F386643

General Info

Members Datasets Scaffolds Average Seq Length
285 149 570 382

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100002309|Ga0070711_1000023094
Length 399
Sequence MLYYLSQKLLEWTNGTPWADHLSALRLFRYITVRSAGAAVTALLLSWWLGPKIIHWLKQLKFGQDYADKAEEAGGLAARVLSKKGTPTMGGVLIVMVLVFSTMLWTEWNAQVELTALAVLVLAGLGFYDDYAKIIQQSGGGTPPRLKLIVQIAAALFVGIYLWQLPATSELRLSENKNVITSYLVSDLMLPFYKYPIHMGAIAGIPVAGLVVVLLAIVGSSNAVNLTDGLDGLAIGCALITAFVFLVFTYVAGNVKAAAYLQIPYVSGAGELTVFCAALIGAGLGFLWFNCHPAQVFMGDTGSLALGGAFGIMAVLIHQPFVLVIAGGVFVLEAVSVMLQTGWFKFTRMRTGTGRRIFLMAPLHHHFEKKGWYESQVVMRFYILCVLFAVVALATLKLR

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
81 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
82 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
83 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
84 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
85 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
100 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.65
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100002309 3300005439 Bacteria 10823
2 rootH2_10035288 3300003320 Bacteria 5501
3 Ga0070683_100283051 3300005329 Unclassified 1577
4 Ga0070690_100010019 3300005330 Bacteria 5502
5 Ga0070690_100013712 3300005330 Bacteria 4799
6 Ga0070690_100051168 3300005330 Bacteria 2636
7 Ga0068868_100062267 3300005338 Bacteria 2957
8 Ga0070689_100050058 3300005340 Bacteria 3227
9 Ga0070689_100114883 3300005340 Bacteria 2145
10 Ga0070689_100221501 3300005340 Bacteria 1552
11 Ga0070691_10013697 3300005341 Bacteria 3718
12 Ga0070687_100051876 3300005343 Bacteria 2126
13 Ga0070675_100000804 3300005354 Bacteria 22072
14 Ga0070675_100101707 3300005354 Bacteria 2421
15 Ga0070675_100191505 3300005354 Bacteria 1772
16 Ga0070673_100068122 3300005364 Bacteria 2849
17 Ga0070688_100042696 3300005365 Bacteria 2790
18 Ga0070667_100061131 3300005367 Bacteria 3189
19 Ga0070701_10006647 3300005438 Bacteria 4880
20 Ga0070711_100184271 3300005439 Bacteria 1600
21 Ga0070705_100026546 3300005440 Bacteria 3153
22 Ga0070694_100017293 3300005444 Bacteria 4554
23 Ga0070685_10014966 3300005466 Bacteria 4117
24 Ga0070672_100103891 3300005543 Bacteria 2308
25 Ga0070686_100013974 3300005544 Bacteria 4613
26 Ga0070686_100024588 3300005544 Bacteria 3612
27 Ga0070686_100155058 3300005544 Unclassified 1607
28 Ga0070686_100163504 3300005544 Bacteria 1569
29 Ga0070695_100183540 3300005545 Bacteria 1484
30 Ga0070665_100258107 3300005548 Bacteria 1744
31 Ga0070704_100026079 3300005549 Bacteria 3856
32 Ga0070704_100117070 3300005549 Bacteria 2039
33 Ga0068855_100021430 3300005563 Bacteria 7749
34 Ga0068855_100060216 3300005563 Bacteria 4441
35 Ga0068855_100142009 3300005563 Bacteria 2736
36 Ga0070664_100004318 3300005564 Bacteria 11426
37 Ga0068857_100002523 3300005577 Bacteria 14985
38 Ga0068857_100043616 3300005577 Bacteria 3978
39 Ga0068856_100000079 3300005614 Bacteria 92486
40 Ga0068859_100000581 3300005617 Bacteria 36448
41 Ga0068859_100020422 3300005617 Bacteria 6648
42 Ga0068859_100022598 3300005617 Bacteria 6306
43 Ga0068859_100022748 3300005617 Bacteria 6285
44 Ga0068859_100080687 3300005617 Bacteria 3294
45 Ga0068864_100155689 3300005618 Bacteria 2074
46 Ga0068864_100249343 3300005618 Bacteria 1648
47 Ga0068863_100002577 3300005841 Bacteria 17972
48 Ga0068863_100047618 3300005841 Bacteria 4066
49 Ga0068863_100189857 3300005841 Bacteria 1974
50 Ga0068858_100019960 3300005842 Bacteria 6267
51 Ga0068858_100249668 3300005842 Bacteria 1685
52 Ga0068858_100357201 3300005842 Bacteria 1400
53 Ga0068860_100001970 3300005843 Bacteria 21702
54 Ga0068862_100218106 3300005844 Bacteria 1726
55 Ga0081455_10199528 3300005937 Bacteria 1499
56 Ga0097621_100011178 3300006237 Bacteria 6607
57 Ga0097621_100053230 3300006237 Bacteria 3299
58 Ga0068871_100004387 3300006358 Bacteria 9807
59 Ga0068871_100169937 3300006358 Bacteria 1868
60 Ga0075428_100020061 3300006844 Bacteria 7402
61 Ga0075428_100032920 3300006844 Bacteria 5724
62 Ga0075428_100548189 3300006844 Bacteria 1236
63 Ga0075430_100056764 3300006846 Bacteria 3293
64 Ga0075431_100008485 3300006847 Bacteria 10289
65 Ga0075431_100314557 3300006847 Bacteria 1580
66 Ga0075433_10014318 3300006852 Bacteria 6479
67 Ga0075434_100023706 3300006871 Bacteria 5986
68 Ga0097620_100000581 3300006931 Bacteria 36448
69 Ga0097620_100020422 3300006931 Bacteria 6648
70 Ga0097620_100022598 3300006931 Bacteria 6306
71 Ga0097620_100022748 3300006931 Bacteria 6285
72 Ga0097620_100080691 3300006931 Bacteria 3294
73 Ga0105240_10002780 3300009093 Bacteria 27659
74 Ga0105240_10062830 3300009093 Bacteria 4622
75 Ga0105240_10120624 3300009093 Bacteria 3158
76 Ga0105240_10177679 3300009093 Bacteria 2515
77 Ga0111539_10011188 3300009094 Bacteria 11277
78 Ga0111539_10023482 3300009094 Bacteria 7576
79 Ga0105245_10157920 3300009098 Bacteria 2149
80 Ga0114129_10000254 3300009147 Bacteria 60253
81 Ga0105242_10040908 3300009176 Bacteria 3736
82 Ga0105248_10000381 3300009177 Bacteria 51763
83 Ga0105238_10095745 3300009551 Bacteria 2955
84 Ga0157370_10110034 3300013104 Bacteria 2575
85 Ga0157374_10017540 3300013296 Bacteria 6306
86 Ga0157374_10057460 3300013296 Bacteria 3634
87 Ga0163162_10012410 3300013306 Bacteria 8321
88 Ga0157372_10215118 3300013307 Bacteria 2227
89 Ga0157375_10000017 3300013308 Bacteria 286152
90 Ga0157375_10000440 3300013308 Bacteria 37608
91 Ga0163163_10000194 3300014325 Bacteria 62568
92 Ga0163163_10015916 3300014325 Bacteria 6966
93 Ga0163163_10044401 3300014325 Bacteria 4360
94 Ga0157377_10085674 3300014745 Bacteria 1850
95 Ga0157379_10000263 3300014968 Bacteria 41237
96 Ga0157376_10044774 3300014969 Bacteria 3639
97 Ga0163161_10068482 3300017792 Bacteria 2593
98 Ga0207695_10022689 3300025913 Bacteria 7114
99 Ga0207695_10045676 3300025913 Bacteria 4648
100 Ga0207663_10001297 3300025916 Bacteria 11584
101 Ga0207663_10154914 3300025916 Bacteria 1611
102 Ga0207694_10100018 3300025924 Bacteria 2297
103 Ga0207659_10000432 3300025926 Bacteria 25126
104 Ga0207659_10004454 3300025926 Bacteria 8479
105 Ga0207659_10009724 3300025926 Bacteria 6014
106 Ga0207687_10136053 3300025927 Bacteria 1858
107 Ga0207670_10005501 3300025936 Bacteria 6963
108 Ga0207670_10068706 3300025936 Bacteria 2442
109 Ga0207691_10061338 3300025940 Bacteria 3416
110 Ga0207691_10263897 3300025940 Bacteria 1484
111 Ga0207711_10004330 3300025941 Bacteria 12121
112 Ga0207661_10200818 3300025944 Bacteria 1753
113 Ga0207679_10026979 3300025945 Bacteria 3967
114 Ga0207667_10075438 3300025949 Bacteria 3501
115 Ga0207667_10178588 3300025949 Bacteria 2181
116 Ga0207651_10019038 3300025960 Bacteria 4104
117 Ga0207658_10045574 3300025986 Bacteria 3197
118 Ga0207677_10139504 3300026023 Bacteria 1854
119 Ga0207702_10000669 3300026078 Bacteria 37291
120 Ga0207702_10002497 3300026078 Bacteria 17366
121 Ga0207641_10001650 3300026088 Bacteria 21778
122 Ga0207641_10019516 3300026088 Bacteria 5565
123 Ga0207676_10155816 3300026095 Bacteria 1973
124 Ga0207674_10015568 3300026116 Bacteria 8352
125 Ga0207675_100077546 3300026118 Bacteria 3113
126 Ga0268266_10309046 3300028379 Bacteria 1477
127 Ga0268265_10168952 3300028380 Bacteria 1867
128 Ga0268264_10069822 3300028381 Bacteria 2972
129 Ga0265337_1000077 3300028556 Bacteria 46215
130 Ga0265337_1025990 3300028556 Bacteria 1778
131 Ga0265326_10010588 3300028558 Bacteria 2734
132 Ga0265319_1000004 3300028563 Bacteria 305085
133 Ga0265319_1013723 3300028563 Bacteria 3206
134 Ga0265323_10000058 3300028653 Bacteria 61416
135 Ga0265323_10045041 3300028653 Bacteria 1587
136 Ga0265322_10022428 3300028654 Bacteria 1806
137 Ga0265336_10001988 3300028666 Bacteria 8733
138 Ga0265338_10000038 3300028800 Bacteria 237195
139 Ga0265338_10000214 3300028800 Bacteria 106870
140 Ga0265338_10000276 3300028800 Bacteria 93585
141 Ga0265338_10000439 3300028800 Bacteria 74770
142 Ga0265338_10000533 3300028800 Bacteria 66710
143 Ga0265338_10000630 3300028800 Bacteria 61283
144 Ga0265338_10000843 3300028800 Bacteria 51673
145 Ga0265338_10001209 3300028800 Bacteria 42710
146 Ga0265338_10003168 3300028800 Bacteria 23481
147 Ga0265338_10004206 3300028800 Bacteria 19630
148 Ga0265338_10004557 3300028800 Bacteria 18651
149 Ga0265338_10005205 3300028800 Bacteria 17062
150 Ga0265338_10005988 3300028800 Bacteria 15643
151 Ga0265338_10007101 3300028800 Bacteria 14031
152 Ga0265338_10010977 3300028800 Bacteria 10526
153 Ga0265338_10042086 3300028800 Bacteria 4261
154 Ga0265338_10049724 3300028800 Bacteria 3797
155 Ga0265338_10069685 3300028800 Bacteria 3019
156 Ga0265338_10157554 3300028800 Bacteria 1757
157 Ga0265338_10163531 3300028800 Bacteria 1716
158 Ga0265338_10263419 3300028800 Bacteria 1266
159 Ga0265324_10000237 3300029957 Bacteria 41672
160 Ga0265324_10000865 3300029957 Bacteria 19451
161 Ga0265324_10018035 3300029957 Bacteria 2560
162 Ga0265324_10019675 3300029957 Bacteria 2430
163 Ga0265324_10027960 3300029957 Bacteria 1990
164 Ga0265328_10011966 3300031239 Bacteria 3460
165 Ga0265320_10000242 3300031240 Bacteria 45162
166 Ga0265320_10000364 3300031240 Bacteria 36776
167 Ga0265320_10025300 3300031240 Bacteria 3123
168 Ga0265320_10058233 3300031240 Bacteria 1850
169 Ga0265325_10007970 3300031241 Bacteria 6287
170 Ga0265325_10013206 3300031241 Bacteria 4706
171 Ga0265325_10057682 3300031241 Bacteria 1980
172 Ga0265329_10000325 3300031242 Bacteria 25315
173 Ga0265340_10000246 3300031247 Bacteria 28156
174 Ga0265340_10044978 3300031247 Bacteria 2158
175 Ga0265339_10013546 3300031249 Bacteria 4938
176 Ga0265339_10019883 3300031249 Bacteria 3931
177 Ga0265339_10029683 3300031249 Bacteria 3101
178 Ga0265339_10067163 3300031249 Bacteria 1918
179 Ga0265327_10001439 3300031251 Bacteria 30023
180 Ga0265316_10001480 3300031344 Bacteria 25164
181 Ga0265316_10005378 3300031344 Bacteria 12458
182 Ga0265316_10007636 3300031344 Bacteria 10157
183 Ga0265316_10021474 3300031344 Bacteria 5466
184 Ga0265316_10047472 3300031344 Bacteria 3397
185 Ga0265316_10069028 3300031344 Bacteria 2728
186 Ga0265316_10127303 3300031344 Bacteria 1920
187 Ga0265313_10004915 3300031595 Bacteria 10017
188 Ga0265313_10013895 3300031595 Bacteria 4795
189 Ga0265314_10000214 3300031711 Bacteria 85787
190 Ga0265314_10061098 3300031711 Bacteria 2568
191 Ga0265314_10123626 3300031711 Bacteria 1625
192 Ga0316576_10174895 3300031727 Bacteria 1620
193 Ga0373950_0001488 3300034818 Bacteria 3063
194 Ga0373951_0008722 3300035091 Bacteria 2285
195 Ga0373932_0000001 3300035112 Bacteria 1459067
196 Ga0373945_0005248 3300035116 Bacteria 4143
197 Ga0373954_0001248 3300035118 Bacteria 10248
198 Ga0373956_0020622 3300035119 Bacteria 2807
199 Ga0373946_0023148 3300035171 Bacteria 2425
200 Ga0373946_0043383 3300035171 Bacteria 1853
201 Ga0373931_0000004 3300035691 Bacteria 535140
202 Ga0373927_0057753 3300035695 Bacteria 2509
203 Ga0373947_0061870 3300035725 Bacteria 2276
204 Ga0373937_0001257 3300036401 Bacteria 21283
205 Ga0373937_0239249 3300036401 Bacteria 1710
206 Ga0373925_0001025 3300037068 Bacteria 25280
207 Ga0373925_0009077 3300037068 Bacteria 7239
208 Ga0373925_0019312 3300037068 Bacteria 4956
209 Ga0395900_0441768 3300037418 Bacteria 1258
210 Ga0395905_0011375 3300037471 Bacteria 8603
211 Ga0451577_0001244 3300042876 Bacteria 35254
212 Ga0451577_0001420 3300042876 Bacteria 31947
213 Ga0451577_0004245 3300042876 Bacteria 15254
214 Ga0451577_0014324 3300042876 Bacteria 7393
215 Ga0451577_0045227 3300042876 Bacteria 3940
216 Ga0451577_0120612 3300042876 Bacteria 2349
217 Ga0453684_0005468 3300044712 Bacteria 25149
218 Ga0453684_0022726 3300044712 Bacteria 9289
219 Ga0453684_0079718 3300044712 Bacteria 4092
220 Ga0451576_0029710 3300045051 Bacteria 5847
221 Ga0451576_0030294 3300045051 Bacteria 5784
222 Ga0451576_0036675 3300045051 Bacteria 5196
223 Ga0451576_0058186 3300045051 Bacteria 4040
224 Ga0451576_0064758 3300045051 Bacteria 3807
225 Ga0451576_0068329 3300045051 Bacteria 3698
226 Ga0451576_0071283 3300045051 Bacteria 3616
227 Ga0451576_0082396 3300045051 Bacteria 3346
228 Ga0451576_0138683 3300045051 Bacteria 2537
229 Ga0451576_0161229 3300045051 Bacteria 2341
230 Ga0451576_0297475 3300045051 Bacteria 1688
231 Ga0495592_0000101 3300046454 Bacteria 75856
232 Ga0495592_0173215 3300046454 Bacteria 1476
233 Ga0495608_0052528 3300046511 Bacteria 2698
234 Ga0495618_0001806 3300046514 Bacteria 14162
235 Ga0495628_0001655 3300046516 Bacteria 20382
236 Ga0495630_0000073 3300046517 Bacteria 79321
237 Ga0495630_0036449 3300046517 Bacteria 3677
238 Ga0495630_0174762 3300046517 Bacteria 1637
239 Ga0495666_0001768 3300046526 Bacteria 10663
240 Ga0495640_0015495 3300046533 Bacteria 5734
241 Ga0495640_0029893 3300046533 Bacteria 3905
242 Ga0495586_0000040 3300046535 Bacteria 79335
243 Ga0495586_0000348 3300046535 Bacteria 29056
244 Ga0495586_0000548 3300046535 Bacteria 21893
245 Ga0495586_0004896 3300046535 Bacteria 7163
246 Ga0495586_0032801 3300046535 Bacteria 2785
247 Ga0495656_0076364 3300046615 Bacteria 1501
248 Ga0495634_0000889 3300046642 Bacteria 28667
249 Ga0495634_0008406 3300046642 Bacteria 7691
250 Ga0495634_0031994 3300046642 Bacteria 3620
251 Ga0495634_0166651 3300046642 Bacteria 1386
252 Ga0495599_0012567 3300046678 Bacteria 5222
253 Ga0495647_0031901 3300046681 Bacteria 1961
254 Ga0495658_0004210 3300046683 Bacteria 7083
255 Ga0495658_0028547 3300046683 Bacteria 3013
256 Ga0495613_0008133 3300046689 Bacteria 7802
257 Ga0495613_0076080 3300046689 Bacteria 2443
258 Ga0495581_0095952 3300047315 Bacteria 1722
259 Ga0495604_0106790 3300047317 Bacteria 2047
260 Ga0495674_0002615 3300047319 Bacteria 17520
261 Ga0495674_0006476 3300047319 Bacteria 11226
262 Ga0495674_0110435 3300047319 Bacteria 2332
263 Ga0495676_0006224 3300047321 Bacteria 10981
264 Ga0495676_0123381 3300047321 Bacteria 1881
265 Ga0495680_0042956 3300047322 Bacteria 3583
266 Ga0495684_0106204 3300047471 Bacteria 2121
267 Ga0501031_0000004 3300049568 Bacteria 202781
268 Ga0501031_0018937 3300049568 Bacteria 4482
269 Ga0501032_0005152 3300049569 Bacteria 9747
270 Ga0501032_0052606 3300049569 Bacteria 2744
271 Ga0501033_0011982 3300049570 Bacteria 6622
272 Ga0501034_0085672 3300049571 Bacteria 3152
273 Ga0501036_0117347 3300049572 Bacteria 2248
274 Ga0501257_010413 3300049686 Bacteria 2110
275 Ga0501080_0088193 3300049742 Bacteria 2882
276 Ga0501035_0040887 3300049822 Bacteria 4187
277 Ga0501035_0186142 3300049822 Bacteria 1787
278 Ga0501044_0001072 3300049823 Bacteria 32802
279 Ga0501044_0029088 3300049823 Bacteria 5827
280 nmdc:mga05p37_2475_c1 3300050507 Bacteria 21484
281 nmdc:mga06r32_312141_c1 3300050510 Bacteria 1558
282 nmdc:mga08y16_13579_c1 3300050511 Bacteria 8572
283 nmdc:mga08y16_98393_c1 3300050511 Bacteria 3046
284 nmdc:mga0n895_10968_c1 3300050512 Bacteria 8053
285 nmdc:mga0a205_41022_c1 3300050515 Bacteria 4457
286 Ga0070711_100002309
287 rootH2_10035288
288 Ga0070683_100283051
289 Ga0070690_100010019
290 Ga0070690_100013712
291 Ga0070690_100051168
292 Ga0068868_100062267
293 Ga0070689_100050058
294 Ga0070689_100114883
295 Ga0070689_100221501
296 Ga0070691_10013697
297 Ga0070687_100051876
298 Ga0070675_100000804
299 Ga0070675_100101707
300 Ga0070675_100191505
301 Ga0070673_100068122
302 Ga0070688_100042696
303 Ga0070667_100061131
304 Ga0070701_10006647
305 Ga0070711_100184271
306 Ga0070705_100026546
307 Ga0070694_100017293
308 Ga0070685_10014966
309 Ga0070672_100103891
310 Ga0070686_100013974
311 Ga0070686_100024588
312 Ga0070686_100155058
313 Ga0070686_100163504
314 Ga0070695_100183540
315 Ga0070665_100258107
316 Ga0070704_100026079
317 Ga0070704_100117070
318 Ga0068855_100021430
319 Ga0068855_100060216
320 Ga0068855_100142009
321 Ga0070664_100004318
322 Ga0068857_100002523
323 Ga0068857_100043616
324 Ga0068856_100000079
325 Ga0068859_100000581
326 Ga0068859_100020422
327 Ga0068859_100022598
328 Ga0068859_100022748
329 Ga0068859_100080687
330 Ga0068864_100155689
331 Ga0068864_100249343
332 Ga0068863_100002577
333 Ga0068863_100047618
334 Ga0068863_100189857
335 Ga0068858_100019960
336 Ga0068858_100249668
337 Ga0068858_100357201
338 Ga0068860_100001970
339 Ga0068862_100218106
340 Ga0081455_10199528
341 Ga0097621_100011178
342 Ga0097621_100053230
343 Ga0068871_100004387
344 Ga0068871_100169937
345 Ga0075428_100020061
346 Ga0075428_100032920
347 Ga0075428_100548189
348 Ga0075430_100056764
349 Ga0075431_100008485
350 Ga0075431_100314557
351 Ga0075433_10014318
352 Ga0075434_100023706
353 Ga0097620_100000581
354 Ga0097620_100020422
355 Ga0097620_100022598
356 Ga0097620_100022748
357 Ga0097620_100080691
358 Ga0105240_10002780
359 Ga0105240_10062830
360 Ga0105240_10120624
361 Ga0105240_10177679
362 Ga0111539_10011188
363 Ga0111539_10023482
364 Ga0105245_10157920
365 Ga0114129_10000254
366 Ga0105242_10040908
367 Ga0105248_10000381
368 Ga0105238_10095745
369 Ga0157370_10110034
370 Ga0157374_10017540
371 Ga0157374_10057460
372 Ga0163162_10012410
373 Ga0157372_10215118
374 Ga0157375_10000017
375 Ga0157375_10000440
376 Ga0163163_10000194
377 Ga0163163_10015916
378 Ga0163163_10044401
379 Ga0157377_10085674
380 Ga0157379_10000263
381 Ga0157376_10044774
382 Ga0163161_10068482
383 Ga0207695_10022689
384 Ga0207695_10045676
385 Ga0207663_10001297
386 Ga0207663_10154914
387 Ga0207694_10100018
388 Ga0207659_10000432
389 Ga0207659_10004454
390 Ga0207659_10009724
391 Ga0207687_10136053
392 Ga0207670_10005501
393 Ga0207670_10068706
394 Ga0207691_10061338
395 Ga0207691_10263897
396 Ga0207711_10004330
397 Ga0207661_10200818
398 Ga0207679_10026979
399 Ga0207667_10075438
400 Ga0207667_10178588
401 Ga0207651_10019038
402 Ga0207658_10045574
403 Ga0207677_10139504
404 Ga0207702_10000669
405 Ga0207702_10002497
406 Ga0207641_10001650
407 Ga0207641_10019516
408 Ga0207676_10155816
409 Ga0207674_10015568
410 Ga0207675_100077546
411 Ga0268266_10309046
412 Ga0268265_10168952
413 Ga0268264_10069822
414 Ga0265337_1000077
415 Ga0265337_1025990
416 Ga0265326_10010588
417 Ga0265319_1000004
418 Ga0265319_1013723
419 Ga0265323_10000058
420 Ga0265323_10045041
421 Ga0265322_10022428
422 Ga0265336_10001988
423 Ga0265338_10000038
424 Ga0265338_10000214
425 Ga0265338_10000276
426 Ga0265338_10000439
427 Ga0265338_10000533
428 Ga0265338_10000630
429 Ga0265338_10000843
430 Ga0265338_10001209
431 Ga0265338_10003168
432 Ga0265338_10004206
433 Ga0265338_10004557
434 Ga0265338_10005205
435 Ga0265338_10005988
436 Ga0265338_10007101
437 Ga0265338_10010977
438 Ga0265338_10042086
439 Ga0265338_10049724
440 Ga0265338_10069685
441 Ga0265338_10157554
442 Ga0265338_10163531
443 Ga0265338_10263419
444 Ga0265324_10000237
445 Ga0265324_10000865
446 Ga0265324_10018035
447 Ga0265324_10019675
448 Ga0265324_10027960
449 Ga0265328_10011966
450 Ga0265320_10000242
451 Ga0265320_10000364
452 Ga0265320_10025300
453 Ga0265320_10058233
454 Ga0265325_10007970
455 Ga0265325_10013206
456 Ga0265325_10057682
457 Ga0265329_10000325
458 Ga0265340_10000246
459 Ga0265340_10044978
460 Ga0265339_10013546
461 Ga0265339_10019883
462 Ga0265339_10029683
463 Ga0265339_10067163
464 Ga0265327_10001439
465 Ga0265316_10001480
466 Ga0265316_10005378
467 Ga0265316_10007636
468 Ga0265316_10021474
469 Ga0265316_10047472
470 Ga0265316_10069028
471 Ga0265316_10127303
472 Ga0265313_10004915
473 Ga0265313_10013895
474 Ga0265314_10000214
475 Ga0265314_10061098
476 Ga0265314_10123626
477 Ga0316576_10174895
478 Ga0373950_0001488
479 Ga0373951_0008722
480 Ga0373932_0000001
481 Ga0373945_0005248
482 Ga0373954_0001248
483 Ga0373956_0020622
484 Ga0373946_0023148
485 Ga0373946_0043383
486 Ga0373931_0000004
487 Ga0373927_0057753
488 Ga0373947_0061870
489 Ga0373937_0001257
490 Ga0373937_0239249
491 Ga0373925_0001025
492 Ga0373925_0009077
493 Ga0373925_0019312
494 Ga0395900_0441768
495 Ga0395905_0011375
496 Ga0451577_0001244
497 Ga0451577_0001420
498 Ga0451577_0004245
499 Ga0451577_0014324
500 Ga0451577_0045227
501 Ga0451577_0120612
502 Ga0453684_0005468
503 Ga0453684_0022726
504 Ga0453684_0079718
505 Ga0451576_0029710
506 Ga0451576_0030294
507 Ga0451576_0036675
508 Ga0451576_0058186
509 Ga0451576_0064758
510 Ga0451576_0068329
511 Ga0451576_0071283
512 Ga0451576_0082396
513 Ga0451576_0138683
514 Ga0451576_0161229
515 Ga0451576_0297475
516 Ga0495592_0000101
517 Ga0495592_0173215
518 Ga0495608_0052528
519 Ga0495618_0001806
520 Ga0495628_0001655
521 Ga0495630_0000073
522 Ga0495630_0036449
523 Ga0495630_0174762
524 Ga0495666_0001768
525 Ga0495640_0015495
526 Ga0495640_0029893
527 Ga0495586_0000040
528 Ga0495586_0000348
529 Ga0495586_0000548
530 Ga0495586_0004896
531 Ga0495586_0032801
532 Ga0495656_0076364
533 Ga0495634_0000889
534 Ga0495634_0008406
535 Ga0495634_0031994
536 Ga0495634_0166651
537 Ga0495599_0012567
538 Ga0495647_0031901
539 Ga0495658_0004210
540 Ga0495658_0028547
541 Ga0495613_0008133
542 Ga0495613_0076080
543 Ga0495581_0095952
544 Ga0495604_0106790
545 Ga0495674_0002615
546 Ga0495674_0006476
547 Ga0495674_0110435
548 Ga0495676_0006224
549 Ga0495676_0123381
550 Ga0495680_0042956
551 Ga0495684_0106204
552 Ga0501031_0000004
553 Ga0501031_0018937
554 Ga0501032_0005152
555 Ga0501032_0052606
556 Ga0501033_0011982
557 Ga0501034_0085672
558 Ga0501036_0117347
559 Ga0501257_010413
560 Ga0501080_0088193
561 Ga0501035_0040887
562 Ga0501035_0186142
563 Ga0501044_0001072
564 Ga0501044_0029088
565 nmdc:mga05p37_2475_c1
566 nmdc:mga06r32_312141_c1
567 nmdc:mga08y16_13579_c1
568 nmdc:mga08y16_98393_c1
569 nmdc:mga0n895_10968_c1
570 nmdc:mga0a205_41022_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

83

95

0.97

PF00953

Glycos_transf_4

Glycosyl transferase family 4

112

318

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cxr-assembly4.cif.gz_D crystal structure of mray bound to a sphaerimicin analogue 0.9595 33 391
6oyz-assembly1.cif.gz_A crystal structure of mray bound to capuramycin 0.955 34 391
6oz6-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9546 34 391
6oyh-assembly2.cif.gz_C crystal structure of mray bound to carbacaprazamycin 0.9544 34 391
6oyh-assembly3.cif.gz_B crystal structure of mray bound to carbacaprazamycin 0.9536 34 391
ID Description Score Start End Superfamily
af_B6SP54_8_261_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2964 204 393 1.20.1250.20
af_Q55EC8_162_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.286 205 391 1.20.1250.20
af_A0A1D8PJN2_21_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2858 118 388 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.275 204 387 1.20.1250.20
af_O01840_1_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2699 201 387 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A382HE65-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase 0.9873 205 393 GO:0005886
GO:0008963
GO:0044038
GO:0071555
AF-A0A661TJ11-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9841 227 393 GO:0005886
GO:0008963
GO:0009252
GO:0046872
GO:0051992
GO:0071555
AF-A0A536UQL1-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9811 236 393 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0051992
GO:0071555
AF-A0A7C7VBU3-F1-model_v4 deleted 0.9787 204 393
AF-A0A3C0DUC1-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9781 200 337 GO:0005886
GO:0008963
GO:0044038
GO:0046872
GO:0051992
GO:0071555

Map