_0012416 3300048926 Bacteria 7264
237 Ga0496124_0000237 3300048927 Bacteria 107270
238 Ga0496124_0000566 3300048927 Bacteria 62517
239 Ga0496124_0000588 3300048927 Bacteria 61276
240 Ga0496124_0000848 3300048927 Bacteria 49859
241 Ga0496124_0001488 3300048927 Bacteria 34405
242 Ga0496124_0001601 3300048927 Bacteria 32582
243 Ga0496124_0001742 3300048927 Bacteria 30475
244 Ga0496124_0004977 3300048927 Bacteria 15204
245 Ga0496125_0000663 3300048928 Bacteria 57400
246 Ga0496125_0004644 3300048928 Bacteria 15677
247 Ga0496126_0000058 3300048929 Bacteria 272530
248 Ga0496126_0001697 3300048929 Bacteria 32726
249 Ga0501201_002529 3300049651 Bacteria 1676
250 Ga0501206_004556 3300049653 Bacteria 1765
251 Ga0501206_015049 3300049653 Bacteria 1068
252 Ga0501211_000554 3300049658 Bacteria 3695
253 Ga0501211_001151 3300049658 Bacteria 2806
254 Ga0501211_002051 3300049658 Bacteria 2149
255 Ga0501235_001570 3300049669 Bacteria 4895
256 Ga0501235_003528 3300049669 Bacteria 3385
257 Ga0501235_008577 3300049669 Bacteria 2231
258 Ga0501225_0004017 3300049705 Bacteria 4403
259 Ga0501225_0016594 3300049705 Bacteria 2048
260 Ga0501245_004880 3300049708 Bacteria 1850
261 Ga0500643_000287 3300053087 Bacteria 43495
262 Ga0500643_000322 3300053087 Bacteria 38615
263 Ga0500643_000361 3300053087 Bacteria 36161
264 Ga0500556_0000021 3300053104 Bacteria 184159
265 Ga0500608_000042 3300053122 Bacteria 56626
266 Ga0500573_0088146 3300053140 Bacteria 1756
267 Ga0500627_0000156 3300053158 Bacteria 20300
268 Ga0500627_0001669 3300053158 Bacteria 6283
269 2738712250 2738541275 Bacteria 4830863
270 2738850675 2738541301 Bacteria 4834102
271 2738866404 2738541304 Bacteria 4833665
272 2739298922 2738543022 Bacteria 4835059
273 2739360600 2738543033 Bacteria 4833336
274 2739652100 2739367664 Bacteria 4114334
275 2740030574 2739367865 Bacteria 4114482
276 2819553683 2818991438 Bacteria 5793701
277 2919143375 2919138771 Bacteria 5281312
278 2919143552 2919138771 Bacteria 5281312
279 2928103070 2928100450 Bacteria 4837635
280 2928104281 2928100450 Bacteria 4837635
281 2928104732 2928100450 Bacteria 4837635
282 2928960060 2928959182 Bacteria 4725774
283 2928962880 2928959182 Bacteria 4725774
284 2928963366 2928959182 Bacteria 4725774
285 Ga0496102_0001125
286 SwRhRL2b_contig_3565797
287 LJQas_1009282
288 JGI24736J21556_1009535
289 JGI24740J21852_10019209
290 JGI24739J22299_10001864
291 JGI24739J22299_10004570
292 JGI24737J22298_10020544
293 Ga0055530_10005349
294 Ga0055530_10012218
295 Ga0065704_10085473
296 Ga0070658_10018703
297 Ga0070658_10126556
298 Ga0070690_100012770
299 Ga0070677_10085090
300 Ga0070666_10000021
301 Ga0070682_100159346
302 Ga0070660_100009719
303 Ga0070660_100087355
304 Ga0070660_100183485
305 Ga0070661_100004976
306 Ga0070661_100180097
307 Ga0070668_100083453
308 Ga0070669_100000149
309 Ga0070669_100001001
310 Ga0070669_100043595
311 Ga0070669_100152317
312 Ga0070669_100311618
313 Ga0070673_100007608
314 Ga0070659_100001999
315 Ga0070667_100003210
316 Ga0070663_100004040
317 Ga0070662_100130122
318 Ga0070685_10159296
319 Ga0070679_100097055
320 Ga0068853_100215460
321 Ga0070686_100000001
322 Ga0068855_100037606
323 Ga0068855_100108194
324 Ga0068857_100273910
325 Ga0068857_100374024
326 Ga0068856_100036721
327 Ga0068856_100140487
328 Ga0068856_100199103
329 Ga0068856_100396191
330 Ga0068859_100014089
331 Ga0068858_100006526
332 Ga0068858_100039582
333 Ga0068858_100486657
334 Ga0068860_100000084
335 Ga0068862_100505514
336 Ga0075369_10064776
337 Ga0068865_100035719
338 Ga0097620_100014089
339 Ga0105251_10003709
340 Ga0105250_10008898
341 Ga0105250_10011658
342 Ga0105240_10003313
343 Ga0105240_10092391
344 Ga0105240_10140976
345 Ga0105240_10271407
346 Ga0105247_10025671
347 Ga0105248_10004996
348 Ga0105248_10042585
349 Ga0105248_10060689
350 Ga0105237_10045218
351 Ga0105237_10075421
352 Ga0105237_10105237
353 Ga0105238_10290539
354 Ga0105249_10000047
355 Ga0105239_10011780
356 Ga0105239_10043409
357 Ga0105246_10163077
358 Ga0157373_10161829
359 Ga0157371_10209838
360 Ga0157370_10317596
361 Ga0157369_10000201
362 Ga0157369_10028580
363 Ga0157369_10487885
364 Ga0157378_10034922
365 Ga0163162_10368922
366 Ga0207673_1002403
367 Ga0209676_1027213
368 Ga0209050_1000192
369 Ga0209257_1010996
370 Ga0207697_10009035
371 Ga0207696_1001435
372 Ga0207696_1002289
373 Ga0207713_1000959
374 Ga0207713_1013074
375 Ga0207680_10000008
376 Ga0207647_10000239
377 Ga0207647_10000621
378 Ga0207647_10028778
379 Ga0207643_10047812
380 Ga0207705_10000888
381 Ga0207705_10024500
382 Ga0207654_10003170
383 Ga0207695_10015767
384 Ga0207695_10065235
385 Ga0207695_10166048
386 Ga0207695_10198201
387 Ga0207671_10007038
388 Ga0207671_10032322
389 Ga0207671_10043166
390 Ga0207671_10092740
391 Ga0207671_10198105
392 Ga0207671_10301754
393 Ga0207662_10159964
394 Ga0207657_10036052
395 Ga0207657_10172629
396 Ga0207649_10000927
397 Ga0207649_10079128
398 Ga0207652_10094112
399 Ga0207681_10000263
400 Ga0207681_10013075
401 Ga0207681_10052097
402 Ga0207681_10208423
403 Ga0207694_10002346
404 Ga0207694_10016766
405 Ga0207644_10000086
406 Ga0207690_10016776
407 Ga0207690_10124878
408 Ga0207706_10000185
409 Ga0207711_10078326
410 Ga0207667_10031130
411 Ga0207667_10086214
412 Ga0207667_10144272
413 Ga0207651_10061186
414 Ga0207712_10000009
415 Ga0207712_10328046
416 Ga0207668_10006756
417 Ga0207668_10037740
418 Ga0207640_10060222
419 Ga0207658_10000550
420 Ga0207658_10004536
421 Ga0207703_10040205
422 Ga0207639_10006629
423 Ga0207639_10169444
424 Ga0207678_10003738
425 Ga0207702_10006193
426 Ga0207702_10022275
427 Ga0207702_10022891
428 Ga0207702_10068924
429 Ga0207702_10116493
430 Ga0207702_10300880
431 Ga0207641_10005431
432 Ga0207648_10001018
433 Ga0207676_10000919
434 Ga0207676_10207023
435 Ga0207674_10031430
436 Ga0207698_10008562
437 Ga0268266_10001691
438 Ga0268265_10082579
439 Ga0268264_10000003
440 Ga0268264_10230212
441 Ga0307513_10095055
442 Ga0307408_100000504
443 Ga0395899_0001276
444 Ga0395899_0074484
445 Ga0395899_0154399
446 Ga0395900_0000130
447 Ga0395900_0156743
448 Ga0395900_0190791
449 Ga0395898_0000618
450 Ga0395898_0003840
451 Ga0395905_0000366
452 Ga0395905_0261844
453 Ga0395901_0000613
454 Ga0395901_0650655
455 Ga0237819_00607
456 Ga0466966_0000019
457 Ga0495627_001029
458 Ga0495650_0000855
459 Ga0495596_0000026
460 Ga0495607_0045333
461 Ga0495610_0000589
462 Ga0495610_0015956
463 Ga0495616_0000018
464 Ga0495616_0000030
465 Ga0495616_0000358
466 Ga0495620_0018287
467 Ga0495632_0000042
468 Ga0495643_0001609
469 Ga0495643_0009953
470 Ga0495663_0000015
471 Ga0495633_0000127
472 Ga0495633_0002638
473 Ga0495671_0146517
474 Ga0495681_0000349
475 Ga0496102_0000225
476 Ga0496102_0000385
477 Ga0496102_0000554
478 Ga0496102_0002657
479 Ga0496102_0006784
480 Ga0496102_0088773
481 Ga0496103_0000144
482 Ga0496103_0000209
483 Ga0496103_0000349
484 Ga0496103_0000731
485 Ga0496103_0003367
486 Ga0496103_0004870
487 Ga0496103_0039698
488 Ga0496105_0002585
489 Ga0496105_0189519
490 Ga0496116_0000153
491 Ga0496116_0000696
492 Ga0496116_0001497
493 Ga0496116_0002799
494 Ga0496116_0045111
495 Ga0496116_0059978
496 Ga0496117_0000193
497 Ga0496117_0000947
498 Ga0496117_0000976
499 Ga0496117_0001080
500 Ga0496117_0001704
501 Ga0496117_0011650
502 Ga0496118_0000193
503 Ga0496118_0000561
504 Ga0496118_0000812
505 Ga0496118_0001358
506 Ga0496118_0001830
507 Ga0496118_0003788
508 Ga0496118_0005055
509 Ga0496119_0004133
510 Ga0496119_0016228
511 Ga0496119_0028603
512 Ga0496119_0066565
513 Ga0496119_0091086
514 Ga0496120_0070934
515 Ga0496120_0082689
516 Ga0496120_0090267
517 Ga0496121_0004148
518 Ga0496122_0000094
519 Ga0496123_0000116
520 Ga0496123_0012416
521 Ga0496124_0000237
522 Ga0496124_0000566
523 Ga0496124_0000588
524 Ga0496124_0000848
525 Ga0496124_0001488
526 Ga0496124_0001601
527 Ga0496124_0001742
528 Ga0496124_0004977
529 Ga0496125_0000663
530 Ga0496125_0004644
531 Ga0496126_0000058
532 Ga0496126_0001697
533 Ga0501201_002529
534 Ga0501206_004556
535 Ga0501206_015049
536 Ga0501211_000554
537 Ga0501211_001151
538 Ga0501211_002051
539 Ga0501235_001570
540 Ga0501235_003528
541 Ga0501235_008577
542 Ga0501225_0004017
543 Ga0501225_0016594
544 Ga0501245_004880
545 Ga0500643_000287
546 Ga0500643_000322
547 Ga0500643_000361
548 Ga0500556_0000021
549 Ga0500608_000042
550 Ga0500573_0088146
551 Ga0500627_0000156
552 Ga0500627_0001669
553 2738712250
554 2738850675
555 2738866404
556 2739298922
557 2739360600
558 2739652100
559 2740030574
560 2819553683
561 2919143375
562 2919143552
563 2928103070
564 2928104281
565 2928104732
566 2928960060
567 2928962880
568 2928963366

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05168

HEPN

HEPN domain

209

333

0.9

PF18765

Polbeta

Polymerase beta, Nucleotidyltransferase

76

188

0.9

PF01909

NTP_transf_2

Nucleotidyltransferase domain

72

170

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nqf-assembly1.cif.gz_A crystal structure of hepn domain protein 0.9723 156 295
4nqf-assembly1.cif.gz_A crystal structure of hepn domain protein 0.9332 156 295
1ufb-assembly1.cif.gz_A crystal structure of tt1696 from thermus thermophilus hb8 0.7489 168 292
2hsb-assembly1.cif.gz_A crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution 0.7473 167 294
1ufb-assembly1.cif.gz_A crystal structure of tt1696 from thermus thermophilus hb8 0.7217 168 292
ID Description Score Start End Superfamily
4nqfA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.9669 156 295 1.20.120.330
4nqfA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.9273 156 295 1.20.120.330
af_Q58022_9_132_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8013 165 292 1.20.120.330
af_Q57607_11_134_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7943 166 292 1.20.120.330
af_Q58022_9_132_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7722 165 292 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A2N3B7A4-F1-model_v4 Nucleotidyltransferase 0.9948 199 303 GO:0016740
AF-W4LJ61-F1-model_v4 HEPN domain-containing protein 0.9942 178 301
AF-A0A7Y9VNN5-F1-model_v4 deleted 0.9903 192 303
AF-A0A4V6NHZ9-F1-model_v4 HEPN domain-containing protein 0.9901 163 304
AF-A0A249Q0C4-F1-model_v4 deleted 0.9898 177 303

Map