F386785

General Info

Members Datasets Scaffolds Average Seq Length
285 183 255 471

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10001126|Ga0157371_1000112623
Length 530
Sequence LNKGRDSASSFAANAGFEFRISNLIFQKASCSSIFLPPNPISLILHTKKFFMDENLYDFGMIGLGVMGSNLLLNMADHGFAVIGYDKNPDKTKAFEAEATEGTTVKGVNTLEVMIAKLKTPRKLMMLVPAGKPVDSVINELKPLLQKGDIIIDGGNSHYTDTLRRIAELQNAGFHFMGMGISGGEEGARLGPSIMPGGDMEAYKEVAPILKAIAAKVNGEPCVGYLGHNAAGHYVKMVHNGIEYAIMELISECYDLMHHGLGLSSEELEQVFKDWDSGDMKSFLLEITAVIFARKDEKIDRYLLDMILDKAGAKGTGKWTSQEGLDLPMPIPTIDSAVMMRNLSSLIDERKEAAEMYKTDPKKIETDKKEFISQLREALYFSTLISYAQGLAMLPVASAELKMDIPLPEVVSVWRGGCIIRSAMLDLFKKAYQDADLKNLLLDKNIAQILQGKESALQKVVSIAALNNYPAAGLMSSLNYFNAYRRRLLPTNLIQAQRDFFGAHTYQRTDKEGIFHTVWEEEVRKAEMEK

Samples

Sample ID Description Type Environment
1 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
2 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
3 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
4 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
5 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
6 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
7 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
8 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
9 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
10 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
11 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
15 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
16 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
17 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
18 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
19 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
20 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
21 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
22 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
23 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
24 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
25 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
26 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
27 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
28 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
29 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
30 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
172 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
173 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
177 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
178 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
179 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.47
Metatranscriptomes 0
Isolates 10.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0.35
Rhizoplane 0
Rhizosphere 85.61
Stem 0
Stem Tuber 0
Unclassified 11.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011909 3300001979 Bacteria 3294
2 rootH1_10176428 3300003316 Bacteria 2241
3 rootH2_10000351 3300003320 Bacteria 12685
4 rootH2_10050780 3300003320 Bacteria 10519
5 rootL2_10035061 3300003322 Bacteria 5629
6 rootL2_10104958 3300003322 Bacteria 2819
7 JGI25160J50197_1000193 3300003354 Bacteria 51332
8 Ga0065704_10073351 3300005289 Bacteria 7266
9 Ga0065704_10132942 3300005289 Bacteria 1606
10 Ga0070658_10025053 3300005327 Bacteria 4782
11 Ga0070658_10029210 3300005327 Bacteria 4429
12 Ga0070658_10095993 3300005327 Bacteria 2447
13 Ga0070658_10101538 3300005327 Bacteria 2378
14 Ga0070658_10164198 3300005327 Bacteria 1864
15 Ga0070670_100038467 3300005331 Bacteria 4114
16 Ga0070677_10009451 3300005333 Bacteria 3305
17 Ga0070666_10003676 3300005335 Bacteria 9296
18 Ga0070680_100032316 3300005336 Bacteria 4213
19 Ga0070680_100047419 3300005336 Bacteria 3498
20 Ga0070680_100149129 3300005336 Bacteria 1963
21 Ga0070682_100000392 3300005337 Bacteria 29167
22 Ga0070682_100024461 3300005337 Bacteria 3595
23 Ga0068868_100007251 3300005338 Bacteria 7885
24 Ga0070660_100034119 3300005339 Bacteria 3843
25 Ga0070668_100057203 3300005347 Bacteria 3013
26 Ga0070674_100038301 3300005356 Bacteria 3230
27 Ga0070667_100002402 3300005367 Bacteria 16395
28 Ga0070678_100003657 3300005456 Bacteria 8586
29 Ga0070681_10047246 3300005458 Bacteria 4303
30 Ga0070681_10058505 3300005458 Bacteria 3834
31 Ga0070681_10110051 3300005458 Bacteria 2695
32 Ga0070681_10227690 3300005458 Bacteria 1779
33 Ga0068867_100065442 3300005459 Bacteria 2705
34 Ga0070679_100002695 3300005530 Bacteria 16172
35 Ga0070679_100014547 3300005530 Bacteria 7559
36 Ga0070679_100071339 3300005530 Bacteria 3464
37 Ga0070679_100122776 3300005530 Bacteria 2581
38 Ga0070684_100019063 3300005535 Bacteria 5670
39 Ga0068853_100000595 3300005539 Bacteria 24814
40 Ga0068853_100007459 3300005539 Bacteria 8754
41 Ga0068853_100145779 3300005539 Bacteria 2128
42 Ga0070672_100021513 3300005543 Bacteria 4722
43 Ga0070695_100056819 3300005545 Bacteria 2527
44 Ga0070665_100028108 3300005548 Bacteria 5664
45 Ga0068855_100017559 3300005563 Bacteria 8604
46 Ga0068855_100020017 3300005563 Bacteria 8035
47 Ga0068855_100049257 3300005563 Bacteria 4969
48 Ga0068855_100101833 3300005563 Bacteria 3306
49 Ga0068856_100011241 3300005614 Bacteria 8690
50 Ga0068856_100031876 3300005614 Bacteria 5157
51 Ga0068856_100095139 3300005614 Bacteria 2967
52 Ga0068852_100006862 3300005616 Bacteria 8273
53 Ga0068852_100160283 3300005616 Bacteria 2100
54 Ga0068852_100225262 3300005616 Bacteria 1785
55 Ga0068859_100006236 3300005617 Bacteria 12106
56 Ga0068864_100021783 3300005618 Bacteria 5369
57 Ga0068864_100161561 3300005618 Bacteria 2036
58 Ga0068861_100046562 3300005719 Bacteria 3270
59 Ga0068870_10004492 3300005840 Bacteria 6006
60 Ga0068860_100007403 3300005843 Bacteria 10982
61 Ga0068860_100112395 3300005843 Bacteria 2605
62 Ga0081540_1020767 3300005983 Bacteria 3935
63 Ga0075366_10007167 3300006195 Bacteria 6140
64 Ga0097621_100014826 3300006237 Bacteria 5846
65 Ga0075370_10066009 3300006353 Bacteria 2064
66 Ga0068871_100012871 3300006358 Bacteria 6194
67 Ga0068865_100029638 3300006881 Bacteria 3633
68 Ga0097620_100006236 3300006931 Bacteria 12106
69 Ga0105244_10000204 3300009036 Bacteria 60589
70 Ga0105240_10002358 3300009093 Bacteria 30449
71 Ga0105240_10054719 3300009093 Bacteria 4999
72 Ga0114129_10001087 3300009147 Bacteria 35667
73 Ga0105243_10000143 3300009148 Bacteria 81998
74 Ga0105243_10000955 3300009148 Bacteria 27007
75 Ga0105241_10002042 3300009174 Bacteria 15268
76 Ga0105242_10014402 3300009176 Bacteria 6128
77 Ga0105237_10002282 3300009545 Bacteria 23838
78 Ga0105237_10002321 3300009545 Bacteria 23628
79 Ga0105237_10018640 3300009545 Bacteria 7176
80 Ga0105249_10187827 3300009553 Bacteria 2015
81 Ga0105239_10028067 3300010375 Bacteria 6193
82 Ga0105246_10006084 3300011119 Bacteria 7364
83 Ga0157373_10010020 3300013100 Bacteria 6984
84 Ga0157373_10026873 3300013100 Bacteria 4154
85 Ga0157371_10000310 3300013102 Bacteria 63504
86 Ga0157371_10000759 3300013102 Bacteria 37290
87 Ga0157371_10001126 3300013102 Bacteria 28872
88 Ga0157371_10008605 3300013102 Bacteria 8106
89 Ga0157371_10011198 3300013102 Bacteria 6932
90 Ga0157371_10023265 3300013102 Bacteria 4531
91 Ga0157371_10026618 3300013102 Bacteria 4202
92 Ga0157371_10039453 3300013102 Bacteria 3376
93 Ga0157371_10054384 3300013102 Bacteria 2843
94 Ga0157371_10075939 3300013102 Bacteria 2380
95 Ga0157371_10126808 3300013102 Bacteria 1816
96 Ga0157370_10001642 3300013104 Bacteria 27619
97 Ga0157370_10012086 3300013104 Bacteria 8982
98 Ga0157370_10021526 3300013104 Bacteria 6425
99 Ga0157370_10025831 3300013104 Bacteria 5810
100 Ga0157370_10057155 3300013104 Bacteria 3711
101 Ga0157369_10010659 3300013105 Bacteria 10462
102 Ga0157369_10020379 3300013105 Bacteria 7412
103 Ga0157374_10097486 3300013296 Bacteria 2813
104 Ga0157374_10100433 3300013296 Bacteria 2773
105 Ga0157378_10151933 3300013297 Bacteria 2158
106 Ga0157372_10054901 3300013307 Bacteria 4447
107 Ga0157372_10056027 3300013307 Bacteria 4404
108 Ga0157372_10061062 3300013307 Bacteria 4219
109 Ga0157372_10080985 3300013307 Bacteria 3675
110 Ga0157372_10095696 3300013307 Bacteria 3384
111 Ga0157372_10321523 3300013307 Bacteria 1801
112 Ga0157375_10011807 3300013308 Bacteria 7722
113 Ga0157380_10009034 3300014326 Bacteria 7120
114 Ga0157376_10083945 3300014969 Bacteria 2741
115 Ga0163161_10008541 3300017792 Bacteria 7086
116 Ga0163161_10092749 3300017792 Bacteria 2236
117 Ga0209675_1000175 3300025291 Bacteria 74245
118 Ga0207426_1000026 3300025302 Bacteria 515228
119 Ga0207655_1000508 3300025728 Bacteria 49719
120 Ga0207682_10012263 3300025893 Bacteria 3347
121 Ga0207642_10016921 3300025899 Bacteria 2760
122 Ga0207645_10000193 3300025907 Bacteria 49552
123 Ga0207643_10006907 3300025908 Bacteria 6086
124 Ga0207705_10012644 3300025909 Bacteria 6092
125 Ga0207705_10014995 3300025909 Bacteria 5571
126 Ga0207705_10024771 3300025909 Bacteria 4282
127 Ga0207705_10137561 3300025909 Bacteria 1822
128 Ga0207654_10003473 3300025911 Bacteria 7968
129 Ga0207707_10043476 3300025912 Bacteria 3919
130 Ga0207695_10000087 3300025913 Bacteria 276412
131 Ga0207695_10051324 3300025913 Bacteria 4332
132 Ga0207671_10026535 3300025914 Bacteria 4339
133 Ga0207660_10044986 3300025917 Bacteria 3108
134 Ga0207660_10120874 3300025917 Bacteria 1983
135 Ga0207660_10131604 3300025917 Bacteria 1905
136 Ga0207657_10008178 3300025919 Bacteria 10655
137 Ga0207657_10069046 3300025919 Bacteria 3000
138 Ga0207652_10001975 3300025921 Bacteria 17735
139 Ga0207652_10006883 3300025921 Bacteria 9159
140 Ga0207652_10111440 3300025921 Bacteria 2427
141 Ga0207681_10107143 3300025923 Bacteria 2026
142 Ga0207650_10052567 3300025925 Bacteria 3018
143 Ga0207659_10061792 3300025926 Unclassified 2701
144 Ga0207659_10070709 3300025926 Bacteria 2546
145 Ga0207690_10046006 3300025932 Bacteria 2887
146 Ga0207709_10000184 3300025935 Bacteria 83205
147 Ga0207709_10009634 3300025935 Bacteria 5320
148 Ga0207704_10012770 3300025938 Bacteria 4176
149 Ga0207691_10002498 3300025940 Bacteria 17985
150 Ga0207689_10001011 3300025942 Bacteria 27034
151 Ga0207661_10004686 3300025944 Bacteria 9579
152 Ga0207667_10000584 3300025949 Bacteria 47412
153 Ga0207667_10009282 3300025949 Bacteria 11607
154 Ga0207667_10034865 3300025949 Bacteria 5401
155 Ga0207667_10082982 3300025949 Bacteria 3319
156 Ga0207668_10172379 3300025972 Bacteria 1698
157 Ga0207640_10013155 3300025981 Bacteria 4735
158 Ga0207658_10068667 3300025986 Bacteria 2675
159 Ga0207658_10173164 3300025986 Bacteria 1780
160 Ga0207639_10130970 3300026041 Bacteria 2076
161 Ga0207702_10048876 3300026078 Bacteria 3568
162 Ga0207702_10075095 3300026078 Bacteria 2919
163 Ga0207702_10249978 3300026078 Bacteria 1665
164 Ga0207648_10000914 3300026089 Bacteria 33242
165 Ga0207674_10033809 3300026116 Bacteria 5350
166 Ga0207674_10135807 3300026116 Bacteria 2422
167 Ga0207675_100013769 3300026118 Bacteria 7545
168 Ga0207683_10009836 3300026121 Bacteria 8158
169 Ga0207698_10010381 3300026142 Bacteria 5979
170 Ga0207698_10167548 3300026142 Bacteria 1930
171 Ga0268266_10033698 3300028379 Bacteria 4353
172 Ga0268265_10054259 3300028380 Unclassified 3040
173 Ga0268264_10039887 3300028381 Bacteria 3879
174 Ga0307511_10000076 3300030521 Bacteria 82520
175 Ga0265325_10000991 3300031241 Bacteria 20371
176 Ga0265339_10003520 3300031249 Bacteria 10938
177 Ga0265331_10000388 3300031250 Bacteria 45506
178 Ga0265313_10000879 3300031595 Bacteria 30392
179 Ga0265313_10019467 3300031595 Bacteria 3775
180 Ga0316579_10001771 3300031691 Bacteria 7943
181 Ga0316579_10022891 3300031691 Bacteria 2799
182 Ga0316579_10044323 3300031691 Bacteria 2071
183 Ga0265314_10000770 3300031711 Bacteria 38192
184 Ga0316576_10067359 3300031727 Bacteria 2636
185 Ga0316585_10020175 3300032137 Bacteria 2038
186 Ga0307510_10000949 3300033180 Bacteria 30604
187 Ga0316582_0008238 3300036647 Bacteria 5590
188 Ga0316582_0008632 3300036647 Bacteria 5483
189 Ga0316582_0040180 3300036647 Bacteria 2918
190 Ga0316582_0089783 3300036647 Bacteria 2021
191 Ga0316584_0000340 3300036712 Bacteria 23993
192 Ga0316584_0002815 3300036712 Bacteria 11151
193 Ga0316584_0006177 3300036712 Bacteria 8101
194 Ga0316584_0086399 3300036712 Bacteria 2348
195 Ga0395899_0017218 3300037312 Bacteria 5506
196 Ga0395899_0086383 3300037312 Bacteria 2278
197 Ga0395900_0002065 3300037418 Bacteria 22530
198 Ga0395900_0003198 3300037418 Bacteria 17741
199 Ga0395900_0074765 3300037418 Bacteria 3483
200 Ga0395900_0122195 3300037418 Bacteria 2671
201 Ga0395900_0246998 3300037418 Bacteria 1787
202 Ga0395898_0003202 3300037466 Bacteria 18427
203 Ga0395898_0031361 3300037466 Bacteria 5311
204 Ga0395898_0031584 3300037466 Bacteria 5290
205 Ga0395905_0036298 3300037471 Bacteria 4629
206 Ga0395901_0000905 3300038443 Bacteria 32593
207 Ga0395901_0001659 3300038443 Bacteria 22988
208 Ga0395901_0079270 3300038443 Bacteria 3429
209 Ga0395901_0109983 3300038443 Bacteria 2893
210 Ga0439466_0034140 3300041411 Bacteria 1726
211 Ga0439431_0000098 3300041997 Bacteria 14675
212 Ga0451577_0268126 3300042876 Bacteria 1546
213 Ga0495590_0018548 3300046457 Bacteria 2490
214 Ga0495596_0000248 3300046500 Bacteria 35866
215 Ga0495606_0001358 3300046507 Bacteria 33214
216 Ga0495632_0003896 3300046519 Bacteria 10373
217 Ga0495609_0000185 3300046538 Bacteria 62912
218 Ga0495633_0004031 3300046558 Bacteria 9502
219 Ga0495667_0167340 3300046559 Bacteria 1413
220 Ga0495625_0000543 3300046660 Bacteria 55204
221 Ga0495686_0000151 3300047472 Bacteria 135048
222 Ga0496116_0000022 3300048919 Bacteria 482506
223 Ga0496116_0003946 3300048919 Bacteria 14427
224 Ga0496117_0000074 3300048920 Bacteria 232732
225 Ga0496118_0000983 3300048921 Bacteria 44379
226 Ga0496119_0000017 3300048922 Bacteria 309779
227 Ga0496122_0000123 3300048925 Bacteria 180420
228 Ga0496122_0000159 3300048925 Bacteria 159297
229 Ga0496122_0000536 3300048925 Bacteria 78520
230 Ga0496122_0001983 3300048925 Bacteria 30552
231 Ga0496122_0002591 3300048925 Bacteria 25343
232 Ga0496122_0010627 3300048925 Bacteria 9456
233 Ga0496123_0002659 3300048926 Bacteria 21582
234 Ga0496123_0015043 3300048926 Bacteria 6372
235 Ga0496123_0024434 3300048926 Bacteria 4593
236 Ga0496124_0000835 3300048927 Bacteria 50192
237 Ga0496125_0000156 3300048928 Bacteria 151400
238 Ga0496125_0008790 3300048928 Bacteria 10504
239 Ga0496126_0001545 3300048929 Bacteria 35377
240 Ga0501034_0035729 3300049571 Bacteria 5037
241 Ga0501034_0128100 3300049571 Bacteria 2523
242 Ga0501070_0028679 3300049586 Bacteria 4667
243 Ga0501198_004863 3300049649 Bacteria 1877
244 Ga0501201_000788 3300049651 Bacteria 2968
245 Ga0501217_000705 3300049661 Bacteria 5740
246 Ga0501223_002036 3300049663 Bacteria 4534
247 Ga0501235_001846 3300049669 Bacteria 4528
248 Ga0501243_000765 3300049675 Bacteria 4458
249 Ga0501259_000504 3300049688 Bacteria 6268
250 Ga0501245_000835 3300049708 Bacteria 3882
251 Ga0501279_001181 3300049775 Bacteria 3427
252 Ga0501035_0038300 3300049822 Bacteria 4342
253 Ga0501044_0162001 3300049823 Unclassified 2213
254 Ga0500611_000003 3300053727 Bacteria 333431
255 Ga0466962_0012893 3300061719 Bacteria 4020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10164198 Ga0070658_101641981 398
2 3300025972 Ga0207668_10172379 Ga0207668_101723791 407
3 3300046559 Ga0495667_0167340 Ga0495667_0167340_94_1392 421
4 3300003322 rootL2_10104958 rootL2_101049582 432
5 3300026078 Ga0207702_10249978 Ga0207702_102499782 437
6 3300049822 Ga0501035_0038300 Ga0501035_0038300_755_2179 448
7 3300005614 Ga0068856_100031876 Ga0068856_1000318766 452
8 3300033180 Ga0307510_10000949 Ga0307510_1000094915 452
9 3300046507 Ga0495606_0001358 Ga0495606_0001358_537_1952 452
10 3300013104 Ga0157370_10025831 Ga0157370_100258313 454
11 3300037471 Ga0395905_0036298 Ga0395905_0036298_1402_2814 456
12 3300009036 Ga0105244_10000204 Ga0105244_1000020425 458
13 3300036647 Ga0316582_0040180 Ga0316582_0040180_1033_2445 459
14 3300005614 Ga0068856_100095139 Ga0068856_1000951391 460
15 3300003320 rootH2_10000351 rootH2_100003517 461
16 3300005535 Ga0070684_100019063 Ga0070684_1000190635 461
17 3300005563 Ga0068855_100017559 Ga0068855_1000175599 461
18 3300025913 Ga0207695_10000087 Ga0207695_10000087132 461
19 3300025944 Ga0207661_10004686 Ga0207661_1000468610 461
20 3300025949 Ga0207667_10000584 Ga0207667_1000058442 461
21 3300005336 Ga0070680_100032316 Ga0070680_1000323163 462
22 3300005458 Ga0070681_10047246 Ga0070681_100472463 462
23 3300005530 Ga0070679_100071339 Ga0070679_1000713392 462
24 3300005563 Ga0068855_100049257 Ga0068855_1000492573 462
25 3300010375 Ga0105239_10028067 Ga0105239_100280677 462
26 3300013100 Ga0157373_10010020 Ga0157373_100100207 462
27 3300013102 Ga0157371_10011198 Ga0157371_100111983 462
28 3300013102 Ga0157371_10039453 Ga0157371_100394532 462
29 3300013105 Ga0157369_10020379 Ga0157369_100203798 462
30 3300013307 Ga0157372_10095696 Ga0157372_100956962 462
31 3300025909 Ga0207705_10014995 Ga0207705_100149954 462
32 3300025909 Ga0207705_10024771 Ga0207705_100247713 462
33 3300025912 Ga0207707_10043476 Ga0207707_100434763 462
34 3300025917 Ga0207660_10044986 Ga0207660_100449862 462
35 3300025921 Ga0207652_10006883 Ga0207652_100068836 462
36 3300025949 Ga0207667_10009282 Ga0207667_1000928210 462
37 3300026078 Ga0207702_10048876 Ga0207702_100488763 462
38 3300037312 Ga0395899_0017218 Ga0395899_0017218_638_2104 462
39 3300037418 Ga0395900_0074765 Ga0395900_0074765_1672_3207 462
40 3300037418 Ga0395900_0122195 Ga0395900_0122195_794_2260 462
41 3300037466 Ga0395898_0031361 Ga0395898_0031361_3215_4681 462
42 3300038443 Ga0395901_0079270 Ga0395901_0079270_540_2006 462
43 3300038443 Ga0395901_0109983 Ga0395901_0109983_1046_2581 462
44 3300006195 Ga0075366_10007167 Ga0075366_100071672 464
45 3300009545 Ga0105237_10002321 Ga0105237_1000232119 464
46 3300013307 Ga0157372_10321523 Ga0157372_103215231 464
47 3300037418 Ga0395900_0246998 Ga0395900_0246998_25_1440 464
48 3300046457 Ga0495590_0018548 Ga0495590_0018548_1008_2405 464
49 3300005327 Ga0070658_10025053 Ga0070658_100250533 465
50 3300005339 Ga0070660_100034119 Ga0070660_1000341191 465
51 3300005530 Ga0070679_100014547 Ga0070679_1000145474 465
52 3300005539 Ga0068853_100145779 Ga0068853_1001457791 465
53 3300005616 Ga0068852_100006862 Ga0068852_1000068627 465
54 3300013102 Ga0157371_10054384 Ga0157371_100543842 465
55 3300025917 Ga0207660_10120874 Ga0207660_101208742 465
56 3300025919 Ga0207657_10008178 Ga0207657_100081786 465
57 3300026142 Ga0207698_10010381 Ga0207698_100103812 465
58 3300031241 Ga0265325_10000991 Ga0265325_100009912 465
59 3300031249 Ga0265339_10003520 Ga0265339_100035206 465
60 3300031250 Ga0265331_10000388 Ga0265331_1000038824 465
61 3300031595 Ga0265313_10000879 Ga0265313_100008792 465
62 3300031711 Ga0265314_10000770 Ga0265314_1000077022 465
63 iso_pu_bacteria 2910245624 2910248972 465
64 3300009553 Ga0105249_10187827 Ga0105249_101878272 466
65 iso_pu_bacteria 2883068021 2883070820 466
66 3300005331 Ga0070670_100038467 Ga0070670_1000384674 467
67 3300025925 Ga0207650_10052567 Ga0207650_100525673 467
68 3300053727 Ga0500611_000003 Ga0500611_000003_255881_257287 467
69 iso_pu_bacteria 2582581278 2585144782 467
70 iso_pu_bacteria 2585428045 2587677567 467
71 iso_pu_bacteria 2585428060 2587746732 467
72 iso_pu_bacteria 2585428061 2587753014 467
73 iso_pu_bacteria 2585428095 2587868044 467
74 iso_pu_bacteria 2585428182 2588209435 467
75 iso_pu_bacteria 2585428183 2588213771 467
76 iso_pu_bacteria 2585428184 2588218631 467
77 iso_pu_bacteria 2585428185 2588225683 467
78 iso_pu_bacteria 2585428187 2588233942 467
79 iso_pu_bacteria 2588253712 2588445030 467
80 iso_pu_bacteria 2588254255 2590604380 467
81 iso_pu_bacteria 2588254257 2590612370 467
82 iso_pu_bacteria 2721755487 2722727913 467
83 iso_pu_bacteria 2728369107 2729199086 467
84 iso_pu_bacteria 2738541273 2738700236 467
85 iso_pu_bacteria 2738543014 2739253985 467
86 iso_pu_bacteria 2739367874 2740058205 467
87 iso_pu_bacteria 2765235839 2765573120 467
88 iso_pu_bacteria 2816332188 2816873571 467
89 iso_pu_bacteria 2840677318 2840678004 467
90 iso_pu_bacteria 2871720351 2871723369 467
91 iso_pu_bacteria 2889290771 2889291174 467
92 iso_pu_bacteria 2896085136 2896085821 467
93 iso_pu_bacteria 2945924605 2945928165 467
94 iso_pu_bacteria 2977243572 2977246393 467
95 iso_pu_bacteria 2993372514 2993373832 467
96 3300005530 Ga0070679_100002695 Ga0070679_1000026955 468
97 3300013104 Ga0157370_10012086 Ga0157370_100120864 468
98 3300025921 Ga0207652_10001975 Ga0207652_100019755 468
99 3300025932 Ga0207690_10046006 Ga0207690_100460062 468
100 3300025949 Ga0207667_10082982 Ga0207667_100829823 468
101 3300026116 Ga0207674_10033809 Ga0207674_100338092 468
102 3300031691 Ga0316579_10001771 Ga0316579_100017717 468
103 3300031691 Ga0316579_10022891 Ga0316579_100228912 468
104 3300031691 Ga0316579_10044323 Ga0316579_100443232 468
105 3300031727 Ga0316576_10067359 Ga0316576_100673591 468
106 3300032137 Ga0316585_10020175 Ga0316585_100201751 468
107 3300036647 Ga0316582_0008238 Ga0316582_0008238_2376_3785 468
108 3300036647 Ga0316582_0008632 Ga0316582_0008632_3944_5353 468
109 3300036712 Ga0316584_0000340 Ga0316584_0000340_20286_21695 468
110 3300036712 Ga0316584_0002815 Ga0316584_0002815_6949_8358 468
111 3300036712 Ga0316584_0006177 Ga0316584_0006177_5786_7195 468
112 3300036712 Ga0316584_0086399 Ga0316584_0086399_58_1467 468
113 3300037418 Ga0395900_0002065 Ga0395900_0002065_15242_16651 468
114 3300037418 Ga0395900_0003198 Ga0395900_0003198_13930_15339 468
115 3300037466 Ga0395898_0003202 Ga0395898_0003202_5314_6723 468
116 3300038443 Ga0395901_0000905 Ga0395901_0000905_5852_7261 468
117 3300005333 Ga0070677_10009451 Ga0070677_100094512 469
118 3300005335 Ga0070666_10003676 Ga0070666_100036761 469
119 3300005338 Ga0068868_100007251 Ga0068868_1000072517 469
120 3300005356 Ga0070674_100038301 Ga0070674_1000383012 469
121 3300005367 Ga0070667_100002402 Ga0070667_10000240212 469
122 3300005456 Ga0070678_100003657 Ga0070678_1000036572 469
123 3300005459 Ga0068867_100065442 Ga0068867_1000654422 469
124 3300005543 Ga0070672_100021513 Ga0070672_1000215132 469
125 3300005548 Ga0070665_100028108 Ga0070665_1000281082 469
126 3300005617 Ga0068859_100006236 Ga0068859_1000062364 469
127 3300005618 Ga0068864_100161561 Ga0068864_1001615612 469
128 3300005719 Ga0068861_100046562 Ga0068861_1000465623 469
129 3300005840 Ga0068870_10004492 Ga0068870_100044923 469
130 3300005843 Ga0068860_100112395 Ga0068860_1001123952 469
131 3300006237 Ga0097621_100014826 Ga0097621_1000148265 469
132 3300006358 Ga0068871_100012871 Ga0068871_1000128712 469
133 3300006881 Ga0068865_100029638 Ga0068865_1000296382 469
134 3300006931 Ga0097620_100006236 Ga0097620_1000062364 469
135 3300009176 Ga0105242_10014402 Ga0105242_100144024 469
136 3300011119 Ga0105246_10006084 Ga0105246_100060841 469
137 3300013102 Ga0157371_10026618 Ga0157371_100266183 469
138 3300013296 Ga0157374_10097486 Ga0157374_100974863 469
139 3300013308 Ga0157375_10011807 Ga0157375_100118076 469
140 3300014326 Ga0157380_10009034 Ga0157380_100090343 469
141 3300025893 Ga0207682_10012263 Ga0207682_100122632 469
142 3300025899 Ga0207642_10016921 Ga0207642_100169211 469
143 3300025907 Ga0207645_10000193 Ga0207645_1000019338 469
144 3300025908 Ga0207643_10006907 Ga0207643_100069073 469
145 3300025923 Ga0207681_10107143 Ga0207681_101071431 469
146 3300025926 Ga0207659_10061792 Ga0207659_100617922 469
147 3300025926 Ga0207659_10070709 Ga0207659_100707092 469
148 3300025938 Ga0207704_10012770 Ga0207704_100127702 469
149 3300025940 Ga0207691_10002498 Ga0207691_100024986 469
150 3300025942 Ga0207689_10001011 Ga0207689_100010112 469
151 3300025981 Ga0207640_10013155 Ga0207640_100131553 469
152 3300025986 Ga0207658_10068667 Ga0207658_100686672 469
153 3300026041 Ga0207639_10130970 Ga0207639_101309702 469
154 3300026089 Ga0207648_10000914 Ga0207648_1000091420 469
155 3300026118 Ga0207675_100013769 Ga0207675_1000137693 469
156 3300026121 Ga0207683_10009836 Ga0207683_100098362 469
157 3300026142 Ga0207698_10167548 Ga0207698_101675482 469
158 3300028379 Ga0268266_10033698 Ga0268266_100336983 469
159 3300028381 Ga0268264_10039887 Ga0268264_100398872 469
160 3300049649 Ga0501198_004863 Ga0501198_004863_316_1728 469
161 3300049651 Ga0501201_000788 Ga0501201_000788_1519_2931 469
162 3300049661 Ga0501217_000705 Ga0501217_000705_1368_2780 469
163 3300049663 Ga0501223_002036 Ga0501223_002036_2695_4107 469
164 3300049669 Ga0501235_001846 Ga0501235_001846_2669_4081 469
165 3300049675 Ga0501243_000765 Ga0501243_000765_1470_2882 469
166 3300049688 Ga0501259_000504 Ga0501259_000504_3372_4784 469
167 3300049708 Ga0501245_000835 Ga0501245_000835_2105_3517 469
168 3300049775 Ga0501279_001181 Ga0501279_001181_880_2292 469
169 3300005539 Ga0068853_100000595 Ga0068853_10000059513 470
170 3300005545 Ga0070695_100056819 Ga0070695_1000568192 470
171 3300005983 Ga0081540_1020767 Ga0081540_10207672 470
172 3300009093 Ga0105240_10002358 Ga0105240_100023584 470
173 3300009545 Ga0105237_10002282 Ga0105237_1000228215 470
174 3300013104 Ga0157370_10021526 Ga0157370_100215266 470
175 3300013104 Ga0157370_10057155 Ga0157370_100571553 470
176 3300013307 Ga0157372_10061062 Ga0157372_100610622 470
177 3300013307 Ga0157372_10080985 Ga0157372_100809853 470
178 3300030521 Ga0307511_10000076 Ga0307511_1000007630 470
179 3300036647 Ga0316582_0089783 Ga0316582_0089783_159_1619 470
180 3300041997 Ga0439431_0000098 Ga0439431_0000098_9656_11071 470
181 3300049571 Ga0501034_0035729 Ga0501034_0035729_1330_2745 470
182 3300049823 Ga0501044_0162001 Ga0501044_0162001_649_2064 470
183 3300061719 Ga0466962_0012893 Ga0466962_0012893_303_1718 470
184 3300003316 rootH1_10176428 rootH1_101764282 471
185 3300003320 rootH2_10050780 rootH2_100507805 471
186 3300003322 rootL2_10035061 rootL2_100350615 471
187 3300005289 Ga0065704_10073351 Ga0065704_100733515 471
188 3300005289 Ga0065704_10132942 Ga0065704_101329421 471
189 3300005337 Ga0070682_100000392 Ga0070682_1000003923 471
190 3300005337 Ga0070682_100024461 Ga0070682_1000244611 471
191 3300005347 Ga0070668_100057203 Ga0070668_1000572032 471
192 3300005530 Ga0070679_100122776 Ga0070679_1001227762 471
193 3300005539 Ga0068853_100007459 Ga0068853_1000074595 471
194 3300005563 Ga0068855_100020017 Ga0068855_1000200176 471
195 3300005614 Ga0068856_100011241 Ga0068856_1000112415 471
196 3300009093 Ga0105240_10054719 Ga0105240_100547193 471
197 3300009148 Ga0105243_10000143 Ga0105243_1000014340 471
198 3300009148 Ga0105243_10000955 Ga0105243_100009553 471
199 3300009174 Ga0105241_10002042 Ga0105241_100020428 471
200 3300009545 Ga0105237_10018640 Ga0105237_100186405 471
201 3300013102 Ga0157371_10000310 Ga0157371_1000031044 471
202 3300013102 Ga0157371_10023265 Ga0157371_100232656 471
203 3300013307 Ga0157372_10056027 Ga0157372_100560272 471
204 3300017792 Ga0163161_10008541 Ga0163161_100085413 471
205 3300017792 Ga0163161_10092749 Ga0163161_100927492 471
206 3300025291 Ga0209675_1000175 Ga0209675_100017522 471
207 3300025728 Ga0207655_1000508 Ga0207655_100050815 471
208 3300025911 Ga0207654_10003473 Ga0207654_100034737 471
209 3300025913 Ga0207695_10051324 Ga0207695_100513243 471
210 3300025921 Ga0207652_10111440 Ga0207652_101114402 471
211 3300025935 Ga0207709_10000184 Ga0207709_1000018441 471
212 3300025935 Ga0207709_10009634 Ga0207709_100096343 471
213 3300025949 Ga0207667_10034865 Ga0207667_100348655 471
214 3300026078 Ga0207702_10075095 Ga0207702_100750952 471
215 3300031595 Ga0265313_10019467 Ga0265313_100194673 471
216 3300041411 Ga0439466_0034140 Ga0439466_0034140_68_1486 471
217 3300042876 Ga0451577_0268126 Ga0451577_0268126_82_1524 471
218 3300046500 Ga0495596_0000248 Ga0495596_0000248_18629_20047 471
219 3300046519 Ga0495632_0003896 Ga0495632_0003896_1098_2516 471
220 3300046538 Ga0495609_0000185 Ga0495609_0000185_56629_58047 471
221 3300046558 Ga0495633_0004031 Ga0495633_0004031_7849_9267 471
222 3300046660 Ga0495625_0000543 Ga0495625_0000543_7325_8743 471
223 3300047472 Ga0495686_0000151 Ga0495686_0000151_86264_87682 471
224 3300048919 Ga0496116_0000022 Ga0496116_0000022_181711_183129 471
225 3300048919 Ga0496116_0003946 Ga0496116_0003946_1202_2620 471
226 3300048920 Ga0496117_0000074 Ga0496117_0000074_179666_181084 471
227 3300048921 Ga0496118_0000983 Ga0496118_0000983_33259_34677 471
228 3300048922 Ga0496119_0000017 Ga0496119_0000017_51566_52984 471
229 3300048925 Ga0496122_0000123 Ga0496122_0000123_66084_67502 471
230 3300048925 Ga0496122_0000159 Ga0496122_0000159_119781_121199 471
231 3300048925 Ga0496122_0000536 Ga0496122_0000536_60010_61428 471
232 3300048925 Ga0496122_0001983 Ga0496122_0001983_1641_3059 471
233 3300048925 Ga0496122_0002591 Ga0496122_0002591_12125_13543 471
234 3300048925 Ga0496122_0010627 Ga0496122_0010627_6075_7493 471
235 3300048926 Ga0496123_0002659 Ga0496123_0002659_17042_18460 471
236 3300048926 Ga0496123_0015043 Ga0496123_0015043_4366_5784 471
237 3300048926 Ga0496123_0024434 Ga0496123_0024434_390_1808 471
238 3300048927 Ga0496124_0000835 Ga0496124_0000835_31295_32713 471
239 3300048928 Ga0496125_0000156 Ga0496125_0000156_109619_111037 471
240 3300048928 Ga0496125_0008790 Ga0496125_0008790_6030_7448 471
241 3300048929 Ga0496126_0001545 Ga0496126_0001545_250_1668 471
242 iso_pu_bacteria 2993480792 2993484514 471
243 3300005327 Ga0070658_10029210 Ga0070658_100292102 472
244 3300005327 Ga0070658_10095993 Ga0070658_100959932 472
245 3300005327 Ga0070658_10101538 Ga0070658_101015382 472
246 3300005336 Ga0070680_100047419 Ga0070680_1000474192 472
247 3300005336 Ga0070680_100149129 Ga0070680_1001491292 472
248 3300005458 Ga0070681_10110051 Ga0070681_101100512 472
249 3300005458 Ga0070681_10227690 Ga0070681_102276902 472
250 3300005563 Ga0068855_100101833 Ga0068855_1001018333 472
251 3300005616 Ga0068852_100160283 Ga0068852_1001602832 472
252 3300005616 Ga0068852_100225262 Ga0068852_1002252622 472
253 3300005618 Ga0068864_100021783 Ga0068864_1000217833 472
254 3300005843 Ga0068860_100007403 Ga0068860_1000074037 472
255 3300013100 Ga0157373_10026873 Ga0157373_100268734 472
256 3300013102 Ga0157371_10000759 Ga0157371_100007596 472
257 3300013102 Ga0157371_10001126 Ga0157371_1000112623 472
258 3300013102 Ga0157371_10008605 Ga0157371_100086056 472
259 3300013102 Ga0157371_10075939 Ga0157371_100759392 472
260 3300013102 Ga0157371_10126808 Ga0157371_101268081 472
261 3300013104 Ga0157370_10001642 Ga0157370_1000164219 472
262 3300013105 Ga0157369_10010659 Ga0157369_100106598 472
263 3300013296 Ga0157374_10100433 Ga0157374_101004332 472
264 3300013297 Ga0157378_10151933 Ga0157378_101519332 472
265 3300013307 Ga0157372_10054901 Ga0157372_100549013 472
266 3300014969 Ga0157376_10083945 Ga0157376_100839452 472
267 3300025909 Ga0207705_10012644 Ga0207705_100126442 472
268 3300025909 Ga0207705_10137561 Ga0207705_101375612 472
269 3300025917 Ga0207660_10131604 Ga0207660_101316042 472
270 3300025919 Ga0207657_10069046 Ga0207657_100690462 472
271 3300025986 Ga0207658_10173164 Ga0207658_101731642 472
272 3300026116 Ga0207674_10135807 Ga0207674_101358072 472
273 3300028380 Ga0268265_10054259 Ga0268265_100542593 472
274 3300037312 Ga0395899_0086383 Ga0395899_0086383_766_2205 472
275 3300037466 Ga0395898_0031584 Ga0395898_0031584_2804_4396 472
276 3300038443 Ga0395901_0001659 Ga0395901_0001659_18190_19782 472
277 3300049571 Ga0501034_0128100 Ga0501034_0128100_423_1847 472
278 3300049586 Ga0501070_0028679 Ga0501070_0028679_2101_3525 472
279 3300001979 JGI24740J21852_10011909 JGI24740J21852_100119092 473
280 3300003354 JGI25160J50197_1000193 JGI25160J50197_100019323 473
281 3300005458 Ga0070681_10058505 Ga0070681_100585052 473
282 3300006353 Ga0075370_10066009 Ga0075370_100660092 473
283 3300009147 Ga0114129_10001087 Ga0114129_1000108721 473
284 3300025302 Ga0207426_1000026 Ga0207426_1000026236 473
285 3300025914 Ga0207671_10026535 Ga0207671_100265352 473

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

232

519

0.99

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

58

227

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.963 5 468
2zyg-assembly1.cif.gz_A apo-form of dimeric 6-phosphogluconate dehydrogenase 0.9624 5 468
7cb2-assembly1.cif.gz_A the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus 0.9587 5 469
3fwn-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate 0.9583 4 468
2zya-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate 0.9576 4 469
ID Description Score Start End Superfamily
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9787 5 181 3.40.50.720
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9723 5 182 3.40.50.720
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9714 7 185 3.40.50.720
af_Q9FFR3_186_447_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9706 184 434 1.10.1040.10
2w90B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9642 184 433 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A536CT49-F1-model_v4 NADP-dependent phosphogluconate dehydrogenase 0.9981 73 159 GO:0004616
GO:0050661
AF-A0A5C8M9U3-F1-model_v4 NADP-dependent phosphogluconate dehydrogenase (EC 1.1.1.44) 0.9973 65 181 GO:0004616
GO:0050661
AF-A0A7S1UZH2-F1-model_v4 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) (EC 1.1.1.44) 0.9965 101 199 GO:0004616
GO:0006098
GO:0019521
GO:0050661
AF-A0A2E0BCB0-F1-model_v4 Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) 0.9949 5 185 GO:0004616
GO:0050661
AF-A0A2N0QKL0-F1-model_v4 NAD-binding 6-phosphogluconate dehydrogenase 0.9945 76 165 GO:0004616
GO:0050661

Feature Viewer

pLDDT pTM Quality
94.45 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map