F386922

General Info

Members Datasets Scaffolds Average Seq Length
285 133 285 278

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0079172|Ga0373933_0079172_167_1090
Length 298
Sequence MKSGGSPKRDGRPPAGRPRGQEQTLRGGSGIAGENRRNCEFQLLRYVPDALRNEYVHIGVILREQGSDKPAEVRFTRDWRRLRCLDPEADTALLEGMESELRRRFQEEPQGRLMRLLEESLSLNVQMTEPKAYLAESLPAGMEELMRLYVEPLRRERIPRLRGRAAIQATMRGEFERAGVWDLLRKQIAARDYTRPGDPLRIDLGYRPNGVIRMFHAVSLEPGVEMAKVLAFSRVEKAALELTAVIEPAAKIGATDEDPERLEMYRFGVETMEEHQIRVLTTSDMGRVADTARRELRV

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.51
Rhizosphere 96.14
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10239311 3300003323 Unclassified 2321
2 Ga0070658_10018244 3300005327 Bacteria 5616
3 Ga0070658_10025849 3300005327 Bacteria 4708
4 Ga0070683_100009070 3300005329 Bacteria 8488
5 Ga0070683_100015285 3300005329 Bacteria 6739
6 Ga0070683_100039768 3300005329 Bacteria 4320
7 Ga0070683_100173941 3300005329 Bacteria 2044
8 Ga0070670_100184295 3300005331 Bacteria 1812
9 Ga0068869_100002576 3300005334 Bacteria 10949
10 Ga0070666_10066254 3300005335 Bacteria 2450
11 Ga0070682_100117432 3300005337 Bacteria 1781
12 Ga0068868_100000969 3300005338 Bacteria 19517
13 Ga0068868_100078152 3300005338 Bacteria 2648
14 Ga0070660_100156193 3300005339 Unclassified 1836
15 Ga0070660_100201951 3300005339 Unclassified 1612
16 Ga0070661_100007332 3300005344 Bacteria 7609
17 Ga0070661_100163782 3300005344 Unclassified 1685
18 Ga0070661_100295677 3300005344 Bacteria 1259
19 Ga0070671_100001442 3300005355 Bacteria 17755
20 Ga0070671_100019563 3300005355 Bacteria 5513
21 Ga0070667_100017377 3300005367 Bacteria 5961
22 Ga0070714_100044629 3300005435 Bacteria 3753
23 Ga0070663_100106777 3300005455 Bacteria 2098
24 Ga0070663_100193147 3300005455 Bacteria 1585
25 Ga0070679_100134211 3300005530 Bacteria 2456
26 Ga0070684_100002349 3300005535 Bacteria 13949
27 Ga0070684_100018058 3300005535 Bacteria 5801
28 Ga0070684_100047179 3300005535 Bacteria 3733
29 Ga0068853_100000264 3300005539 Bacteria 36901
30 Ga0068853_100195008 3300005539 Bacteria 1841
31 Ga0068853_100603535 3300005539 Bacteria 1042
32 Ga0070665_100136277 3300005548 Unclassified 2458
33 Ga0070665_100242868 3300005548 Bacteria 1801
34 Ga0068855_100000216 3300005563 Bacteria 73411
35 Ga0068855_100002826 3300005563 Bacteria 21376
36 Ga0068855_100049052 3300005563 Bacteria 4981
37 Ga0068855_100114924 3300005563 Bacteria 3086
38 Ga0068855_100352873 3300005563 Bacteria 1620
39 Ga0070664_100053183 3300005564 Bacteria 3432
40 Ga0068857_100001621 3300005577 Bacteria 18069
41 Ga0068857_100134491 3300005577 Bacteria 2232
42 Ga0068856_100001136 3300005614 Bacteria 27971
43 Ga0068856_100002530 3300005614 Bacteria 18841
44 Ga0068856_100016234 3300005614 Bacteria 7204
45 Ga0068856_100431457 3300005614 Bacteria 1338
46 Ga0068852_100000042 3300005616 Bacteria 91949
47 Ga0068852_100000046 3300005616 Bacteria 87937
48 Ga0068852_100003508 3300005616 Bacteria 10967
49 Ga0068852_100172213 3300005616 Bacteria 2030
50 Ga0068852_100253724 3300005616 Bacteria 1686
51 Ga0068859_100047822 3300005617 Bacteria 4298
52 Ga0068859_100312743 3300005617 Bacteria 1664
53 Ga0068864_100001867 3300005618 Bacteria 17293
54 Ga0068851_10000417 3300005834 Bacteria 19079
55 Ga0068851_10049282 3300005834 Unclassified 2136
56 Ga0068851_10129653 3300005834 Unclassified 1363
57 Ga0068863_100012154 3300005841 Bacteria 8316
58 Ga0068858_100190558 3300005842 Bacteria 1937
59 Ga0068860_100000752 3300005843 Bacteria 36823
60 Ga0081540_1020461 3300005983 Bacteria 3978
61 Ga0070717_10666880 3300006028 Bacteria 944
62 Ga0097621_100006478 3300006237 Bacteria 8315
63 Ga0097621_100130315 3300006237 Unclassified 2140
64 Ga0068871_100001110 3300006358 Bacteria 18057
65 Ga0068871_100187297 3300006358 Unclassified 1781
66 Ga0075436_100061221 3300006914 Unclassified 2600
67 Ga0075436_100075394 3300006914 Bacteria 2336
68 Ga0097620_100047822 3300006931 Bacteria 4298
69 Ga0097620_100312777 3300006931 Bacteria 1664
70 Ga0105240_10000065 3300009093 Bacteria 213992
71 Ga0105240_10001829 3300009093 Bacteria 35656
72 Ga0105240_10003478 3300009093 Bacteria 24431
73 Ga0105240_10004557 3300009093 Bacteria 21033
74 Ga0105240_10004719 3300009093 Bacteria 20569
75 Ga0105240_10094073 3300009093 Unclassified 3657
76 Ga0105240_10119834 3300009093 Unclassified 3169
77 Ga0105245_10031427 3300009098 Bacteria 4699
78 Ga0105245_10188330 3300009098 Bacteria 1975
79 Ga0105247_10001468 3300009101 Bacteria 16988
80 Ga0105247_10060891 3300009101 Unclassified 2340
81 Ga0105241_10000278 3300009174 Bacteria 38174
82 Ga0105241_10120369 3300009174 Bacteria 2113
83 Ga0105241_10153569 3300009174 Unclassified 1886
84 Ga0105248_10062069 3300009177 Unclassified 4197
85 Ga0105248_10324769 3300009177 Bacteria 1733
86 Ga0105248_10378559 3300009177 Unclassified 1594
87 Ga0105237_10002432 3300009545 Bacteria 23119
88 Ga0105237_10109958 3300009545 Unclassified 2748
89 Ga0105237_10150388 3300009545 Bacteria 2324
90 Ga0105237_10163790 3300009545 Unclassified 2222
91 Ga0105238_10000530 3300009551 Bacteria 39934
92 Ga0105238_10000634 3300009551 Bacteria 37020
93 Ga0105238_10009229 3300009551 Bacteria 9871
94 Ga0105238_10039293 3300009551 Bacteria 4798
95 Ga0105238_10084029 3300009551 Unclassified 3172
96 Ga0105238_10120761 3300009551 Unclassified 2600
97 Ga0105239_10001165 3300010375 Bacteria 36151
98 Ga0105239_10003808 3300010375 Bacteria 18348
99 Ga0105239_10068057 3300010375 Bacteria 3913
100 Ga0105239_10242234 3300010375 Unclassified 2024
101 Ga0105239_10309384 3300010375 Bacteria 1780
102 Ga0105246_10127362 3300011119 Bacteria 1896
103 Ga0157373_10290672 3300013100 Unclassified 1159
104 Ga0157373_10352740 3300013100 Unclassified 1050
105 Ga0157373_10394991 3300013100 Unclassified 990
106 Ga0157371_10218351 3300013102 Bacteria 1369
107 Ga0157370_10000009 3300013104 Bacteria 231270
108 Ga0157369_10000022 3300013105 Bacteria 233081
109 Ga0157369_10000794 3300013105 Bacteria 40368
110 Ga0157369_10001128 3300013105 Bacteria 33404
111 Ga0157369_10035206 3300013105 Bacteria 5491
112 Ga0157369_10055460 3300013105 Unclassified 4278
113 Ga0157369_10082109 3300013105 Bacteria 3449
114 Ga0157369_10116976 3300013105 Bacteria 2830
115 Ga0157369_10125853 3300013105 Bacteria 2717
116 Ga0157374_10004084 3300013296 Bacteria 12255
117 Ga0157374_10007308 3300013296 Bacteria 9417
118 Ga0157374_10285560 3300013296 Bacteria 1630
119 Ga0157374_10286135 3300013296 Bacteria 1628
120 Ga0157378_10005531 3300013297 Bacteria 11065
121 Ga0157378_10044007 3300013297 Unclassified 3963
122 Ga0163162_10004126 3300013306 Bacteria 13944
123 Ga0157372_10000192 3300013307 Bacteria 67358
124 Ga0157372_10005792 3300013307 Bacteria 13158
125 Ga0157372_10038369 3300013307 Bacteria 5286
126 Ga0157372_10060937 3300013307 Bacteria 4223
127 Ga0157372_10099749 3300013307 Unclassified 3313
128 Ga0157372_10110683 3300013307 Unclassified 3146
129 Ga0157372_10135702 3300013307 Unclassified 2833
130 Ga0157372_10228918 3300013307 Bacteria 2155
131 Ga0157372_10689861 3300013307 Bacteria 1189
132 Ga0157375_10059676 3300013308 Bacteria 3780
133 Ga0157375_10106039 3300013308 Unclassified 2902
134 Ga0157375_10336010 3300013308 Bacteria 1676
135 Ga0163163_10009609 3300014325 Bacteria 8643
136 Ga0182008_10016877 3300014497 Unclassified 3788
137 Ga0182008_10167501 3300014497 Unclassified 1108
138 Ga0157379_10001698 3300014968 Bacteria 18216
139 Ga0157379_10100725 3300014968 Unclassified 2593
140 Ga0157376_10168670 3300014969 Bacteria 1991
141 Ga0157376_10420751 3300014969 Bacteria 1296
142 Ga0213872_10006755 3300021361 Bacteria 5713
143 Ga0213872_10009022 3300021361 Bacteria 4794
144 Ga0213872_10045590 3300021361 Bacteria 1995
145 Ga0207656_10049063 3300025321 Bacteria 1819
146 Ga0207710_10002527 3300025900 Bacteria 8459
147 Ga0207710_10177350 3300025900 Bacteria 1044
148 Ga0207647_10133044 3300025904 Bacteria 1461
149 Ga0207705_10032363 3300025909 Bacteria 3737
150 Ga0207705_10034218 3300025909 Unclassified 3633
151 Ga0207654_10001279 3300025911 Bacteria 13388
152 Ga0207654_10002087 3300025911 Bacteria 10237
153 Ga0207707_10166418 3300025912 Unclassified 1927
154 Ga0207707_10193393 3300025912 Unclassified 1774
155 Ga0207695_10000052 3300025913 Bacteria 398089
156 Ga0207695_10000174 3300025913 Bacteria 189006
157 Ga0207695_10000332 3300025913 Bacteria 112161
158 Ga0207695_10001747 3300025913 Bacteria 34511
159 Ga0207695_10024562 3300025913 Bacteria 6774
160 Ga0207695_10053441 3300025913 Bacteria 4225
161 Ga0207695_10241784 3300025913 Bacteria 1706
162 Ga0207671_10000783 3300025914 Bacteria 40292
163 Ga0207671_10000867 3300025914 Bacteria 38284
164 Ga0207671_10308119 3300025914 Unclassified 1251
165 Ga0207649_10246795 3300025920 Bacteria 1284
166 Ga0207694_10000043 3300025924 Bacteria 171251
167 Ga0207694_10000362 3300025924 Bacteria 42697
168 Ga0207694_10008726 3300025924 Bacteria 7650
169 Ga0207694_10549486 3300025924 Bacteria 969
170 Ga0207650_10157811 3300025925 Bacteria 1795
171 Ga0207687_10006651 3300025927 Bacteria 7625
172 Ga0207687_10212044 3300025927 Bacteria 1520
173 Ga0207644_10066485 3300025931 Bacteria 2625
174 Ga0207644_10070878 3300025931 Bacteria 2548
175 Ga0207711_10022155 3300025941 Bacteria 5311
176 Ga0207711_10047634 3300025941 Unclassified 3666
177 Ga0207711_10139997 3300025941 Unclassified 2176
178 Ga0207689_10008489 3300025942 Bacteria 8951
179 Ga0207661_10024442 3300025944 Bacteria 4580
180 Ga0207661_10025255 3300025944 Bacteria 4514
181 Ga0207661_10244506 3300025944 Unclassified 1593
182 Ga0207679_10039962 3300025945 Bacteria 3354
183 Ga0207679_10290603 3300025945 Unclassified 1405
184 Ga0207667_10000878 3300025949 Bacteria 38401
185 Ga0207667_10007819 3300025949 Bacteria 12777
186 Ga0207667_10037863 3300025949 Bacteria 5154
187 Ga0207667_10122509 3300025949 Bacteria 2679
188 Ga0207667_10123867 3300025949 Unclassified 2663
189 Ga0207640_10239226 3300025981 Unclassified 1402
190 Ga0207658_10021420 3300025986 Unclassified 4487
191 Ga0207677_10003382 3300026023 Bacteria 8444
192 Ga0207677_10154888 3300026023 Bacteria 1773
193 Ga0207703_10196631 3300026035 Bacteria 1789
194 Ga0207639_10000270 3300026041 Bacteria 37095
195 Ga0207639_10058238 3300026041 Bacteria 2971
196 Ga0207639_10198894 3300026041 Unclassified 1717
197 Ga0207678_10047401 3300026067 Bacteria 3716
198 Ga0207702_10025860 3300026078 Bacteria 4872
199 Ga0207702_10080474 3300026078 Bacteria 2826
200 Ga0207641_10003667 3300026088 Bacteria 13526
201 Ga0207641_10161136 3300026088 Unclassified 2040
202 Ga0207676_10004144 3300026095 Bacteria 10238
203 Ga0207674_10003928 3300026116 Bacteria 18098
204 Ga0207674_10160760 3300026116 Bacteria 2201
205 Ga0207674_10180785 3300026116 Bacteria 2061
206 Ga0207698_10000007 3300026142 Bacteria 289457
207 Ga0207698_10000055 3300026142 Bacteria 82550
208 Ga0207698_10291028 3300026142 Bacteria 1516
209 Ga0268266_10105256 3300028379 Unclassified 2492
210 Ga0268264_10007418 3300028381 Bacteria 9157
211 Ga0265336_10001188 3300028666 Bacteria 12380
212 Ga0265338_10002934 3300028800 Bacteria 24743
213 Ga0265338_10006350 3300028800 Bacteria 15101
214 Ga0265338_10021993 3300028800 Bacteria 6626
215 Ga0265330_10045888 3300031235 Unclassified 1926
216 Ga0265328_10003877 3300031239 Bacteria 6578
217 Ga0265325_10129148 3300031241 Bacteria 1211
218 Ga0265340_10047295 3300031247 Unclassified 2095
219 Ga0265340_10069829 3300031247 Bacteria 1667
220 Ga0265339_10000012 3300031249 Bacteria 203469
221 Ga0265339_10002669 3300031249 Bacteria 12698
222 Ga0265339_10013326 3300031249 Bacteria 4986
223 Ga0265339_10017107 3300031249 Bacteria 4301
224 Ga0265339_10096495 3300031249 Unclassified 1543
225 Ga0265316_10003043 3300031344 Bacteria 17118
226 Ga0265316_10026937 3300031344 Bacteria 4771
227 Ga0265316_10029115 3300031344 Bacteria 4546
228 Ga0265316_10032685 3300031344 Bacteria 4244
229 Ga0265316_10153400 3300031344 Bacteria 1725
230 Ga0265316_10156476 3300031344 Bacteria 1705
231 Ga0265316_10232521 3300031344 Bacteria 1357
232 Ga0307408_100320494 3300031548 Bacteria 1305
233 Ga0265314_10000139 3300031711 Bacteria 108861
234 Ga0265314_10005834 3300031711 Bacteria 11026
235 Ga0265314_10020798 3300031711 Bacteria 5060
236 Ga0265314_10030474 3300031711 Unclassified 3992
237 Ga0265342_10001091 3300031712 Bacteria 26110
238 Ga0265342_10081787 3300031712 Bacteria 1864
239 Ga0265342_10104216 3300031712 Bacteria 1612
240 Ga0307410_10100837 3300031852 Bacteria 2069
241 Ga0307412_10389506 3300031911 Bacteria 1131
242 Ga0307409_100320584 3300031995 Bacteria 1450
243 Ga0307416_100022055 3300032002 Bacteria 4587
244 Ga0307411_10016640 3300032005 Bacteria 4166
245 Ga0373943_0247487 3300035170 Bacteria 1000
246 Ga0373946_0185591 3300035171 Bacteria 989
247 Ga0373933_0079172 3300035724 Bacteria 2012
248 Ga0373947_0026169 3300035725 Bacteria 3407
249 Ga0373937_0050671 3300036401 Bacteria 3803
250 Ga0395898_0500025 3300037466 Bacteria 1156
251 Ga0395905_0007130 3300037471 Bacteria 11173
252 Ga0395905_0013588 3300037471 Bacteria 7800
253 Ga0395905_0863547 3300037471 Bacteria 808
254 Ga0436360_1032925 3300039438 Unclassified 1233
255 Ga0436360_1216769 3300039438 Bacteria 7254
256 Ga0436361_0209176 3300039447 Bacteria 17603
257 Ga0436361_0218374 3300039447 Bacteria 14565
258 Ga0436361_0354935 3300039447 Bacteria 2408
259 Ga0436361_0359247 3300039447 Bacteria 1503
260 Ga0451577_0000054 3300042876 Bacteria 278798
261 Ga0453683_0035197 3300044673 Bacteria 3156
262 Ga0453683_0356318 3300044673 Unclassified 940
263 Ga0466961_0169223 3300044693 Bacteria 1359
264 Ga0466961_0236186 3300044693 Unclassified 1124
265 Ga0466963_0007135 3300044694 Bacteria 6659
266 Ga0453684_0000289 3300044712 Bacteria 215476
267 Ga0451576_0003702 3300045051 Bacteria 20675
268 Ga0466967_0000784 3300045976 Bacteria 16536
269 Ga0495659_0006177 3300046664 Unclassified 3786
270 Ga0495623_0131256 3300046679 Bacteria 1500
271 Ga0495669_0002713 3300046684 Bacteria 7255
272 Ga0495669_0049078 3300046684 Unclassified 1889
273 Ga0495602_0468105 3300048088 Bacteria 886
274 Ga0496100_0528853 3300048903 Unclassified 911
275 Ga0496102_0585100 3300048905 Unclassified 1039
276 Ga0496104_0021070 3300048907 Bacteria 5980
277 Ga0496105_0256192 3300048908 Bacteria 1416
278 Ga0496105_0312545 3300048908 Unclassified 1261
279 Ga0496107_0138740 3300048910 Bacteria 1797
280 Ga0496107_0486443 3300048910 Unclassified 916
281 Ga0496109_0185974 3300048912 Unclassified 1952
282 Ga0496115_0015984 3300048918 Bacteria 5706
283 Ga0496115_0189557 3300048918 Unclassified 1699
284 nmdc:mga08x19_49949_c1 3300050514 Bacteria 2683
285 nmdc:mga08x19_8338_c1 3300050514 Bacteria 6167

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0863547 Ga0395905_0863547_37_690 214
2 3300048088 Ga0495602_0468105 Ga0495602_0468105_73_786 237
3 3300048908 Ga0496105_0312545 Ga0496105_0312545_20_778 252
4 3300046664 Ga0495659_0006177 Ga0495659_0006177_1126_1941 258
5 3300046684 Ga0495669_0049078 Ga0495669_0049078_1021_1836 258
6 3300009177 Ga0105248_10062069 Ga0105248_100620693 260
7 3300013102 Ga0157371_10218351 Ga0157371_102183512 260
8 3300013307 Ga0157372_10110683 Ga0157372_101106832 260
9 3300013307 Ga0157372_10689861 Ga0157372_106898612 260
10 3300014968 Ga0157379_10100725 Ga0157379_101007253 260
11 3300021361 Ga0213872_10006755 Ga0213872_100067554 260
12 3300021361 Ga0213872_10009022 Ga0213872_100090224 260
13 3300025941 Ga0207711_10047634 Ga0207711_100476343 260
14 3300039447 Ga0436361_0209176 Ga0436361_0209176_9097_9879 260
15 3300005983 Ga0081540_1020461 Ga0081540_10204613 261
16 3300009093 Ga0105240_10004557 Ga0105240_100045575 261
17 3300009174 Ga0105241_10000278 Ga0105241_1000027826 261
18 3300009545 Ga0105237_10002432 Ga0105237_100024322 261
19 3300009551 Ga0105238_10000530 Ga0105238_1000053011 261
20 3300010375 Ga0105239_10003808 Ga0105239_100038085 261
21 3300013100 Ga0157373_10352740 Ga0157373_103527401 261
22 3300013105 Ga0157369_10001128 Ga0157369_1000112824 261
23 3300013307 Ga0157372_10005792 Ga0157372_100057925 261
24 3300025924 Ga0207694_10549486 Ga0207694_105494861 261
25 3300014497 Ga0182008_10167501 Ga0182008_101675011 262
26 3300037471 Ga0395905_0007130 Ga0395905_0007130_7426_8223 262
27 3300005435 Ga0070714_100044629 Ga0070714_1000446294 263
28 3300006914 Ga0075436_100061221 Ga0075436_1000612213 263
29 3300006914 Ga0075436_100075394 Ga0075436_1000753941 263
30 3300013105 Ga0157369_10000794 Ga0157369_1000079435 263
31 3300013307 Ga0157372_10038369 Ga0157372_100383693 263
32 3300037471 Ga0395905_0013588 Ga0395905_0013588_6808_7608 263
33 3300046684 Ga0495669_0002713 Ga0495669_0002713_2042_2869 263
34 3300050514 nmdc:mga08x19_49949_c1 nmdc:mga08x19_49949_c1_511_1308 263
35 3300050514 nmdc:mga08x19_8338_c1 nmdc:mga08x19_8338_c1_3863_4660 263
36 3300013307 Ga0157372_10135702 Ga0157372_101357023 264
37 3300048918 Ga0496115_0189557 Ga0496115_0189557_793_1653 264
38 3300005339 Ga0070660_100201951 Ga0070660_1002019512 265
39 3300005834 Ga0068851_10129653 Ga0068851_101296531 265
40 3300009093 Ga0105240_10094073 Ga0105240_100940732 265
41 3300009551 Ga0105238_10120761 Ga0105238_101207611 265
42 3300010375 Ga0105239_10242234 Ga0105239_102422342 265
43 3300013100 Ga0157373_10394991 Ga0157373_103949911 265
44 3300014497 Ga0182008_10016877 Ga0182008_100168772 265
45 3300025912 Ga0207707_10166418 Ga0207707_101664182 265
46 3300025945 Ga0207679_10290603 Ga0207679_102906032 265
47 3300048903 Ga0496100_0528853 Ga0496100_0528853_46_858 265
48 3300048910 Ga0496107_0486443 Ga0496107_0486443_60_872 265
49 3300048912 Ga0496109_0185974 Ga0496109_0185974_384_1196 265
50 3300035170 Ga0373943_0247487 Ga0373943_0247487_114_920 266
51 3300035171 Ga0373946_0185591 Ga0373946_0185591_34_840 266
52 3300035725 Ga0373947_0026169 Ga0373947_0026169_1787_2593 266
53 3300005344 Ga0070661_100163782 Ga0070661_1001637821 267
54 3300026088 Ga0207641_10161136 Ga0207641_101611362 267
55 3300031548 Ga0307408_100320494 Ga0307408_1003204941 268
56 3300031852 Ga0307410_10100837 Ga0307410_101008372 268
57 3300031911 Ga0307412_10389506 Ga0307412_103895061 268
58 3300031995 Ga0307409_100320584 Ga0307409_1003205841 268
59 3300032002 Ga0307416_100022055 Ga0307416_1000220552 268
60 3300032005 Ga0307411_10016640 Ga0307411_100166403 268
61 3300035724 Ga0373933_0079172 Ga0373933_0079172_167_1090 269
62 3300036401 Ga0373937_0050671 Ga0373937_0050671_1038_1961 269
63 3300042876 Ga0451577_0000054 Ga0451577_0000054_113755_114582 269
64 3300044673 Ga0453683_0035197 Ga0453683_0035197_1504_2331 269
65 3300044712 Ga0453684_0000289 Ga0453684_0000289_186092_186919 269
66 3300045051 Ga0451576_0003702 Ga0451576_0003702_11345_12172 269
67 3300013308 Ga0157375_10106039 Ga0157375_101060392 270
68 3300005530 Ga0070679_100134211 Ga0070679_1001342113 271
69 3300025912 Ga0207707_10193393 Ga0207707_101933932 271
70 3300037466 Ga0395898_0500025 Ga0395898_0500025_164_994 271
71 3300039438 Ga0436360_1032925 Ga0436360_1032925_102_917 271
72 3300039438 Ga0436360_1216769 Ga0436360_1216769_5931_6746 271
73 3300039447 Ga0436361_0218374 Ga0436361_0218374_5282_6097 271
74 3300028800 Ga0265338_10006350 Ga0265338_100063501 273
75 3300031249 Ga0265339_10002669 Ga0265339_100026693 273
76 3300031344 Ga0265316_10003043 Ga0265316_100030432 273
77 3300031711 Ga0265314_10005834 Ga0265314_100058342 273
78 3300044693 Ga0466961_0169223 Ga0466961_0169223_71_910 273
79 3300005329 Ga0070683_100015285 Ga0070683_1000152853 274
80 3300005535 Ga0070684_100018058 Ga0070684_1000180583 274
81 3300005563 Ga0068855_100049052 Ga0068855_1000490524 274
82 3300013105 Ga0157369_10125853 Ga0157369_101258532 274
83 3300013307 Ga0157372_10099749 Ga0157372_100997493 274
84 3300021361 Ga0213872_10045590 Ga0213872_100455902 274
85 3300025944 Ga0207661_10025255 Ga0207661_100252553 274
86 3300025949 Ga0207667_10122509 Ga0207667_101225092 274
87 3300039447 Ga0436361_0354935 Ga0436361_0354935_1486_2316 274
88 3300039447 Ga0436361_0359247 Ga0436361_0359247_447_1274 274
89 3300005329 Ga0070683_100173941 Ga0070683_1001739411 276
90 3300005535 Ga0070684_100047179 Ga0070684_1000471792 276
91 3300005563 Ga0068855_100000216 Ga0068855_10000021648 276
92 3300005577 Ga0068857_100134491 Ga0068857_1001344912 276
93 3300005616 Ga0068852_100000042 Ga0068852_10000004258 276
94 3300009093 Ga0105240_10000065 Ga0105240_10000065137 276
95 3300013100 Ga0157373_10290672 Ga0157373_102906721 276
96 3300013104 Ga0157370_10000009 Ga0157370_1000000943 276
97 3300013105 Ga0157369_10000022 Ga0157369_10000022154 276
98 3300013307 Ga0157372_10000192 Ga0157372_1000019214 276
99 3300025913 Ga0207695_10000052 Ga0207695_1000005245 276
100 3300025944 Ga0207661_10244506 Ga0207661_102445062 276
101 3300025949 Ga0207667_10007819 Ga0207667_100078198 276
102 3300026116 Ga0207674_10160760 Ga0207674_101607602 276
103 3300026142 Ga0207698_10000007 Ga0207698_1000000744 276
104 3300044694 Ga0466963_0007135 Ga0466963_0007135_3458_4288 276
105 3300045976 Ga0466967_0000784 Ga0466967_0000784_8878_9708 276
106 3300005327 Ga0070658_10025849 Ga0070658_100258491 277
107 3300005329 Ga0070683_100039768 Ga0070683_1000397682 277
108 3300005344 Ga0070661_100007332 Ga0070661_1000073324 277
109 3300005455 Ga0070663_100193147 Ga0070663_1001931472 277
110 3300005548 Ga0070665_100136277 Ga0070665_1001362773 277
111 3300005563 Ga0068855_100114924 Ga0068855_1001149242 277
112 3300005614 Ga0068856_100016234 Ga0068856_1000162344 277
113 3300005614 Ga0068856_100431457 Ga0068856_1004314572 277
114 3300005616 Ga0068852_100003508 Ga0068852_1000035083 277
115 3300005834 Ga0068851_10049282 Ga0068851_100492823 277
116 3300009093 Ga0105240_10119834 Ga0105240_101198342 277
117 3300009174 Ga0105241_10153569 Ga0105241_101535692 277
118 3300009551 Ga0105238_10039293 Ga0105238_100392932 277
119 3300009551 Ga0105238_10084029 Ga0105238_100840293 277
120 3300013105 Ga0157369_10035206 Ga0157369_100352062 277
121 3300025909 Ga0207705_10032363 Ga0207705_100323631 277
122 3300025913 Ga0207695_10241784 Ga0207695_102417842 277
123 3300025914 Ga0207671_10308119 Ga0207671_103081191 277
124 3300025949 Ga0207667_10037863 Ga0207667_100378633 277
125 3300025949 Ga0207667_10123867 Ga0207667_101238673 277
126 3300026041 Ga0207639_10058238 Ga0207639_100582381 277
127 3300026078 Ga0207702_10025860 Ga0207702_100258604 277
128 3300026116 Ga0207674_10180785 Ga0207674_101807852 277
129 3300028379 Ga0268266_10105256 Ga0268266_101052562 277
130 3300028800 Ga0265338_10002934 Ga0265338_100029346 277
131 3300031249 Ga0265339_10017107 Ga0265339_100171073 277
132 3300031711 Ga0265314_10020798 Ga0265314_100207982 277
133 3300005563 Ga0068855_100352873 Ga0068855_1003528732 278
134 3300006028 Ga0070717_10666880 Ga0070717_106668801 278
135 3300013105 Ga0157369_10055460 Ga0157369_100554603 278
136 3300013296 Ga0157374_10007308 Ga0157374_1000730810 278
137 3300025909 Ga0207705_10034218 Ga0207705_100342183 278
138 3300028666 Ga0265336_10001188 Ga0265336_100011886 278
139 3300028800 Ga0265338_10021993 Ga0265338_100219934 278
140 3300031235 Ga0265330_10045888 Ga0265330_100458881 278
141 3300031241 Ga0265325_10129148 Ga0265325_101291482 278
142 3300031247 Ga0265340_10069829 Ga0265340_100698291 278
143 3300031249 Ga0265339_10013326 Ga0265339_100133262 278
144 3300031249 Ga0265339_10096495 Ga0265339_100964952 278
145 3300031344 Ga0265316_10026937 Ga0265316_100269372 278
146 3300031344 Ga0265316_10153400 Ga0265316_101534002 278
147 3300031344 Ga0265316_10156476 Ga0265316_101564761 278
148 3300031344 Ga0265316_10232521 Ga0265316_102325212 278
149 3300031711 Ga0265314_10000139 Ga0265314_1000013989 278
150 3300031711 Ga0265314_10030474 Ga0265314_100304742 278
151 3300031712 Ga0265342_10104216 Ga0265342_101042162 278
152 3300044673 Ga0453683_0356318 Ga0453683_0356318_16_852 278
153 3300044693 Ga0466961_0236186 Ga0466961_0236186_48_911 281
154 3300003323 rootH1_10239311 rootH1_102393112 282
155 3300005327 Ga0070658_10018244 Ga0070658_100182443 282
156 3300005329 Ga0070683_100009070 Ga0070683_1000090704 282
157 3300005331 Ga0070670_100184295 Ga0070670_1001842952 282
158 3300005334 Ga0068869_100002576 Ga0068869_10000257612 282
159 3300005335 Ga0070666_10066254 Ga0070666_100662542 282
160 3300005337 Ga0070682_100117432 Ga0070682_1001174322 282
161 3300005338 Ga0068868_100000969 Ga0068868_10000096910 282
162 3300005338 Ga0068868_100078152 Ga0068868_1000781522 282
163 3300005339 Ga0070660_100156193 Ga0070660_1001561931 282
164 3300005344 Ga0070661_100295677 Ga0070661_1002956772 282
165 3300005355 Ga0070671_100001442 Ga0070671_10000144215 282
166 3300005355 Ga0070671_100019563 Ga0070671_1000195632 282
167 3300005367 Ga0070667_100017377 Ga0070667_1000173772 282
168 3300005455 Ga0070663_100106777 Ga0070663_1001067772 282
169 3300005535 Ga0070684_100002349 Ga0070684_1000023497 282
170 3300005539 Ga0068853_100000264 Ga0068853_1000002648 282
171 3300005539 Ga0068853_100195008 Ga0068853_1001950081 282
172 3300005539 Ga0068853_100603535 Ga0068853_1006035351 282
173 3300005548 Ga0070665_100242868 Ga0070665_1002428682 282
174 3300005563 Ga0068855_100002826 Ga0068855_10000282614 282
175 3300005564 Ga0070664_100053183 Ga0070664_1000531834 282
176 3300005577 Ga0068857_100001621 Ga0068857_1000016212 282
177 3300005614 Ga0068856_100001136 Ga0068856_1000011363 282
178 3300005614 Ga0068856_100002530 Ga0068856_1000025304 282
179 3300005616 Ga0068852_100000046 Ga0068852_10000004628 282
180 3300005616 Ga0068852_100172213 Ga0068852_1001722131 282
181 3300005616 Ga0068852_100253724 Ga0068852_1002537242 282
182 3300005617 Ga0068859_100047822 Ga0068859_1000478221 282
183 3300005617 Ga0068859_100312743 Ga0068859_1003127431 282
184 3300005618 Ga0068864_100001867 Ga0068864_1000018679 282
185 3300005834 Ga0068851_10000417 Ga0068851_100004172 282
186 3300005841 Ga0068863_100012154 Ga0068863_1000121544 282
187 3300005842 Ga0068858_100190558 Ga0068858_1001905582 282
188 3300005843 Ga0068860_100000752 Ga0068860_10000075226 282
189 3300006237 Ga0097621_100006478 Ga0097621_1000064784 282
190 3300006237 Ga0097621_100130315 Ga0097621_1001303152 282
191 3300006358 Ga0068871_100001110 Ga0068871_10000111011 282
192 3300006358 Ga0068871_100187297 Ga0068871_1001872972 282
193 3300006931 Ga0097620_100047822 Ga0097620_1000478221 282
194 3300006931 Ga0097620_100312777 Ga0097620_1003127772 282
195 3300009093 Ga0105240_10001829 Ga0105240_100018292 282
196 3300009093 Ga0105240_10003478 Ga0105240_1000347821 282
197 3300009093 Ga0105240_10004719 Ga0105240_1000471912 282
198 3300009098 Ga0105245_10031427 Ga0105245_100314276 282
199 3300009098 Ga0105245_10188330 Ga0105245_101883303 282
200 3300009101 Ga0105247_10001468 Ga0105247_100014681 282
201 3300009101 Ga0105247_10060891 Ga0105247_100608912 282
202 3300009174 Ga0105241_10120369 Ga0105241_101203691 282
203 3300009177 Ga0105248_10324769 Ga0105248_103247692 282
204 3300009177 Ga0105248_10378559 Ga0105248_103785592 282
205 3300009545 Ga0105237_10109958 Ga0105237_101099583 282
206 3300009545 Ga0105237_10150388 Ga0105237_101503882 282
207 3300009545 Ga0105237_10163790 Ga0105237_101637902 282
208 3300009551 Ga0105238_10000634 Ga0105238_1000063416 282
209 3300009551 Ga0105238_10009229 Ga0105238_100092294 282
210 3300010375 Ga0105239_10001165 Ga0105239_1000116535 282
211 3300010375 Ga0105239_10068057 Ga0105239_100680571 282
212 3300010375 Ga0105239_10309384 Ga0105239_103093842 282
213 3300011119 Ga0105246_10127362 Ga0105246_101273621 282
214 3300013105 Ga0157369_10082109 Ga0157369_100821093 282
215 3300013105 Ga0157369_10116976 Ga0157369_101169763 282
216 3300013296 Ga0157374_10004084 Ga0157374_100040844 282
217 3300013296 Ga0157374_10285560 Ga0157374_102855601 282
218 3300013296 Ga0157374_10286135 Ga0157374_102861351 282
219 3300013297 Ga0157378_10005531 Ga0157378_1000553110 282
220 3300013297 Ga0157378_10044007 Ga0157378_100440072 282
221 3300013306 Ga0163162_10004126 Ga0163162_100041266 282
222 3300013307 Ga0157372_10060937 Ga0157372_100609373 282
223 3300013307 Ga0157372_10228918 Ga0157372_102289182 282
224 3300013308 Ga0157375_10059676 Ga0157375_100596764 282
225 3300013308 Ga0157375_10336010 Ga0157375_103360101 282
226 3300014325 Ga0163163_10009609 Ga0163163_100096094 282
227 3300014968 Ga0157379_10001698 Ga0157379_100016989 282
228 3300014969 Ga0157376_10168670 Ga0157376_101686702 282
229 3300014969 Ga0157376_10420751 Ga0157376_104207511 282
230 3300025321 Ga0207656_10049063 Ga0207656_100490632 282
231 3300025900 Ga0207710_10002527 Ga0207710_100025271 282
232 3300025900 Ga0207710_10177350 Ga0207710_101773502 282
233 3300025904 Ga0207647_10133044 Ga0207647_101330441 282
234 3300025911 Ga0207654_10001279 Ga0207654_100012795 282
235 3300025911 Ga0207654_10002087 Ga0207654_100020875 282
236 3300025913 Ga0207695_10000174 Ga0207695_10000174107 282
237 3300025913 Ga0207695_10000332 Ga0207695_1000033283 282
238 3300025913 Ga0207695_10001747 Ga0207695_1000174722 282
239 3300025913 Ga0207695_10024562 Ga0207695_100245624 282
240 3300025913 Ga0207695_10053441 Ga0207695_100534414 282
241 3300025914 Ga0207671_10000783 Ga0207671_100007838 282
242 3300025914 Ga0207671_10000867 Ga0207671_100008672 282
243 3300025920 Ga0207649_10246795 Ga0207649_102467952 282
244 3300025924 Ga0207694_10000043 Ga0207694_100000434 282
245 3300025924 Ga0207694_10000362 Ga0207694_1000036211 282
246 3300025924 Ga0207694_10008726 Ga0207694_100087265 282
247 3300025925 Ga0207650_10157811 Ga0207650_101578112 282
248 3300025927 Ga0207687_10006651 Ga0207687_100066514 282
249 3300025927 Ga0207687_10212044 Ga0207687_102120442 282
250 3300025931 Ga0207644_10066485 Ga0207644_100664854 282
251 3300025931 Ga0207644_10070878 Ga0207644_100708781 282
252 3300025941 Ga0207711_10022155 Ga0207711_100221552 282
253 3300025941 Ga0207711_10139997 Ga0207711_101399974 282
254 3300025942 Ga0207689_10008489 Ga0207689_100084891 282
255 3300025944 Ga0207661_10024442 Ga0207661_100244422 282
256 3300025945 Ga0207679_10039962 Ga0207679_100399622 282
257 3300025949 Ga0207667_10000878 Ga0207667_1000087822 282
258 3300025981 Ga0207640_10239226 Ga0207640_102392261 282
259 3300025986 Ga0207658_10021420 Ga0207658_100214202 282
260 3300026023 Ga0207677_10003382 Ga0207677_100033821 282
261 3300026023 Ga0207677_10154888 Ga0207677_101548881 282
262 3300026035 Ga0207703_10196631 Ga0207703_101966312 282
263 3300026041 Ga0207639_10000270 Ga0207639_1000027022 282
264 3300026041 Ga0207639_10198894 Ga0207639_101988942 282
265 3300026067 Ga0207678_10047401 Ga0207678_100474013 282
266 3300026078 Ga0207702_10080474 Ga0207702_100804741 282
267 3300026088 Ga0207641_10003667 Ga0207641_100036677 282
268 3300026095 Ga0207676_10004144 Ga0207676_100041441 282
269 3300026116 Ga0207674_10003928 Ga0207674_100039289 282
270 3300026142 Ga0207698_10000055 Ga0207698_1000005544 282
271 3300026142 Ga0207698_10291028 Ga0207698_102910282 282
272 3300028381 Ga0268264_10007418 Ga0268264_100074185 282
273 3300031239 Ga0265328_10003877 Ga0265328_100038773 282
274 3300031247 Ga0265340_10047295 Ga0265340_100472952 282
275 3300031249 Ga0265339_10000012 Ga0265339_100000121 282
276 3300031344 Ga0265316_10029115 Ga0265316_100291154 282
277 3300031344 Ga0265316_10032685 Ga0265316_100326852 282
278 3300031712 Ga0265342_10001091 Ga0265342_1000109123 282
279 3300031712 Ga0265342_10081787 Ga0265342_100817872 282
280 3300046679 Ga0495623_0131256 Ga0495623_0131256_295_1143 282
281 3300048905 Ga0496102_0585100 Ga0496102_0585100_28_879 282
282 3300048907 Ga0496104_0021070 Ga0496104_0021070_4379_5230 282
283 3300048908 Ga0496105_0256192 Ga0496105_0256192_442_1293 282
284 3300048910 Ga0496107_0138740 Ga0496107_0138740_650_1501 282
285 3300048918 Ga0496115_0015984 Ga0496115_0015984_3181_4032 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11236

DUF3037

Protein of unknown function (DUF3037)

41

150

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vmi-assembly1.cif.gz_AC structure of the human mitochondrial ribosome-ef-g1 complex (classiii) 0.68 175 232
7ut5-assembly2.cif.gz_B acinetobacter baumannii dihydroorotate dehydrogenase bound with inhibitor dsm186 0.6445 190 261
6hxj-assembly1.cif.gz_B structure of atp citrate lyase from chlorobium limicola in complex with citrate and coenzyme a. 0.6275 188 280
5tzn-assembly1.cif.gz_F structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6) 0.6251 7 55
7jj0-assembly2.cif.gz_C gtp-specific succinyl-coa synthetase complexed with mg-gmppcp 0.611 190 281
ID Description Score Start End Superfamily
af_Q2FXA8_166_254_3.40.50.10130 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6884 181 267 3.40.50.10130
5j1pA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Arenavirus RNA polymerase 0.6634 175 230 3.30.70.2640
af_Q9P7P2_5_174_3.30.900.10 Alpha Beta;2-Layer Sandwich;Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A;HORMA domain 0.6281 9 53 3.30.900.10
af_Q9NU22_5379_5545_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6258 199 265 3.40.50.410
af_Q8MPQ7_139_316_2.40.160.120 Mainly Beta;Beta Barrel;Porin; 0.6104 10 50 2.40.160.120
ID Description Score Start End GO Terms
AF-A0A2V9BZN2-F1-model_v4 Uncharacterized protein 0.8591 160 279
AF-A0A2V9VXY7-F1-model_v4 DUF3037 domain-containing protein 0.8506 1 112
AF-A0A2V9BZN2-F1-model_v4 Uncharacterized protein 0.8301 160 279
AF-A0A2V9VXY7-F1-model_v4 DUF3037 domain-containing protein 0.8092 1 112
AF-A0A2V9BZZ4-F1-model_v4 DUF3037 domain-containing protein 0.7754 1 109

Feature Viewer

pLDDT pTM Quality
86.88 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map