F386922
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 285 | 133 | 285 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300035724|Ga0373933_0079172|Ga0373933_0079172_167_1090 |
| Length | 298 |
| Sequence | MKSGGSPKRDGRPPAGRPRGQEQTLRGGSGIAGENRRNCEFQLLRYVPDALRNEYVHIGVILREQGSDKPAEVRFTRDWRRLRCLDPEADTALLEGMESELRRRFQEEPQGRLMRLLEESLSLNVQMTEPKAYLAESLPAGMEELMRLYVEPLRRERIPRLRGRAAIQATMRGEFERAGVWDLLRKQIAARDYTRPGDPLRIDLGYRPNGVIRMFHAVSLEPGVEMAKVLAFSRVEKAALELTAVIEPAAKIGATDEDPERLEMYRFGVETMEEHQIRVLTTSDMGRVADTARRELRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 59 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 91 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 95 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 96 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 106 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 107 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 108 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 109 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 114 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 115 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 116 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 117 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 120 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 121 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 122 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 128 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 129 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 130 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 131 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 133 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.51 |
| Rhizosphere | 96.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10239311 | 3300003323 | Unclassified | 2321 |
| 2 | Ga0070658_10018244 | 3300005327 | Bacteria | 5616 |
| 3 | Ga0070658_10025849 | 3300005327 | Bacteria | 4708 |
| 4 | Ga0070683_100009070 | 3300005329 | Bacteria | 8488 |
| 5 | Ga0070683_100015285 | 3300005329 | Bacteria | 6739 |
| 6 | Ga0070683_100039768 | 3300005329 | Bacteria | 4320 |
| 7 | Ga0070683_100173941 | 3300005329 | Bacteria | 2044 |
| 8 | Ga0070670_100184295 | 3300005331 | Bacteria | 1812 |
| 9 | Ga0068869_100002576 | 3300005334 | Bacteria | 10949 |
| 10 | Ga0070666_10066254 | 3300005335 | Bacteria | 2450 |
| 11 | Ga0070682_100117432 | 3300005337 | Bacteria | 1781 |
| 12 | Ga0068868_100000969 | 3300005338 | Bacteria | 19517 |
| 13 | Ga0068868_100078152 | 3300005338 | Bacteria | 2648 |
| 14 | Ga0070660_100156193 | 3300005339 | Unclassified | 1836 |
| 15 | Ga0070660_100201951 | 3300005339 | Unclassified | 1612 |
| 16 | Ga0070661_100007332 | 3300005344 | Bacteria | 7609 |
| 17 | Ga0070661_100163782 | 3300005344 | Unclassified | 1685 |
| 18 | Ga0070661_100295677 | 3300005344 | Bacteria | 1259 |
| 19 | Ga0070671_100001442 | 3300005355 | Bacteria | 17755 |
| 20 | Ga0070671_100019563 | 3300005355 | Bacteria | 5513 |
| 21 | Ga0070667_100017377 | 3300005367 | Bacteria | 5961 |
| 22 | Ga0070714_100044629 | 3300005435 | Bacteria | 3753 |
| 23 | Ga0070663_100106777 | 3300005455 | Bacteria | 2098 |
| 24 | Ga0070663_100193147 | 3300005455 | Bacteria | 1585 |
| 25 | Ga0070679_100134211 | 3300005530 | Bacteria | 2456 |
| 26 | Ga0070684_100002349 | 3300005535 | Bacteria | 13949 |
| 27 | Ga0070684_100018058 | 3300005535 | Bacteria | 5801 |
| 28 | Ga0070684_100047179 | 3300005535 | Bacteria | 3733 |
| 29 | Ga0068853_100000264 | 3300005539 | Bacteria | 36901 |
| 30 | Ga0068853_100195008 | 3300005539 | Bacteria | 1841 |
| 31 | Ga0068853_100603535 | 3300005539 | Bacteria | 1042 |
| 32 | Ga0070665_100136277 | 3300005548 | Unclassified | 2458 |
| 33 | Ga0070665_100242868 | 3300005548 | Bacteria | 1801 |
| 34 | Ga0068855_100000216 | 3300005563 | Bacteria | 73411 |
| 35 | Ga0068855_100002826 | 3300005563 | Bacteria | 21376 |
| 36 | Ga0068855_100049052 | 3300005563 | Bacteria | 4981 |
| 37 | Ga0068855_100114924 | 3300005563 | Bacteria | 3086 |
| 38 | Ga0068855_100352873 | 3300005563 | Bacteria | 1620 |
| 39 | Ga0070664_100053183 | 3300005564 | Bacteria | 3432 |
| 40 | Ga0068857_100001621 | 3300005577 | Bacteria | 18069 |
| 41 | Ga0068857_100134491 | 3300005577 | Bacteria | 2232 |
| 42 | Ga0068856_100001136 | 3300005614 | Bacteria | 27971 |
| 43 | Ga0068856_100002530 | 3300005614 | Bacteria | 18841 |
| 44 | Ga0068856_100016234 | 3300005614 | Bacteria | 7204 |
| 45 | Ga0068856_100431457 | 3300005614 | Bacteria | 1338 |
| 46 | Ga0068852_100000042 | 3300005616 | Bacteria | 91949 |
| 47 | Ga0068852_100000046 | 3300005616 | Bacteria | 87937 |
| 48 | Ga0068852_100003508 | 3300005616 | Bacteria | 10967 |
| 49 | Ga0068852_100172213 | 3300005616 | Bacteria | 2030 |
| 50 | Ga0068852_100253724 | 3300005616 | Bacteria | 1686 |
| 51 | Ga0068859_100047822 | 3300005617 | Bacteria | 4298 |
| 52 | Ga0068859_100312743 | 3300005617 | Bacteria | 1664 |
| 53 | Ga0068864_100001867 | 3300005618 | Bacteria | 17293 |
| 54 | Ga0068851_10000417 | 3300005834 | Bacteria | 19079 |
| 55 | Ga0068851_10049282 | 3300005834 | Unclassified | 2136 |
| 56 | Ga0068851_10129653 | 3300005834 | Unclassified | 1363 |
| 57 | Ga0068863_100012154 | 3300005841 | Bacteria | 8316 |
| 58 | Ga0068858_100190558 | 3300005842 | Bacteria | 1937 |
| 59 | Ga0068860_100000752 | 3300005843 | Bacteria | 36823 |
| 60 | Ga0081540_1020461 | 3300005983 | Bacteria | 3978 |
| 61 | Ga0070717_10666880 | 3300006028 | Bacteria | 944 |
| 62 | Ga0097621_100006478 | 3300006237 | Bacteria | 8315 |
| 63 | Ga0097621_100130315 | 3300006237 | Unclassified | 2140 |
| 64 | Ga0068871_100001110 | 3300006358 | Bacteria | 18057 |
| 65 | Ga0068871_100187297 | 3300006358 | Unclassified | 1781 |
| 66 | Ga0075436_100061221 | 3300006914 | Unclassified | 2600 |
| 67 | Ga0075436_100075394 | 3300006914 | Bacteria | 2336 |
| 68 | Ga0097620_100047822 | 3300006931 | Bacteria | 4298 |
| 69 | Ga0097620_100312777 | 3300006931 | Bacteria | 1664 |
| 70 | Ga0105240_10000065 | 3300009093 | Bacteria | 213992 |
| 71 | Ga0105240_10001829 | 3300009093 | Bacteria | 35656 |
| 72 | Ga0105240_10003478 | 3300009093 | Bacteria | 24431 |
| 73 | Ga0105240_10004557 | 3300009093 | Bacteria | 21033 |
| 74 | Ga0105240_10004719 | 3300009093 | Bacteria | 20569 |
| 75 | Ga0105240_10094073 | 3300009093 | Unclassified | 3657 |
| 76 | Ga0105240_10119834 | 3300009093 | Unclassified | 3169 |
| 77 | Ga0105245_10031427 | 3300009098 | Bacteria | 4699 |
| 78 | Ga0105245_10188330 | 3300009098 | Bacteria | 1975 |
| 79 | Ga0105247_10001468 | 3300009101 | Bacteria | 16988 |
| 80 | Ga0105247_10060891 | 3300009101 | Unclassified | 2340 |
| 81 | Ga0105241_10000278 | 3300009174 | Bacteria | 38174 |
| 82 | Ga0105241_10120369 | 3300009174 | Bacteria | 2113 |
| 83 | Ga0105241_10153569 | 3300009174 | Unclassified | 1886 |
| 84 | Ga0105248_10062069 | 3300009177 | Unclassified | 4197 |
| 85 | Ga0105248_10324769 | 3300009177 | Bacteria | 1733 |
| 86 | Ga0105248_10378559 | 3300009177 | Unclassified | 1594 |
| 87 | Ga0105237_10002432 | 3300009545 | Bacteria | 23119 |
| 88 | Ga0105237_10109958 | 3300009545 | Unclassified | 2748 |
| 89 | Ga0105237_10150388 | 3300009545 | Bacteria | 2324 |
| 90 | Ga0105237_10163790 | 3300009545 | Unclassified | 2222 |
| 91 | Ga0105238_10000530 | 3300009551 | Bacteria | 39934 |
| 92 | Ga0105238_10000634 | 3300009551 | Bacteria | 37020 |
| 93 | Ga0105238_10009229 | 3300009551 | Bacteria | 9871 |
| 94 | Ga0105238_10039293 | 3300009551 | Bacteria | 4798 |
| 95 | Ga0105238_10084029 | 3300009551 | Unclassified | 3172 |
| 96 | Ga0105238_10120761 | 3300009551 | Unclassified | 2600 |
| 97 | Ga0105239_10001165 | 3300010375 | Bacteria | 36151 |
| 98 | Ga0105239_10003808 | 3300010375 | Bacteria | 18348 |
| 99 | Ga0105239_10068057 | 3300010375 | Bacteria | 3913 |
| 100 | Ga0105239_10242234 | 3300010375 | Unclassified | 2024 |
| 101 | Ga0105239_10309384 | 3300010375 | Bacteria | 1780 |
| 102 | Ga0105246_10127362 | 3300011119 | Bacteria | 1896 |
| 103 | Ga0157373_10290672 | 3300013100 | Unclassified | 1159 |
| 104 | Ga0157373_10352740 | 3300013100 | Unclassified | 1050 |
| 105 | Ga0157373_10394991 | 3300013100 | Unclassified | 990 |
| 106 | Ga0157371_10218351 | 3300013102 | Bacteria | 1369 |
| 107 | Ga0157370_10000009 | 3300013104 | Bacteria | 231270 |
| 108 | Ga0157369_10000022 | 3300013105 | Bacteria | 233081 |
| 109 | Ga0157369_10000794 | 3300013105 | Bacteria | 40368 |
| 110 | Ga0157369_10001128 | 3300013105 | Bacteria | 33404 |
| 111 | Ga0157369_10035206 | 3300013105 | Bacteria | 5491 |
| 112 | Ga0157369_10055460 | 3300013105 | Unclassified | 4278 |
| 113 | Ga0157369_10082109 | 3300013105 | Bacteria | 3449 |
| 114 | Ga0157369_10116976 | 3300013105 | Bacteria | 2830 |
| 115 | Ga0157369_10125853 | 3300013105 | Bacteria | 2717 |
| 116 | Ga0157374_10004084 | 3300013296 | Bacteria | 12255 |
| 117 | Ga0157374_10007308 | 3300013296 | Bacteria | 9417 |
| 118 | Ga0157374_10285560 | 3300013296 | Bacteria | 1630 |
| 119 | Ga0157374_10286135 | 3300013296 | Bacteria | 1628 |
| 120 | Ga0157378_10005531 | 3300013297 | Bacteria | 11065 |
| 121 | Ga0157378_10044007 | 3300013297 | Unclassified | 3963 |
| 122 | Ga0163162_10004126 | 3300013306 | Bacteria | 13944 |
| 123 | Ga0157372_10000192 | 3300013307 | Bacteria | 67358 |
| 124 | Ga0157372_10005792 | 3300013307 | Bacteria | 13158 |
| 125 | Ga0157372_10038369 | 3300013307 | Bacteria | 5286 |
| 126 | Ga0157372_10060937 | 3300013307 | Bacteria | 4223 |
| 127 | Ga0157372_10099749 | 3300013307 | Unclassified | 3313 |
| 128 | Ga0157372_10110683 | 3300013307 | Unclassified | 3146 |
| 129 | Ga0157372_10135702 | 3300013307 | Unclassified | 2833 |
| 130 | Ga0157372_10228918 | 3300013307 | Bacteria | 2155 |
| 131 | Ga0157372_10689861 | 3300013307 | Bacteria | 1189 |
| 132 | Ga0157375_10059676 | 3300013308 | Bacteria | 3780 |
| 133 | Ga0157375_10106039 | 3300013308 | Unclassified | 2902 |
| 134 | Ga0157375_10336010 | 3300013308 | Bacteria | 1676 |
| 135 | Ga0163163_10009609 | 3300014325 | Bacteria | 8643 |
| 136 | Ga0182008_10016877 | 3300014497 | Unclassified | 3788 |
| 137 | Ga0182008_10167501 | 3300014497 | Unclassified | 1108 |
| 138 | Ga0157379_10001698 | 3300014968 | Bacteria | 18216 |
| 139 | Ga0157379_10100725 | 3300014968 | Unclassified | 2593 |
| 140 | Ga0157376_10168670 | 3300014969 | Bacteria | 1991 |
| 141 | Ga0157376_10420751 | 3300014969 | Bacteria | 1296 |
| 142 | Ga0213872_10006755 | 3300021361 | Bacteria | 5713 |
| 143 | Ga0213872_10009022 | 3300021361 | Bacteria | 4794 |
| 144 | Ga0213872_10045590 | 3300021361 | Bacteria | 1995 |
| 145 | Ga0207656_10049063 | 3300025321 | Bacteria | 1819 |
| 146 | Ga0207710_10002527 | 3300025900 | Bacteria | 8459 |
| 147 | Ga0207710_10177350 | 3300025900 | Bacteria | 1044 |
| 148 | Ga0207647_10133044 | 3300025904 | Bacteria | 1461 |
| 149 | Ga0207705_10032363 | 3300025909 | Bacteria | 3737 |
| 150 | Ga0207705_10034218 | 3300025909 | Unclassified | 3633 |
| 151 | Ga0207654_10001279 | 3300025911 | Bacteria | 13388 |
| 152 | Ga0207654_10002087 | 3300025911 | Bacteria | 10237 |
| 153 | Ga0207707_10166418 | 3300025912 | Unclassified | 1927 |
| 154 | Ga0207707_10193393 | 3300025912 | Unclassified | 1774 |
| 155 | Ga0207695_10000052 | 3300025913 | Bacteria | 398089 |
| 156 | Ga0207695_10000174 | 3300025913 | Bacteria | 189006 |
| 157 | Ga0207695_10000332 | 3300025913 | Bacteria | 112161 |
| 158 | Ga0207695_10001747 | 3300025913 | Bacteria | 34511 |
| 159 | Ga0207695_10024562 | 3300025913 | Bacteria | 6774 |
| 160 | Ga0207695_10053441 | 3300025913 | Bacteria | 4225 |
| 161 | Ga0207695_10241784 | 3300025913 | Bacteria | 1706 |
| 162 | Ga0207671_10000783 | 3300025914 | Bacteria | 40292 |
| 163 | Ga0207671_10000867 | 3300025914 | Bacteria | 38284 |
| 164 | Ga0207671_10308119 | 3300025914 | Unclassified | 1251 |
| 165 | Ga0207649_10246795 | 3300025920 | Bacteria | 1284 |
| 166 | Ga0207694_10000043 | 3300025924 | Bacteria | 171251 |
| 167 | Ga0207694_10000362 | 3300025924 | Bacteria | 42697 |
| 168 | Ga0207694_10008726 | 3300025924 | Bacteria | 7650 |
| 169 | Ga0207694_10549486 | 3300025924 | Bacteria | 969 |
| 170 | Ga0207650_10157811 | 3300025925 | Bacteria | 1795 |
| 171 | Ga0207687_10006651 | 3300025927 | Bacteria | 7625 |
| 172 | Ga0207687_10212044 | 3300025927 | Bacteria | 1520 |
| 173 | Ga0207644_10066485 | 3300025931 | Bacteria | 2625 |
| 174 | Ga0207644_10070878 | 3300025931 | Bacteria | 2548 |
| 175 | Ga0207711_10022155 | 3300025941 | Bacteria | 5311 |
| 176 | Ga0207711_10047634 | 3300025941 | Unclassified | 3666 |
| 177 | Ga0207711_10139997 | 3300025941 | Unclassified | 2176 |
| 178 | Ga0207689_10008489 | 3300025942 | Bacteria | 8951 |
| 179 | Ga0207661_10024442 | 3300025944 | Bacteria | 4580 |
| 180 | Ga0207661_10025255 | 3300025944 | Bacteria | 4514 |
| 181 | Ga0207661_10244506 | 3300025944 | Unclassified | 1593 |
| 182 | Ga0207679_10039962 | 3300025945 | Bacteria | 3354 |
| 183 | Ga0207679_10290603 | 3300025945 | Unclassified | 1405 |
| 184 | Ga0207667_10000878 | 3300025949 | Bacteria | 38401 |
| 185 | Ga0207667_10007819 | 3300025949 | Bacteria | 12777 |
| 186 | Ga0207667_10037863 | 3300025949 | Bacteria | 5154 |
| 187 | Ga0207667_10122509 | 3300025949 | Bacteria | 2679 |
| 188 | Ga0207667_10123867 | 3300025949 | Unclassified | 2663 |
| 189 | Ga0207640_10239226 | 3300025981 | Unclassified | 1402 |
| 190 | Ga0207658_10021420 | 3300025986 | Unclassified | 4487 |
| 191 | Ga0207677_10003382 | 3300026023 | Bacteria | 8444 |
| 192 | Ga0207677_10154888 | 3300026023 | Bacteria | 1773 |
| 193 | Ga0207703_10196631 | 3300026035 | Bacteria | 1789 |
| 194 | Ga0207639_10000270 | 3300026041 | Bacteria | 37095 |
| 195 | Ga0207639_10058238 | 3300026041 | Bacteria | 2971 |
| 196 | Ga0207639_10198894 | 3300026041 | Unclassified | 1717 |
| 197 | Ga0207678_10047401 | 3300026067 | Bacteria | 3716 |
| 198 | Ga0207702_10025860 | 3300026078 | Bacteria | 4872 |
| 199 | Ga0207702_10080474 | 3300026078 | Bacteria | 2826 |
| 200 | Ga0207641_10003667 | 3300026088 | Bacteria | 13526 |
| 201 | Ga0207641_10161136 | 3300026088 | Unclassified | 2040 |
| 202 | Ga0207676_10004144 | 3300026095 | Bacteria | 10238 |
| 203 | Ga0207674_10003928 | 3300026116 | Bacteria | 18098 |
| 204 | Ga0207674_10160760 | 3300026116 | Bacteria | 2201 |
| 205 | Ga0207674_10180785 | 3300026116 | Bacteria | 2061 |
| 206 | Ga0207698_10000007 | 3300026142 | Bacteria | 289457 |
| 207 | Ga0207698_10000055 | 3300026142 | Bacteria | 82550 |
| 208 | Ga0207698_10291028 | 3300026142 | Bacteria | 1516 |
| 209 | Ga0268266_10105256 | 3300028379 | Unclassified | 2492 |
| 210 | Ga0268264_10007418 | 3300028381 | Bacteria | 9157 |
| 211 | Ga0265336_10001188 | 3300028666 | Bacteria | 12380 |
| 212 | Ga0265338_10002934 | 3300028800 | Bacteria | 24743 |
| 213 | Ga0265338_10006350 | 3300028800 | Bacteria | 15101 |
| 214 | Ga0265338_10021993 | 3300028800 | Bacteria | 6626 |
| 215 | Ga0265330_10045888 | 3300031235 | Unclassified | 1926 |
| 216 | Ga0265328_10003877 | 3300031239 | Bacteria | 6578 |
| 217 | Ga0265325_10129148 | 3300031241 | Bacteria | 1211 |
| 218 | Ga0265340_10047295 | 3300031247 | Unclassified | 2095 |
| 219 | Ga0265340_10069829 | 3300031247 | Bacteria | 1667 |
| 220 | Ga0265339_10000012 | 3300031249 | Bacteria | 203469 |
| 221 | Ga0265339_10002669 | 3300031249 | Bacteria | 12698 |
| 222 | Ga0265339_10013326 | 3300031249 | Bacteria | 4986 |
| 223 | Ga0265339_10017107 | 3300031249 | Bacteria | 4301 |
| 224 | Ga0265339_10096495 | 3300031249 | Unclassified | 1543 |
| 225 | Ga0265316_10003043 | 3300031344 | Bacteria | 17118 |
| 226 | Ga0265316_10026937 | 3300031344 | Bacteria | 4771 |
| 227 | Ga0265316_10029115 | 3300031344 | Bacteria | 4546 |
| 228 | Ga0265316_10032685 | 3300031344 | Bacteria | 4244 |
| 229 | Ga0265316_10153400 | 3300031344 | Bacteria | 1725 |
| 230 | Ga0265316_10156476 | 3300031344 | Bacteria | 1705 |
| 231 | Ga0265316_10232521 | 3300031344 | Bacteria | 1357 |
| 232 | Ga0307408_100320494 | 3300031548 | Bacteria | 1305 |
| 233 | Ga0265314_10000139 | 3300031711 | Bacteria | 108861 |
| 234 | Ga0265314_10005834 | 3300031711 | Bacteria | 11026 |
| 235 | Ga0265314_10020798 | 3300031711 | Bacteria | 5060 |
| 236 | Ga0265314_10030474 | 3300031711 | Unclassified | 3992 |
| 237 | Ga0265342_10001091 | 3300031712 | Bacteria | 26110 |
| 238 | Ga0265342_10081787 | 3300031712 | Bacteria | 1864 |
| 239 | Ga0265342_10104216 | 3300031712 | Bacteria | 1612 |
| 240 | Ga0307410_10100837 | 3300031852 | Bacteria | 2069 |
| 241 | Ga0307412_10389506 | 3300031911 | Bacteria | 1131 |
| 242 | Ga0307409_100320584 | 3300031995 | Bacteria | 1450 |
| 243 | Ga0307416_100022055 | 3300032002 | Bacteria | 4587 |
| 244 | Ga0307411_10016640 | 3300032005 | Bacteria | 4166 |
| 245 | Ga0373943_0247487 | 3300035170 | Bacteria | 1000 |
| 246 | Ga0373946_0185591 | 3300035171 | Bacteria | 989 |
| 247 | Ga0373933_0079172 | 3300035724 | Bacteria | 2012 |
| 248 | Ga0373947_0026169 | 3300035725 | Bacteria | 3407 |
| 249 | Ga0373937_0050671 | 3300036401 | Bacteria | 3803 |
| 250 | Ga0395898_0500025 | 3300037466 | Bacteria | 1156 |
| 251 | Ga0395905_0007130 | 3300037471 | Bacteria | 11173 |
| 252 | Ga0395905_0013588 | 3300037471 | Bacteria | 7800 |
| 253 | Ga0395905_0863547 | 3300037471 | Bacteria | 808 |
| 254 | Ga0436360_1032925 | 3300039438 | Unclassified | 1233 |
| 255 | Ga0436360_1216769 | 3300039438 | Bacteria | 7254 |
| 256 | Ga0436361_0209176 | 3300039447 | Bacteria | 17603 |
| 257 | Ga0436361_0218374 | 3300039447 | Bacteria | 14565 |
| 258 | Ga0436361_0354935 | 3300039447 | Bacteria | 2408 |
| 259 | Ga0436361_0359247 | 3300039447 | Bacteria | 1503 |
| 260 | Ga0451577_0000054 | 3300042876 | Bacteria | 278798 |
| 261 | Ga0453683_0035197 | 3300044673 | Bacteria | 3156 |
| 262 | Ga0453683_0356318 | 3300044673 | Unclassified | 940 |
| 263 | Ga0466961_0169223 | 3300044693 | Bacteria | 1359 |
| 264 | Ga0466961_0236186 | 3300044693 | Unclassified | 1124 |
| 265 | Ga0466963_0007135 | 3300044694 | Bacteria | 6659 |
| 266 | Ga0453684_0000289 | 3300044712 | Bacteria | 215476 |
| 267 | Ga0451576_0003702 | 3300045051 | Bacteria | 20675 |
| 268 | Ga0466967_0000784 | 3300045976 | Bacteria | 16536 |
| 269 | Ga0495659_0006177 | 3300046664 | Unclassified | 3786 |
| 270 | Ga0495623_0131256 | 3300046679 | Bacteria | 1500 |
| 271 | Ga0495669_0002713 | 3300046684 | Bacteria | 7255 |
| 272 | Ga0495669_0049078 | 3300046684 | Unclassified | 1889 |
| 273 | Ga0495602_0468105 | 3300048088 | Bacteria | 886 |
| 274 | Ga0496100_0528853 | 3300048903 | Unclassified | 911 |
| 275 | Ga0496102_0585100 | 3300048905 | Unclassified | 1039 |
| 276 | Ga0496104_0021070 | 3300048907 | Bacteria | 5980 |
| 277 | Ga0496105_0256192 | 3300048908 | Bacteria | 1416 |
| 278 | Ga0496105_0312545 | 3300048908 | Unclassified | 1261 |
| 279 | Ga0496107_0138740 | 3300048910 | Bacteria | 1797 |
| 280 | Ga0496107_0486443 | 3300048910 | Unclassified | 916 |
| 281 | Ga0496109_0185974 | 3300048912 | Unclassified | 1952 |
| 282 | Ga0496115_0015984 | 3300048918 | Bacteria | 5706 |
| 283 | Ga0496115_0189557 | 3300048918 | Unclassified | 1699 |
| 284 | nmdc:mga08x19_49949_c1 | 3300050514 | Bacteria | 2683 |
| 285 | nmdc:mga08x19_8338_c1 | 3300050514 | Bacteria | 6167 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0863547 | Ga0395905_0863547_37_690 | 214 |
| 2 | 3300048088 | Ga0495602_0468105 | Ga0495602_0468105_73_786 | 237 |
| 3 | 3300048908 | Ga0496105_0312545 | Ga0496105_0312545_20_778 | 252 |
| 4 | 3300046664 | Ga0495659_0006177 | Ga0495659_0006177_1126_1941 | 258 |
| 5 | 3300046684 | Ga0495669_0049078 | Ga0495669_0049078_1021_1836 | 258 |
| 6 | 3300009177 | Ga0105248_10062069 | Ga0105248_100620693 | 260 |
| 7 | 3300013102 | Ga0157371_10218351 | Ga0157371_102183512 | 260 |
| 8 | 3300013307 | Ga0157372_10110683 | Ga0157372_101106832 | 260 |
| 9 | 3300013307 | Ga0157372_10689861 | Ga0157372_106898612 | 260 |
| 10 | 3300014968 | Ga0157379_10100725 | Ga0157379_101007253 | 260 |
| 11 | 3300021361 | Ga0213872_10006755 | Ga0213872_100067554 | 260 |
| 12 | 3300021361 | Ga0213872_10009022 | Ga0213872_100090224 | 260 |
| 13 | 3300025941 | Ga0207711_10047634 | Ga0207711_100476343 | 260 |
| 14 | 3300039447 | Ga0436361_0209176 | Ga0436361_0209176_9097_9879 | 260 |
| 15 | 3300005983 | Ga0081540_1020461 | Ga0081540_10204613 | 261 |
| 16 | 3300009093 | Ga0105240_10004557 | Ga0105240_100045575 | 261 |
| 17 | 3300009174 | Ga0105241_10000278 | Ga0105241_1000027826 | 261 |
| 18 | 3300009545 | Ga0105237_10002432 | Ga0105237_100024322 | 261 |
| 19 | 3300009551 | Ga0105238_10000530 | Ga0105238_1000053011 | 261 |
| 20 | 3300010375 | Ga0105239_10003808 | Ga0105239_100038085 | 261 |
| 21 | 3300013100 | Ga0157373_10352740 | Ga0157373_103527401 | 261 |
| 22 | 3300013105 | Ga0157369_10001128 | Ga0157369_1000112824 | 261 |
| 23 | 3300013307 | Ga0157372_10005792 | Ga0157372_100057925 | 261 |
| 24 | 3300025924 | Ga0207694_10549486 | Ga0207694_105494861 | 261 |
| 25 | 3300014497 | Ga0182008_10167501 | Ga0182008_101675011 | 262 |
| 26 | 3300037471 | Ga0395905_0007130 | Ga0395905_0007130_7426_8223 | 262 |
| 27 | 3300005435 | Ga0070714_100044629 | Ga0070714_1000446294 | 263 |
| 28 | 3300006914 | Ga0075436_100061221 | Ga0075436_1000612213 | 263 |
| 29 | 3300006914 | Ga0075436_100075394 | Ga0075436_1000753941 | 263 |
| 30 | 3300013105 | Ga0157369_10000794 | Ga0157369_1000079435 | 263 |
| 31 | 3300013307 | Ga0157372_10038369 | Ga0157372_100383693 | 263 |
| 32 | 3300037471 | Ga0395905_0013588 | Ga0395905_0013588_6808_7608 | 263 |
| 33 | 3300046684 | Ga0495669_0002713 | Ga0495669_0002713_2042_2869 | 263 |
| 34 | 3300050514 | nmdc:mga08x19_49949_c1 | nmdc:mga08x19_49949_c1_511_1308 | 263 |
| 35 | 3300050514 | nmdc:mga08x19_8338_c1 | nmdc:mga08x19_8338_c1_3863_4660 | 263 |
| 36 | 3300013307 | Ga0157372_10135702 | Ga0157372_101357023 | 264 |
| 37 | 3300048918 | Ga0496115_0189557 | Ga0496115_0189557_793_1653 | 264 |
| 38 | 3300005339 | Ga0070660_100201951 | Ga0070660_1002019512 | 265 |
| 39 | 3300005834 | Ga0068851_10129653 | Ga0068851_101296531 | 265 |
| 40 | 3300009093 | Ga0105240_10094073 | Ga0105240_100940732 | 265 |
| 41 | 3300009551 | Ga0105238_10120761 | Ga0105238_101207611 | 265 |
| 42 | 3300010375 | Ga0105239_10242234 | Ga0105239_102422342 | 265 |
| 43 | 3300013100 | Ga0157373_10394991 | Ga0157373_103949911 | 265 |
| 44 | 3300014497 | Ga0182008_10016877 | Ga0182008_100168772 | 265 |
| 45 | 3300025912 | Ga0207707_10166418 | Ga0207707_101664182 | 265 |
| 46 | 3300025945 | Ga0207679_10290603 | Ga0207679_102906032 | 265 |
| 47 | 3300048903 | Ga0496100_0528853 | Ga0496100_0528853_46_858 | 265 |
| 48 | 3300048910 | Ga0496107_0486443 | Ga0496107_0486443_60_872 | 265 |
| 49 | 3300048912 | Ga0496109_0185974 | Ga0496109_0185974_384_1196 | 265 |
| 50 | 3300035170 | Ga0373943_0247487 | Ga0373943_0247487_114_920 | 266 |
| 51 | 3300035171 | Ga0373946_0185591 | Ga0373946_0185591_34_840 | 266 |
| 52 | 3300035725 | Ga0373947_0026169 | Ga0373947_0026169_1787_2593 | 266 |
| 53 | 3300005344 | Ga0070661_100163782 | Ga0070661_1001637821 | 267 |
| 54 | 3300026088 | Ga0207641_10161136 | Ga0207641_101611362 | 267 |
| 55 | 3300031548 | Ga0307408_100320494 | Ga0307408_1003204941 | 268 |
| 56 | 3300031852 | Ga0307410_10100837 | Ga0307410_101008372 | 268 |
| 57 | 3300031911 | Ga0307412_10389506 | Ga0307412_103895061 | 268 |
| 58 | 3300031995 | Ga0307409_100320584 | Ga0307409_1003205841 | 268 |
| 59 | 3300032002 | Ga0307416_100022055 | Ga0307416_1000220552 | 268 |
| 60 | 3300032005 | Ga0307411_10016640 | Ga0307411_100166403 | 268 |
| 61 | 3300035724 | Ga0373933_0079172 | Ga0373933_0079172_167_1090 | 269 |
| 62 | 3300036401 | Ga0373937_0050671 | Ga0373937_0050671_1038_1961 | 269 |
| 63 | 3300042876 | Ga0451577_0000054 | Ga0451577_0000054_113755_114582 | 269 |
| 64 | 3300044673 | Ga0453683_0035197 | Ga0453683_0035197_1504_2331 | 269 |
| 65 | 3300044712 | Ga0453684_0000289 | Ga0453684_0000289_186092_186919 | 269 |
| 66 | 3300045051 | Ga0451576_0003702 | Ga0451576_0003702_11345_12172 | 269 |
| 67 | 3300013308 | Ga0157375_10106039 | Ga0157375_101060392 | 270 |
| 68 | 3300005530 | Ga0070679_100134211 | Ga0070679_1001342113 | 271 |
| 69 | 3300025912 | Ga0207707_10193393 | Ga0207707_101933932 | 271 |
| 70 | 3300037466 | Ga0395898_0500025 | Ga0395898_0500025_164_994 | 271 |
| 71 | 3300039438 | Ga0436360_1032925 | Ga0436360_1032925_102_917 | 271 |
| 72 | 3300039438 | Ga0436360_1216769 | Ga0436360_1216769_5931_6746 | 271 |
| 73 | 3300039447 | Ga0436361_0218374 | Ga0436361_0218374_5282_6097 | 271 |
| 74 | 3300028800 | Ga0265338_10006350 | Ga0265338_100063501 | 273 |
| 75 | 3300031249 | Ga0265339_10002669 | Ga0265339_100026693 | 273 |
| 76 | 3300031344 | Ga0265316_10003043 | Ga0265316_100030432 | 273 |
| 77 | 3300031711 | Ga0265314_10005834 | Ga0265314_100058342 | 273 |
| 78 | 3300044693 | Ga0466961_0169223 | Ga0466961_0169223_71_910 | 273 |
| 79 | 3300005329 | Ga0070683_100015285 | Ga0070683_1000152853 | 274 |
| 80 | 3300005535 | Ga0070684_100018058 | Ga0070684_1000180583 | 274 |
| 81 | 3300005563 | Ga0068855_100049052 | Ga0068855_1000490524 | 274 |
| 82 | 3300013105 | Ga0157369_10125853 | Ga0157369_101258532 | 274 |
| 83 | 3300013307 | Ga0157372_10099749 | Ga0157372_100997493 | 274 |
| 84 | 3300021361 | Ga0213872_10045590 | Ga0213872_100455902 | 274 |
| 85 | 3300025944 | Ga0207661_10025255 | Ga0207661_100252553 | 274 |
| 86 | 3300025949 | Ga0207667_10122509 | Ga0207667_101225092 | 274 |
| 87 | 3300039447 | Ga0436361_0354935 | Ga0436361_0354935_1486_2316 | 274 |
| 88 | 3300039447 | Ga0436361_0359247 | Ga0436361_0359247_447_1274 | 274 |
| 89 | 3300005329 | Ga0070683_100173941 | Ga0070683_1001739411 | 276 |
| 90 | 3300005535 | Ga0070684_100047179 | Ga0070684_1000471792 | 276 |
| 91 | 3300005563 | Ga0068855_100000216 | Ga0068855_10000021648 | 276 |
| 92 | 3300005577 | Ga0068857_100134491 | Ga0068857_1001344912 | 276 |
| 93 | 3300005616 | Ga0068852_100000042 | Ga0068852_10000004258 | 276 |
| 94 | 3300009093 | Ga0105240_10000065 | Ga0105240_10000065137 | 276 |
| 95 | 3300013100 | Ga0157373_10290672 | Ga0157373_102906721 | 276 |
| 96 | 3300013104 | Ga0157370_10000009 | Ga0157370_1000000943 | 276 |
| 97 | 3300013105 | Ga0157369_10000022 | Ga0157369_10000022154 | 276 |
| 98 | 3300013307 | Ga0157372_10000192 | Ga0157372_1000019214 | 276 |
| 99 | 3300025913 | Ga0207695_10000052 | Ga0207695_1000005245 | 276 |
| 100 | 3300025944 | Ga0207661_10244506 | Ga0207661_102445062 | 276 |
| 101 | 3300025949 | Ga0207667_10007819 | Ga0207667_100078198 | 276 |
| 102 | 3300026116 | Ga0207674_10160760 | Ga0207674_101607602 | 276 |
| 103 | 3300026142 | Ga0207698_10000007 | Ga0207698_1000000744 | 276 |
| 104 | 3300044694 | Ga0466963_0007135 | Ga0466963_0007135_3458_4288 | 276 |
| 105 | 3300045976 | Ga0466967_0000784 | Ga0466967_0000784_8878_9708 | 276 |
| 106 | 3300005327 | Ga0070658_10025849 | Ga0070658_100258491 | 277 |
| 107 | 3300005329 | Ga0070683_100039768 | Ga0070683_1000397682 | 277 |
| 108 | 3300005344 | Ga0070661_100007332 | Ga0070661_1000073324 | 277 |
| 109 | 3300005455 | Ga0070663_100193147 | Ga0070663_1001931472 | 277 |
| 110 | 3300005548 | Ga0070665_100136277 | Ga0070665_1001362773 | 277 |
| 111 | 3300005563 | Ga0068855_100114924 | Ga0068855_1001149242 | 277 |
| 112 | 3300005614 | Ga0068856_100016234 | Ga0068856_1000162344 | 277 |
| 113 | 3300005614 | Ga0068856_100431457 | Ga0068856_1004314572 | 277 |
| 114 | 3300005616 | Ga0068852_100003508 | Ga0068852_1000035083 | 277 |
| 115 | 3300005834 | Ga0068851_10049282 | Ga0068851_100492823 | 277 |
| 116 | 3300009093 | Ga0105240_10119834 | Ga0105240_101198342 | 277 |
| 117 | 3300009174 | Ga0105241_10153569 | Ga0105241_101535692 | 277 |
| 118 | 3300009551 | Ga0105238_10039293 | Ga0105238_100392932 | 277 |
| 119 | 3300009551 | Ga0105238_10084029 | Ga0105238_100840293 | 277 |
| 120 | 3300013105 | Ga0157369_10035206 | Ga0157369_100352062 | 277 |
| 121 | 3300025909 | Ga0207705_10032363 | Ga0207705_100323631 | 277 |
| 122 | 3300025913 | Ga0207695_10241784 | Ga0207695_102417842 | 277 |
| 123 | 3300025914 | Ga0207671_10308119 | Ga0207671_103081191 | 277 |
| 124 | 3300025949 | Ga0207667_10037863 | Ga0207667_100378633 | 277 |
| 125 | 3300025949 | Ga0207667_10123867 | Ga0207667_101238673 | 277 |
| 126 | 3300026041 | Ga0207639_10058238 | Ga0207639_100582381 | 277 |
| 127 | 3300026078 | Ga0207702_10025860 | Ga0207702_100258604 | 277 |
| 128 | 3300026116 | Ga0207674_10180785 | Ga0207674_101807852 | 277 |
| 129 | 3300028379 | Ga0268266_10105256 | Ga0268266_101052562 | 277 |
| 130 | 3300028800 | Ga0265338_10002934 | Ga0265338_100029346 | 277 |
| 131 | 3300031249 | Ga0265339_10017107 | Ga0265339_100171073 | 277 |
| 132 | 3300031711 | Ga0265314_10020798 | Ga0265314_100207982 | 277 |
| 133 | 3300005563 | Ga0068855_100352873 | Ga0068855_1003528732 | 278 |
| 134 | 3300006028 | Ga0070717_10666880 | Ga0070717_106668801 | 278 |
| 135 | 3300013105 | Ga0157369_10055460 | Ga0157369_100554603 | 278 |
| 136 | 3300013296 | Ga0157374_10007308 | Ga0157374_1000730810 | 278 |
| 137 | 3300025909 | Ga0207705_10034218 | Ga0207705_100342183 | 278 |
| 138 | 3300028666 | Ga0265336_10001188 | Ga0265336_100011886 | 278 |
| 139 | 3300028800 | Ga0265338_10021993 | Ga0265338_100219934 | 278 |
| 140 | 3300031235 | Ga0265330_10045888 | Ga0265330_100458881 | 278 |
| 141 | 3300031241 | Ga0265325_10129148 | Ga0265325_101291482 | 278 |
| 142 | 3300031247 | Ga0265340_10069829 | Ga0265340_100698291 | 278 |
| 143 | 3300031249 | Ga0265339_10013326 | Ga0265339_100133262 | 278 |
| 144 | 3300031249 | Ga0265339_10096495 | Ga0265339_100964952 | 278 |
| 145 | 3300031344 | Ga0265316_10026937 | Ga0265316_100269372 | 278 |
| 146 | 3300031344 | Ga0265316_10153400 | Ga0265316_101534002 | 278 |
| 147 | 3300031344 | Ga0265316_10156476 | Ga0265316_101564761 | 278 |
| 148 | 3300031344 | Ga0265316_10232521 | Ga0265316_102325212 | 278 |
| 149 | 3300031711 | Ga0265314_10000139 | Ga0265314_1000013989 | 278 |
| 150 | 3300031711 | Ga0265314_10030474 | Ga0265314_100304742 | 278 |
| 151 | 3300031712 | Ga0265342_10104216 | Ga0265342_101042162 | 278 |
| 152 | 3300044673 | Ga0453683_0356318 | Ga0453683_0356318_16_852 | 278 |
| 153 | 3300044693 | Ga0466961_0236186 | Ga0466961_0236186_48_911 | 281 |
| 154 | 3300003323 | rootH1_10239311 | rootH1_102393112 | 282 |
| 155 | 3300005327 | Ga0070658_10018244 | Ga0070658_100182443 | 282 |
| 156 | 3300005329 | Ga0070683_100009070 | Ga0070683_1000090704 | 282 |
| 157 | 3300005331 | Ga0070670_100184295 | Ga0070670_1001842952 | 282 |
| 158 | 3300005334 | Ga0068869_100002576 | Ga0068869_10000257612 | 282 |
| 159 | 3300005335 | Ga0070666_10066254 | Ga0070666_100662542 | 282 |
| 160 | 3300005337 | Ga0070682_100117432 | Ga0070682_1001174322 | 282 |
| 161 | 3300005338 | Ga0068868_100000969 | Ga0068868_10000096910 | 282 |
| 162 | 3300005338 | Ga0068868_100078152 | Ga0068868_1000781522 | 282 |
| 163 | 3300005339 | Ga0070660_100156193 | Ga0070660_1001561931 | 282 |
| 164 | 3300005344 | Ga0070661_100295677 | Ga0070661_1002956772 | 282 |
| 165 | 3300005355 | Ga0070671_100001442 | Ga0070671_10000144215 | 282 |
| 166 | 3300005355 | Ga0070671_100019563 | Ga0070671_1000195632 | 282 |
| 167 | 3300005367 | Ga0070667_100017377 | Ga0070667_1000173772 | 282 |
| 168 | 3300005455 | Ga0070663_100106777 | Ga0070663_1001067772 | 282 |
| 169 | 3300005535 | Ga0070684_100002349 | Ga0070684_1000023497 | 282 |
| 170 | 3300005539 | Ga0068853_100000264 | Ga0068853_1000002648 | 282 |
| 171 | 3300005539 | Ga0068853_100195008 | Ga0068853_1001950081 | 282 |
| 172 | 3300005539 | Ga0068853_100603535 | Ga0068853_1006035351 | 282 |
| 173 | 3300005548 | Ga0070665_100242868 | Ga0070665_1002428682 | 282 |
| 174 | 3300005563 | Ga0068855_100002826 | Ga0068855_10000282614 | 282 |
| 175 | 3300005564 | Ga0070664_100053183 | Ga0070664_1000531834 | 282 |
| 176 | 3300005577 | Ga0068857_100001621 | Ga0068857_1000016212 | 282 |
| 177 | 3300005614 | Ga0068856_100001136 | Ga0068856_1000011363 | 282 |
| 178 | 3300005614 | Ga0068856_100002530 | Ga0068856_1000025304 | 282 |
| 179 | 3300005616 | Ga0068852_100000046 | Ga0068852_10000004628 | 282 |
| 180 | 3300005616 | Ga0068852_100172213 | Ga0068852_1001722131 | 282 |
| 181 | 3300005616 | Ga0068852_100253724 | Ga0068852_1002537242 | 282 |
| 182 | 3300005617 | Ga0068859_100047822 | Ga0068859_1000478221 | 282 |
| 183 | 3300005617 | Ga0068859_100312743 | Ga0068859_1003127431 | 282 |
| 184 | 3300005618 | Ga0068864_100001867 | Ga0068864_1000018679 | 282 |
| 185 | 3300005834 | Ga0068851_10000417 | Ga0068851_100004172 | 282 |
| 186 | 3300005841 | Ga0068863_100012154 | Ga0068863_1000121544 | 282 |
| 187 | 3300005842 | Ga0068858_100190558 | Ga0068858_1001905582 | 282 |
| 188 | 3300005843 | Ga0068860_100000752 | Ga0068860_10000075226 | 282 |
| 189 | 3300006237 | Ga0097621_100006478 | Ga0097621_1000064784 | 282 |
| 190 | 3300006237 | Ga0097621_100130315 | Ga0097621_1001303152 | 282 |
| 191 | 3300006358 | Ga0068871_100001110 | Ga0068871_10000111011 | 282 |
| 192 | 3300006358 | Ga0068871_100187297 | Ga0068871_1001872972 | 282 |
| 193 | 3300006931 | Ga0097620_100047822 | Ga0097620_1000478221 | 282 |
| 194 | 3300006931 | Ga0097620_100312777 | Ga0097620_1003127772 | 282 |
| 195 | 3300009093 | Ga0105240_10001829 | Ga0105240_100018292 | 282 |
| 196 | 3300009093 | Ga0105240_10003478 | Ga0105240_1000347821 | 282 |
| 197 | 3300009093 | Ga0105240_10004719 | Ga0105240_1000471912 | 282 |
| 198 | 3300009098 | Ga0105245_10031427 | Ga0105245_100314276 | 282 |
| 199 | 3300009098 | Ga0105245_10188330 | Ga0105245_101883303 | 282 |
| 200 | 3300009101 | Ga0105247_10001468 | Ga0105247_100014681 | 282 |
| 201 | 3300009101 | Ga0105247_10060891 | Ga0105247_100608912 | 282 |
| 202 | 3300009174 | Ga0105241_10120369 | Ga0105241_101203691 | 282 |
| 203 | 3300009177 | Ga0105248_10324769 | Ga0105248_103247692 | 282 |
| 204 | 3300009177 | Ga0105248_10378559 | Ga0105248_103785592 | 282 |
| 205 | 3300009545 | Ga0105237_10109958 | Ga0105237_101099583 | 282 |
| 206 | 3300009545 | Ga0105237_10150388 | Ga0105237_101503882 | 282 |
| 207 | 3300009545 | Ga0105237_10163790 | Ga0105237_101637902 | 282 |
| 208 | 3300009551 | Ga0105238_10000634 | Ga0105238_1000063416 | 282 |
| 209 | 3300009551 | Ga0105238_10009229 | Ga0105238_100092294 | 282 |
| 210 | 3300010375 | Ga0105239_10001165 | Ga0105239_1000116535 | 282 |
| 211 | 3300010375 | Ga0105239_10068057 | Ga0105239_100680571 | 282 |
| 212 | 3300010375 | Ga0105239_10309384 | Ga0105239_103093842 | 282 |
| 213 | 3300011119 | Ga0105246_10127362 | Ga0105246_101273621 | 282 |
| 214 | 3300013105 | Ga0157369_10082109 | Ga0157369_100821093 | 282 |
| 215 | 3300013105 | Ga0157369_10116976 | Ga0157369_101169763 | 282 |
| 216 | 3300013296 | Ga0157374_10004084 | Ga0157374_100040844 | 282 |
| 217 | 3300013296 | Ga0157374_10285560 | Ga0157374_102855601 | 282 |
| 218 | 3300013296 | Ga0157374_10286135 | Ga0157374_102861351 | 282 |
| 219 | 3300013297 | Ga0157378_10005531 | Ga0157378_1000553110 | 282 |
| 220 | 3300013297 | Ga0157378_10044007 | Ga0157378_100440072 | 282 |
| 221 | 3300013306 | Ga0163162_10004126 | Ga0163162_100041266 | 282 |
| 222 | 3300013307 | Ga0157372_10060937 | Ga0157372_100609373 | 282 |
| 223 | 3300013307 | Ga0157372_10228918 | Ga0157372_102289182 | 282 |
| 224 | 3300013308 | Ga0157375_10059676 | Ga0157375_100596764 | 282 |
| 225 | 3300013308 | Ga0157375_10336010 | Ga0157375_103360101 | 282 |
| 226 | 3300014325 | Ga0163163_10009609 | Ga0163163_100096094 | 282 |
| 227 | 3300014968 | Ga0157379_10001698 | Ga0157379_100016989 | 282 |
| 228 | 3300014969 | Ga0157376_10168670 | Ga0157376_101686702 | 282 |
| 229 | 3300014969 | Ga0157376_10420751 | Ga0157376_104207511 | 282 |
| 230 | 3300025321 | Ga0207656_10049063 | Ga0207656_100490632 | 282 |
| 231 | 3300025900 | Ga0207710_10002527 | Ga0207710_100025271 | 282 |
| 232 | 3300025900 | Ga0207710_10177350 | Ga0207710_101773502 | 282 |
| 233 | 3300025904 | Ga0207647_10133044 | Ga0207647_101330441 | 282 |
| 234 | 3300025911 | Ga0207654_10001279 | Ga0207654_100012795 | 282 |
| 235 | 3300025911 | Ga0207654_10002087 | Ga0207654_100020875 | 282 |
| 236 | 3300025913 | Ga0207695_10000174 | Ga0207695_10000174107 | 282 |
| 237 | 3300025913 | Ga0207695_10000332 | Ga0207695_1000033283 | 282 |
| 238 | 3300025913 | Ga0207695_10001747 | Ga0207695_1000174722 | 282 |
| 239 | 3300025913 | Ga0207695_10024562 | Ga0207695_100245624 | 282 |
| 240 | 3300025913 | Ga0207695_10053441 | Ga0207695_100534414 | 282 |
| 241 | 3300025914 | Ga0207671_10000783 | Ga0207671_100007838 | 282 |
| 242 | 3300025914 | Ga0207671_10000867 | Ga0207671_100008672 | 282 |
| 243 | 3300025920 | Ga0207649_10246795 | Ga0207649_102467952 | 282 |
| 244 | 3300025924 | Ga0207694_10000043 | Ga0207694_100000434 | 282 |
| 245 | 3300025924 | Ga0207694_10000362 | Ga0207694_1000036211 | 282 |
| 246 | 3300025924 | Ga0207694_10008726 | Ga0207694_100087265 | 282 |
| 247 | 3300025925 | Ga0207650_10157811 | Ga0207650_101578112 | 282 |
| 248 | 3300025927 | Ga0207687_10006651 | Ga0207687_100066514 | 282 |
| 249 | 3300025927 | Ga0207687_10212044 | Ga0207687_102120442 | 282 |
| 250 | 3300025931 | Ga0207644_10066485 | Ga0207644_100664854 | 282 |
| 251 | 3300025931 | Ga0207644_10070878 | Ga0207644_100708781 | 282 |
| 252 | 3300025941 | Ga0207711_10022155 | Ga0207711_100221552 | 282 |
| 253 | 3300025941 | Ga0207711_10139997 | Ga0207711_101399974 | 282 |
| 254 | 3300025942 | Ga0207689_10008489 | Ga0207689_100084891 | 282 |
| 255 | 3300025944 | Ga0207661_10024442 | Ga0207661_100244422 | 282 |
| 256 | 3300025945 | Ga0207679_10039962 | Ga0207679_100399622 | 282 |
| 257 | 3300025949 | Ga0207667_10000878 | Ga0207667_1000087822 | 282 |
| 258 | 3300025981 | Ga0207640_10239226 | Ga0207640_102392261 | 282 |
| 259 | 3300025986 | Ga0207658_10021420 | Ga0207658_100214202 | 282 |
| 260 | 3300026023 | Ga0207677_10003382 | Ga0207677_100033821 | 282 |
| 261 | 3300026023 | Ga0207677_10154888 | Ga0207677_101548881 | 282 |
| 262 | 3300026035 | Ga0207703_10196631 | Ga0207703_101966312 | 282 |
| 263 | 3300026041 | Ga0207639_10000270 | Ga0207639_1000027022 | 282 |
| 264 | 3300026041 | Ga0207639_10198894 | Ga0207639_101988942 | 282 |
| 265 | 3300026067 | Ga0207678_10047401 | Ga0207678_100474013 | 282 |
| 266 | 3300026078 | Ga0207702_10080474 | Ga0207702_100804741 | 282 |
| 267 | 3300026088 | Ga0207641_10003667 | Ga0207641_100036677 | 282 |
| 268 | 3300026095 | Ga0207676_10004144 | Ga0207676_100041441 | 282 |
| 269 | 3300026116 | Ga0207674_10003928 | Ga0207674_100039289 | 282 |
| 270 | 3300026142 | Ga0207698_10000055 | Ga0207698_1000005544 | 282 |
| 271 | 3300026142 | Ga0207698_10291028 | Ga0207698_102910282 | 282 |
| 272 | 3300028381 | Ga0268264_10007418 | Ga0268264_100074185 | 282 |
| 273 | 3300031239 | Ga0265328_10003877 | Ga0265328_100038773 | 282 |
| 274 | 3300031247 | Ga0265340_10047295 | Ga0265340_100472952 | 282 |
| 275 | 3300031249 | Ga0265339_10000012 | Ga0265339_100000121 | 282 |
| 276 | 3300031344 | Ga0265316_10029115 | Ga0265316_100291154 | 282 |
| 277 | 3300031344 | Ga0265316_10032685 | Ga0265316_100326852 | 282 |
| 278 | 3300031712 | Ga0265342_10001091 | Ga0265342_1000109123 | 282 |
| 279 | 3300031712 | Ga0265342_10081787 | Ga0265342_100817872 | 282 |
| 280 | 3300046679 | Ga0495623_0131256 | Ga0495623_0131256_295_1143 | 282 |
| 281 | 3300048905 | Ga0496102_0585100 | Ga0496102_0585100_28_879 | 282 |
| 282 | 3300048907 | Ga0496104_0021070 | Ga0496104_0021070_4379_5230 | 282 |
| 283 | 3300048908 | Ga0496105_0256192 | Ga0496105_0256192_442_1293 | 282 |
| 284 | 3300048910 | Ga0496107_0138740 | Ga0496107_0138740_650_1501 | 282 |
| 285 | 3300048918 | Ga0496115_0015984 | Ga0496115_0015984_3181_4032 | 282 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vmi-assembly1.cif.gz_AC | structure of the human mitochondrial ribosome-ef-g1 complex (classiii) | 0.68 | 175 | 232 |
| 7ut5-assembly2.cif.gz_B | acinetobacter baumannii dihydroorotate dehydrogenase bound with inhibitor dsm186 | 0.6445 | 190 | 261 |
| 6hxj-assembly1.cif.gz_B | structure of atp citrate lyase from chlorobium limicola in complex with citrate and coenzyme a. | 0.6275 | 188 | 280 |
| 5tzn-assembly1.cif.gz_F | structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6) | 0.6251 | 7 | 55 |
| 7jj0-assembly2.cif.gz_C | gtp-specific succinyl-coa synthetase complexed with mg-gmppcp | 0.611 | 190 | 281 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXA8_166_254_3.40.50.10130 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.6884 | 181 | 267 | 3.40.50.10130 |
| 5j1pA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Arenavirus RNA polymerase | 0.6634 | 175 | 230 | 3.30.70.2640 |
| af_Q9P7P2_5_174_3.30.900.10 | Alpha Beta;2-Layer Sandwich;Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A;HORMA domain | 0.6281 | 9 | 53 | 3.30.900.10 |
| af_Q9NU22_5379_5545_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.6258 | 199 | 265 | 3.40.50.410 |
| af_Q8MPQ7_139_316_2.40.160.120 | Mainly Beta;Beta Barrel;Porin; | 0.6104 | 10 | 50 | 2.40.160.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9BZN2-F1-model_v4 | Uncharacterized protein | 0.8591 | 160 | 279 |
|
| AF-A0A2V9VXY7-F1-model_v4 | DUF3037 domain-containing protein | 0.8506 | 1 | 112 |
|
| AF-A0A2V9BZN2-F1-model_v4 | Uncharacterized protein | 0.8301 | 160 | 279 |
|
| AF-A0A2V9VXY7-F1-model_v4 | DUF3037 domain-containing protein | 0.8092 | 1 | 112 |
|
| AF-A0A2V9BZZ4-F1-model_v4 | DUF3037 domain-containing protein | 0.7754 | 1 | 109 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar