F386458

General Info

Members Datasets Scaffolds Average Seq Length
284 259 568 71

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_515822_c1|nmdc:mga06r32_515822_c1_150_410
Length 86
Sequence MMYAQYMQAPTKEVRVSKWIRQTHRWLSIIFTATVIANFVAMALGEPPAWVVYSPLPPLFLMLVTGLYMFVLPYAATWCSARSAGA

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
54 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
85 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
86 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
87 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
128 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
131 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
134 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
135 2509276019 Ensifer aridi TW10 Isolate Nodule
136 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
137 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
138 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
139 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
140 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
141 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
142 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
143 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
144 2643221584 Caulobacter sp. Root656 Isolate Unclassified
145 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
146 2643221651 Afipia sp. Root123D2 Isolate Unclassified
147 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
148 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
149 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
150 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
151 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
152 2818991467 Bosea vestrisii 3192 Isolate Unclassified
153 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
154 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
155 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
156 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
157 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
158 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
159 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
160 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
161 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
162 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
163 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
164 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
165 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
166 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
167 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
168 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
169 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
170 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
171 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
172 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
173 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
174 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
175 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
176 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
177 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
178 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
179 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
180 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
181 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
182 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
183 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
184 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
185 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
186 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
187 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
188 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
189 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
190 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
191 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
192 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
193 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
194 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
195 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
196 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
197 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
198 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
199 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
200 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
201 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
202 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
203 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
204 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
205 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
206 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
207 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
208 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
209 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
210 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
211 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
212 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
213 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
214 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
215 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
216 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
217 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
218 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
219 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
220 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
221 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
222 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
223 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
224 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
225 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
226 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
227 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
228 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
229 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
230 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
231 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
232 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
233 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
234 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
235 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
236 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
237 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
238 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
239 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
240 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
241 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
242 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
243 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
244 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
245 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
246 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
247 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
248 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
249 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
250 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
251 3004167301 Mesorhizobium loti 582 Isolate Unclassified
252 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
253 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
254 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
255 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
256 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
257 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
258 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
259 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.93
Metatranscriptomes 0.35
Isolates 44.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.49
Nodule 38.38
Rhizoplane 3.17
Rhizosphere 34.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_515822_c1 3300050510 Bacteria 1171
2 JGI24740J21852_10120985 3300001979 Bacteria 656
3 JGI25151J46595_10047140 3300003187 Bacteria 1502
4 Ga0055542_1000845 3300003762 Bacteria 21558
5 Ga0055529_1017818 3300003763 Bacteria 889
6 Ga0055524_1008537 3300003775 Bacteria 4248
7 Ga0065165_1003955 3300005262 Bacteria 9722
8 Ga0070658_11017137 3300005327 Bacteria 721
9 Ga0070666_10526987 3300005335 Bacteria 858
10 Ga0070660_100220471 3300005339 Bacteria 1541
11 Ga0070661_100167319 3300005344 Bacteria 1668
12 Ga0070674_101002888 3300005356 Bacteria 733
13 Ga0070673_101355029 3300005364 Bacteria 669
14 Ga0070659_100779373 3300005366 Bacteria 831
15 Ga0070713_101061634 3300005436 Bacteria 782
16 Ga0070663_100069211 3300005455 Bacteria 2563
17 Ga0068867_100912665 3300005459 Bacteria 791
18 Ga0068853_100290340 3300005539 Bacteria 1509
19 Ga0068855_100830033 3300005563 Bacteria 981
20 Ga0070664_100146364 3300005564 Bacteria 2084
21 Ga0068854_100912153 3300005578 Bacteria 773
22 Ga0068856_100345350 3300005614 Bacteria 1507
23 Ga0068852_100173888 3300005616 Bacteria 2021
24 Ga0068852_101207663 3300005616 Bacteria 777
25 Ga0068852_102012439 3300005616 Bacteria 600
26 Ga0068851_10166511 3300005834 Bacteria 1214
27 Ga0081455_10544793 3300005937 Bacteria 769
28 Ga0081538_10104964 3300005981 Bacteria 1408
29 Ga0081540_1004321 3300005983 Bacteria 10890
30 Ga0075365_10005213 3300006038 Bacteria 6990
31 Ga0075365_10042492 3300006038 Bacteria 2972
32 Ga0075368_10257161 3300006042 Bacteria 747
33 Ga0075368_10570391 3300006042 Bacteria 510
34 Ga0075363_100010411 3300006048 Bacteria 4417
35 Ga0075363_100230092 3300006048 Bacteria 1064
36 Ga0075362_10031739 3300006177 Bacteria 2288
37 Ga0075367_10024130 3300006178 Bacteria 3429
38 Ga0075367_10527129 3300006178 Bacteria 750
39 Ga0075367_10762127 3300006178 Bacteria 616
40 Ga0075369_10056777 3300006186 Bacteria 1702
41 Ga0075369_10405885 3300006186 Bacteria 642
42 Ga0075366_10056543 3300006195 Bacteria 2330
43 Ga0075370_10009733 3300006353 Bacteria 5004
44 Ga0075370_10447624 3300006353 Bacteria 777
45 Ga0075430_100000037 3300006846 Bacteria 68528
46 Ga0099795_10202120 3300007788 Bacteria 838
47 Ga0099795_10489338 3300007788 Bacteria 572
48 Ga0105240_10218911 3300009093 Bacteria 2219
49 Ga0105240_10575565 3300009093 Bacteria 1243
50 Ga0105240_11466509 3300009093 Bacteria 716
51 Ga0105247_10618799 3300009101 Bacteria 805
52 Ga0114129_10052326 3300009147 Bacteria 5731
53 Ga0105241_10125598 3300009174 Bacteria 2071
54 Ga0105248_12497688 3300009177 Bacteria 589
55 Ga0105237_10356716 3300009545 Bacteria 1466
56 Ga0105237_12212671 3300009545 Bacteria 559
57 Ga0105238_12156113 3300009551 Bacteria 592
58 Ga0105238_12357690 3300009551 Bacteria 567
59 Ga0099796_10200188 3300010159 Bacteria 810
60 Ga0105239_12040391 3300010375 Bacteria 666
61 Ga0157347_1069066 3300012502 Bacteria 519
62 Ga0157370_10043752 3300013104 Bacteria 4308
63 Ga0157369_10302055 3300013105 Bacteria 1665
64 Ga0157375_12199234 3300013308 Bacteria 657
65 Ga0157376_13049611 3300014969 Bacteria 507
66 Ga0182005_1068805 3300015265 Bacteria 971
67 Ga0214543_1000022 3300021327 Bacteria 241930
68 Ga0224572_1009351 3300024225 Bacteria 1827
69 Ga0209677_127552 3300025253 Bacteria 598
70 Ga0209148_1000037 3300025254 Bacteria 494767
71 Ga0209233_1025545 3300025261 Bacteria 1459
72 Ga0209455_1000036 3300025272 Bacteria 473309
73 Ga0209025_1000903 3300025294 Bacteria 46017
74 Ga0209256_1001224 3300025299 Bacteria 28617
75 Ga0207680_10801326 3300025903 Bacteria 675
76 Ga0207647_10080604 3300025904 Bacteria 1952
77 Ga0207654_10234772 3300025911 Bacteria 1223
78 Ga0207695_10809677 3300025913 Bacteria 817
79 Ga0207695_10960086 3300025913 Bacteria 734
80 Ga0207657_10088767 3300025919 Bacteria 2583
81 Ga0207694_10234470 3300025924 Bacteria 1499
82 Ga0207694_10971079 3300025924 Bacteria 719
83 Ga0207700_11180882 3300025928 Bacteria 683
84 Ga0207711_11195809 3300025941 Bacteria 702
85 Ga0207667_10468184 3300025949 Bacteria 1280
86 Ga0207677_11124208 3300026023 Bacteria 717
87 Ga0207648_10920684 3300026089 Bacteria 817
88 Ga0207683_10055636 3300026121 Bacteria 3469
89 Ga0207698_10190119 3300026142 Bacteria 1828
90 Ga0207698_10759694 3300026142 Bacteria 969
91 Ga0268266_10106918 3300028379 Bacteria 2474
92 Ga0268264_11429684 3300028381 Bacteria 702
93 Ga0265760_10024858 3300031090 Bacteria 1747
94 Ga0265325_10341089 3300031241 Bacteria 663
95 Ga0265316_11182399 3300031344 Bacteria 529
96 Ga0307513_10670913 3300031456 Bacteria 743
97 Ga0307416_100162964 3300032002 Bacteria 2064
98 Ga0307416_102373728 3300032002 Bacteria 630
99 Ga0307414_10315059 3300032004 Bacteria 1329
100 Ga0373927_0287455 3300035695 Bacteria 1082
101 Ga0373947_1087669 3300035725 Bacteria 545
102 Ga0451787_811282 3300041441 Bacteria 565
103 Ga0451845_0675397 3300041501 Bacteria 712
104 Ga0451849_1433195 3300041505 Bacteria 758
105 Ga0451851_0404538 3300041507 Bacteria 758
106 Ga0495668_0013068 3300046616 Bacteria 4913
107 Ga0495625_0030200 3300046660 Bacteria 4046
108 Ga0495660_0198852 3300046810 Bacteria 958
109 Ga0496101_0761822 3300048904 Bacteria 764
110 Ga0496102_0549235 3300048905 Bacteria 1078
111 Ga0496109_0327979 3300048912 Bacteria 1445
112 Ga0496111_1128668 3300048914 Bacteria 558
113 Ga0496112_0044655 3300048915 Bacteria 4343
114 Ga0496113_1365922 3300048916 Bacteria 549
115 Ga0496114_0543584 3300048917 Bacteria 1027
116 Ga0496119_0030961 3300048922 Bacteria 3597
117 Ga0496125_0169501 3300048928 Bacteria 1470
118 Ga0501031_0170807 3300049568 Bacteria 1421
119 Ga0501032_0002091 3300049569 Bacteria 15738
120 Ga0501033_0000569 3300049570 Bacteria 34403
121 Ga0501036_0851915 3300049572 Bacteria 749
122 Ga0501037_0000147 3300049573 Bacteria 65415
123 Ga0501038_1042080 3300049574 Bacteria 599
124 Ga0501043_0000041 3300049579 Bacteria 116876
125 Ga0501046_0462350 3300049580 Bacteria 912
126 Ga0501047_0165666 3300049581 Bacteria 2081
127 Ga0501068_0017015 3300049584 Bacteria 4201
128 Ga0501069_0000018 3300049585 Bacteria 133550
129 Ga0501070_0000222 3300049586 Bacteria 54032
130 Ga0501071_0009818 3300049587 Bacteria 6390
131 Ga0501074_0000001 3300049590 Bacteria 123588
132 Ga0501080_0000753 3300049742 Bacteria 26231
133 Ga0501083_0000079 3300049744 Bacteria 64984
134 Ga0501035_0000061 3300049822 Bacteria 131658
135 Ga0501044_0000003 3300049823 Bacteria 345647
136 Ga0501044_0323194 3300049823 Bacteria 1467
137 nmdc:mga03n38_103927_c1 3300050490 Bacteria 1374
138 nmdc:mga03n38_118768_c1 3300050490 Bacteria 1297
139 nmdc:mga00v17_61418_c1 3300050491 Bacteria 2310
140 nmdc:mga00v17_83222_c1 3300050491 Bacteria 2001
141 nmdc:mga0yw44_348196_c1 3300050492 Bacteria 997
142 nmdc:mga0yw44_3835_c1 3300050492 Bacteria 6755
143 nmdc:mga0yw44_728835_c1 3300050492 Bacteria 673
144 nmdc:mga0k408_866304_c1 3300050493 Bacteria 525
145 nmdc:mga0k408_89499_c1 3300050493 Bacteria 1808
146 nmdc:mga06z11_722370_c1 3300050494 Bacteria 607
147 nmdc:mga07m45_14798_c1 3300050496 Bacteria 4165
148 nmdc:mga05p37_124971_c1 3300050507 Bacteria 3159
149 nmdc:mga0qj67_316684_c1 3300050509 Bacteria 1263
150 Ga0500651_0540163 3300053093 Bacteria 639
151 Ga0500617_265934 3300053124 Bacteria 567
152 Ga0500642_0225230 3300053130 Bacteria 868
153 Ga0500616_0003319 3300053153 Bacteria 12406
154 Ga0500616_0193111 3300053153 Bacteria 907
155 Ga0500620_131227 3300053155 Bacteria 877
156 Ga0500645_030452 3300053730 Bacteria 1623
157 Ga0501082_0086454 3300060353 Bacteria 2705
158 2503201120 2503198000 Bacteria 6884444
159 2509118769 2508501123 Bacteria 6283661
160 2509376701 2509276019 Bacteria 6802256
161 2509395883 2509276022 Bacteria 6200534
162 2512528814 2512047086 Bacteria 6850303
163 2513926146 2513237146 Bacteria 7166346
164 2515612044 2515154107 Bacteria 6795637
165 2558863936 2558860100 Bacteria 8458965
166 2588517865 2588253730 Bacteria 6881675
167 2599417622 2599185170 Bacteria 7295545
168 2643779084 2643221552 Bacteria 5708754
169 2643927651 2643221584 Bacteria 5511711
170 2644085164 2643221614 Bacteria 4260023
171 2644288901 2643221651 Bacteria 4798932
172 2644342716 2643221661 Bacteria 4267604
173 2644366016 2643221666 Bacteria 4265935
174 2756675973 2756170246 Bacteria 7451806
175 2770194823 2767802442 Bacteria 5747986
176 2792749532 2791355123 Bacteria 8049106
177 2819719800 2818991467 Bacteria 5893227
178 2838038165 2838035591 Bacteria 7166484
179 2838079765 2838074704 Bacteria 6785777
180 2838667150 2838661181 Bacteria 7385261
181 2844007135 2844002411 Bacteria 7168230
182 2844014030 2844009547 Bacteria 6728125
183 2850081702 2850079185 Bacteria 6848280
184 2856326912 2856320880 Bacteria 7263508
185 2856352212 2856349417 Bacteria 6230045
186 2856362230 2856356410 Bacteria 6297484
187 2869175453 2869169390 Bacteria 6659796
188 2869237992 2869234852 Bacteria 6654993
189 2869283539 2869278585 Bacteria 7077053
190 2871439926 2871435913 Bacteria 6880295
191 2871452234 2871451962 Bacteria 7336357
192 2871468376 2871466892 Bacteria 6923287
193 2871488954 2871488783 Bacteria 6929816
194 2874116183 2874109183 Bacteria 6517025
195 2874120300 2874116593 Bacteria 6674494
196 2874126306 2874123672 Bacteria 7238285
197 2874143772 2874139085 Bacteria 7021506
198 2874174515 2874168670 Bacteria 8062617
199 2876392445 2876386047 Bacteria 6698674
200 2876397836 2876392853 Bacteria 6660880
201 2878738291 2878730984 Bacteria 6380721
202 2878739034 2878738818 Bacteria 7136951
203 2878753716 2878753008 Bacteria 6922523
204 2878760650 2878760144 Bacteria 6823465
205 2878767725 2878767105 Bacteria 6898628
206 2881149717 2881147464 Bacteria 7779814
207 2881156538 2881155292 Bacteria 6461656
208 2881166597 2881161766 Bacteria 7127907
209 2881846529 2881845957 Bacteria 6611900
210 2881853339 2881853255 Bacteria 6698367
211 2881867176 2881861095 Bacteria 7128710
212 2882636554 2882632389 Bacteria 8154593
213 2882919636 2882912400 Bacteria 6801539
214 2885313921 2885312484 Bacteria 6415165
215 2885324174 2885318864 Bacteria 6729568
216 2885345569 2885342637 Bacteria 7011821
217 2885357430 2885350715 Bacteria 6787678
218 2888338980 2888337043 Bacteria 6629336
219 2903495613 2903492973 Bacteria 13473544
220 2903515141 2903513507 Bacteria 6344008
221 2903541216 2903540706 Bacteria 7062119
222 2904664487 2904659560 Bacteria 6685615
223 2906385395 2906378014 Bacteria 6911440
224 2906401810 2906401398 Bacteria 6693206
225 2924718025 2924710171 Bacteria 6752351
226 2924741945 2924741084 Bacteria 6661321
227 2924764349 2924762789 Bacteria 6561353
228 2924776396 2924776078 Bacteria 7492003
229 2924789932 2924784321 Bacteria 7416538
230 2937001523 2936996657 Bacteria 6298727
231 2937828466 2937822353 Bacteria 7290551
232 2937854121 2937848649 Bacteria 6983481
233 2937867275 2937861824 Bacteria 6660327
234 2937979747 2937972304 Bacteria 7532020
235 2937995072 2937994558 Bacteria 7036190
236 2957445244 2957443900 Bacteria 6869977
237 2958040051 2958034702 Bacteria 6989922
238 2958054395 2958041894 Bacteria 13082850
239 2958110827 2958108152 Bacteria 6681128
240 2958147670 2958144490 Bacteria 6677056
241 2958165663 2958165035 Bacteria 6906348
242 2960621863 2960617483 Bacteria 6727748
243 2960661965 2960660292 Bacteria 7041660
244 2961119486 2961114664 Bacteria 6680456
245 2961164122 2961163497 Bacteria 6901077
246 2961170904 2961170736 Bacteria 7072258
247 2961184604 2961183825 Bacteria 6688536
248 2965018812 2965018300 Bacteria 6883036
249 2968003483 2967996073 Bacteria 6787468
250 2968004250 2968003550 Bacteria 6929263
251 2968018894 2968016561 Bacteria 7022047
252 2968091212 2968091066 Bacteria 6052692
253 2968115741 2968110612 Bacteria 6814636
254 2968172525 2968171901 Bacteria 6894245
255 2970470933 2970469710 Bacteria 6969209
256 2970503494 2970503327 Bacteria 7099517
257 2970517704 2970510686 Bacteria 7006402
258 2970533010 2970532167 Bacteria 6553173
259 2970555503 2970554993 Bacteria 6814252
260 2970598036 2970593180 Bacteria 7073582
261 2970633613 2970627176 Bacteria 6680862
262 2977526656 2977523885 Bacteria 6960446
263 2977822931 2977821940 Bacteria 6906439
264 2977832607 2977828996 Bacteria 7007971
265 2977857096 2977851361 Bacteria 6694324
266 2977903302 2977898635 Bacteria 6675551
267 2977912946 2977907340 Bacteria 6577984
268 2977927465 2977922695 Bacteria 6956781
269 2979770988 2979764755 Bacteria 6610066
270 2979773764 2979772303 Bacteria 6618277
271 2979815723 2979808191 Bacteria 7179355
272 2987660130 2987659509 Bacteria 6966464
273 2987672805 2987666974 Bacteria 6509233
274 2996356531 2996348954 Bacteria 7239054
275 2996389929 2996386984 Bacteria 6978667
276 3004169211 3004167301 Bacteria 8330599
277 3004189178 3004188549 Bacteria 6952365
278 3004237589 3004232784 Bacteria 6662140
279 3004253345 3004248173 Bacteria 6563236
280 3004282834 3004275668 Bacteria 7114440
281 3004294246 3004289098 Bacteria 6135450
282 8004318483 8004312739 Bacteria 7444653
283 8004375287 8004374579 Bacteria 6898112
284 8004731927 8004727605 Bacteria 6643904
285 nmdc:mga06r32_515822_c1
286 JGI24740J21852_10120985
287 JGI25151J46595_10047140
288 Ga0055542_1000845
289 Ga0055529_1017818
290 Ga0055524_1008537
291 Ga0065165_1003955
292 Ga0070658_11017137
293 Ga0070666_10526987
294 Ga0070660_100220471
295 Ga0070661_100167319
296 Ga0070674_101002888
297 Ga0070673_101355029
298 Ga0070659_100779373
299 Ga0070713_101061634
300 Ga0070663_100069211
301 Ga0068867_100912665
302 Ga0068853_100290340
303 Ga0068855_100830033
304 Ga0070664_100146364
305 Ga0068854_100912153
306 Ga0068856_100345350
307 Ga0068852_100173888
308 Ga0068852_101207663
309 Ga0068852_102012439
310 Ga0068851_10166511
311 Ga0081455_10544793
312 Ga0081538_10104964
313 Ga0081540_1004321
314 Ga0075365_10005213
315 Ga0075365_10042492
316 Ga0075368_10257161
317 Ga0075368_10570391
318 Ga0075363_100010411
319 Ga0075363_100230092
320 Ga0075362_10031739
321 Ga0075367_10024130
322 Ga0075367_10527129
323 Ga0075367_10762127
324 Ga0075369_10056777
325 Ga0075369_10405885
326 Ga0075366_10056543
327 Ga0075370_10009733
328 Ga0075370_10447624
329 Ga0075430_100000037
330 Ga0099795_10202120
331 Ga0099795_10489338
332 Ga0105240_10218911
333 Ga0105240_10575565
334 Ga0105240_11466509
335 Ga0105247_10618799
336 Ga0114129_10052326
337 Ga0105241_10125598
338 Ga0105248_12497688
339 Ga0105237_10356716
340 Ga0105237_12212671
341 Ga0105238_12156113
342 Ga0105238_12357690
343 Ga0099796_10200188
344 Ga0105239_12040391
345 Ga0157347_1069066
346 Ga0157370_10043752
347 Ga0157369_10302055
348 Ga0157375_12199234
349 Ga0157376_13049611
350 Ga0182005_1068805
351 Ga0214543_1000022
352 Ga0224572_1009351
353 Ga0209677_127552
354 Ga0209148_1000037
355 Ga0209233_1025545
356 Ga0209455_1000036
357 Ga0209025_1000903
358 Ga0209256_1001224
359 Ga0207680_10801326
360 Ga0207647_10080604
361 Ga0207654_10234772
362 Ga0207695_10809677
363 Ga0207695_10960086
364 Ga0207657_10088767
365 Ga0207694_10234470
366 Ga0207694_10971079
367 Ga0207700_11180882
368 Ga0207711_11195809
369 Ga0207667_10468184
370 Ga0207677_11124208
371 Ga0207648_10920684
372 Ga0207683_10055636
373 Ga0207698_10190119
374 Ga0207698_10759694
375 Ga0268266_10106918
376 Ga0268264_11429684
377 Ga0265760_10024858
378 Ga0265325_10341089
379 Ga0265316_11182399
380 Ga0307513_10670913
381 Ga0307416_100162964
382 Ga0307416_102373728
383 Ga0307414_10315059
384 Ga0373927_0287455
385 Ga0373947_1087669
386 Ga0451787_811282
387 Ga0451845_0675397
388 Ga0451849_1433195
389 Ga0451851_0404538
390 Ga0495668_0013068
391 Ga0495625_0030200
392 Ga0495660_0198852
393 Ga0496101_0761822
394 Ga0496102_0549235
395 Ga0496109_0327979
396 Ga0496111_1128668
397 Ga0496112_0044655
398 Ga0496113_1365922
399 Ga0496114_0543584
400 Ga0496119_0030961
401 Ga0496125_0169501
402 Ga0501031_0170807
403 Ga0501032_0002091
404 Ga0501033_0000569
405 Ga0501036_0851915
406 Ga0501037_0000147
407 Ga0501038_1042080
408 Ga0501043_0000041
409 Ga0501046_0462350
410 Ga0501047_0165666
411 Ga0501068_0017015
412 Ga0501069_0000018
413 Ga0501070_0000222
414 Ga0501071_0009818
415 Ga0501074_0000001
416 Ga0501080_0000753
417 Ga0501083_0000079
418 Ga0501035_0000061
419 Ga0501044_0000003
420 Ga0501044_0323194
421 nmdc:mga03n38_103927_c1
422 nmdc:mga03n38_118768_c1
423 nmdc:mga00v17_61418_c1
424 nmdc:mga00v17_83222_c1
425 nmdc:mga0yw44_348196_c1
426 nmdc:mga0yw44_3835_c1
427 nmdc:mga0yw44_728835_c1
428 nmdc:mga0k408_866304_c1
429 nmdc:mga0k408_89499_c1
430 nmdc:mga06z11_722370_c1
431 nmdc:mga07m45_14798_c1
432 nmdc:mga05p37_124971_c1
433 nmdc:mga0qj67_316684_c1
434 Ga0500651_0540163
435 Ga0500617_265934
436 Ga0500642_0225230
437 Ga0500616_0003319
438 Ga0500616_0193111
439 Ga0500620_131227
440 Ga0500645_030452
441 Ga0501082_0086454
442 2503201120
443 2509118769
444 2509376701
445 2509395883
446 2512528814
447 2513926146
448 2515612044
449 2558863936
450 2588517865
451 2599417622
452 2643779084
453 2643927651
454 2644085164
455 2644288901
456 2644342716
457 2644366016
458 2756675973
459 2770194823
460 2792749532
461 2819719800
462 2838038165
463 2838079765
464 2838667150
465 2844007135
466 2844014030
467 2850081702
468 2856326912
469 2856352212
470 2856362230
471 2869175453
472 2869237992
473 2869283539
474 2871439926
475 2871452234
476 2871468376
477 2871488954
478 2874116183
479 2874120300
480 2874126306
481 2874143772
482 2874174515
483 2876392445
484 2876397836
485 2878738291
486 2878739034
487 2878753716
488 2878760650
489 2878767725
490 2881149717
491 2881156538
492 2881166597
493 2881846529
494 2881853339
495 2881867176
496 2882636554
497 2882919636
498 2885313921
499 2885324174
500 2885345569
501 2885357430
502 2888338980
503 2903495613
504 2903515141
505 2903541216
506 2904664487
507 2906385395
508 2906401810
509 2924718025
510 2924741945
511 2924764349
512 2924776396
513 2924789932
514 2937001523
515 2937828466
516 2937854121
517 2937867275
518 2937979747
519 2937995072
520 2957445244
521 2958040051
522 2958054395
523 2958110827
524 2958147670
525 2958165663
526 2960621863
527 2960661965
528 2961119486
529 2961164122
530 2961170904
531 2961184604
532 2965018812
533 2968003483
534 2968004250
535 2968018894
536 2968091212
537 2968115741
538 2968172525
539 2970470933
540 2970503494
541 2970517704
542 2970533010
543 2970555503
544 2970598036
545 2970633613
546 2977526656
547 2977822931
548 2977832607
549 2977857096
550 2977903302
551 2977912946
552 2977927465
553 2979770988
554 2979773764
555 2979815723
556 2987660130
557 2987672805
558 2996356531
559 2996389929
560 3004169211
561 3004189178
562 3004237589
563 3004253345
564 3004282834
565 3004294246
566 8004318483
567 8004375287
568 8004731927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map