F386926

General Info

Members Datasets Scaffolds Average Seq Length
285 210 286 164

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0241561|Ga0316582_0241561_322_915
Length 197
Sequence MQKETSLTDKIDGFKFRFRAFRGQPLHFIFYQEHTMPTFDIVSEVDKTEVKNALEQTNKEVSTRFDFKGSDARVEQAELKLTVWADNEFQLDQVQDILNGKLTKRGVDIKCLEISDKIEKVSGNKVKRECEVKVGVETELAKKIVKHLKDSKLKVQASIQGDTVRVSGKNRDDLQEAIAFVKKTITDFPLQFQNFRD

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.56
Nodule 0
Rhizoplane 4.56
Rhizosphere 83.86
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000157 3300002705 Bacteria 49961
2 JGI25154J39366_1000959 3300002738 Bacteria 11885
3 JGI25157J39369_1000114 3300002741 Bacteria 68725
4 JGI25157J39369_1000232 3300002741 Bacteria 43715
5 JGI25164J39214_1003953 3300002772 Bacteria 1774
6 rootH1_10017942 3300003316 Bacteria 1014
7 rootH1_10017942 3300003323 Bacteria 2836
8 rootH2_10004656 3300003320 Bacteria 11378
9 rootL2_10038102 3300003322 Bacteria 1998
10 rootH1_10072715 3300003323 Bacteria 1173
11 rootH1_10072716 3300003323 Bacteria 1567
12 Ga0055533_1000024 3300003756 Bacteria 338067
13 Ga0055525_1001136 3300003759 Bacteria 6383
14 Ga0065707_10673889 3300005295 Bacteria 652
15 Ga0070658_10192674 3300005327 Bacteria 1718
16 Ga0070658_10643874 3300005327 Bacteria 919
17 Ga0070676_10061175 3300005328 Bacteria 2238
18 Ga0070683_101171939 3300005329 Bacteria 738
19 Ga0070690_100142129 3300005330 Bacteria 1630
20 Ga0068869_100021352 3300005334 Bacteria 4453
21 Ga0070666_10072874 3300005335 Bacteria 2339
22 Ga0070682_100221129 3300005337 Bacteria 1348
23 Ga0070660_100082443 3300005339 Bacteria 2525
24 Ga0070687_100405831 3300005343 Bacteria 895
25 Ga0070661_101198717 3300005344 Bacteria 635
26 Ga0070661_101297497 3300005344 Bacteria 611
27 Ga0070668_100026646 3300005347 Bacteria 4387
28 Ga0070669_100000016 3300005353 Bacteria 196825
29 Ga0070674_100750913 3300005356 Bacteria 838
30 Ga0070673_100051278 3300005364 Bacteria 3230
31 Ga0070673_100125869 3300005364 Bacteria 2144
32 Ga0070688_100580177 3300005365 Bacteria 856
33 Ga0070659_100492219 3300005366 Bacteria 1044
34 Ga0068867_101718311 3300005459 Bacteria 589
35 Ga0070685_10003234 3300005466 Bacteria 8281
36 Ga0070685_10117504 3300005466 Bacteria 1647
37 Ga0070684_100260297 3300005535 Bacteria 1587
38 Ga0068853_100155488 3300005539 Bacteria 2060
39 Ga0070672_101174865 3300005543 Bacteria 683
40 Ga0070686_100092903 3300005544 Bacteria 2022
41 Ga0070686_100252799 3300005544 Bacteria 1288
42 Ga0070665_100000114 3300005548 Bacteria 151271
43 Ga0070665_100618772 3300005548 Unclassified 1096
44 Ga0068855_100867385 3300005563 Bacteria 955
45 Ga0068854_100005376 3300005578 Bacteria 8082
46 Ga0068856_100002337 3300005614 Bacteria 19512
47 Ga0068861_100062096 3300005719 Bacteria 2869
48 Ga0068863_100097192 3300005841 Bacteria 2797
49 Ga0068860_100000356 3300005843 Bacteria 60609
50 Ga0068860_100104740 3300005843 Bacteria 2701
51 Ga0068862_100000343 3300005844 Bacteria 50391
52 Ga0070715_10214806 3300006163 Bacteria 985
53 Ga0070716_100121321 3300006173 Unclassified 1637
54 Ga0075366_10045467 3300006195 Bacteria 2602
55 Ga0075433_10223899 3300006852 Bacteria 1671
56 Ga0075434_100011586 3300006871 Bacteria 8324
57 Ga0075434_100728499 3300006871 Bacteria 1009
58 Ga0075436_100011620 3300006914 Bacteria 6042
59 Ga0075436_100237070 3300006914 Bacteria 1297
60 Ga0075435_100268587 3300007076 Bacteria 1455
61 Ga0075435_100390339 3300007076 Bacteria 1196
62 Ga0105240_10431933 3300009093 Bacteria 1478
63 Ga0111539_10065211 3300009094 Bacteria 4305
64 Ga0105245_10016652 3300009098 Bacteria 6419
65 Ga0105245_10307369 3300009098 Bacteria 1558
66 Ga0105245_10897392 3300009098 Bacteria 928
67 Ga0105245_11744012 3300009098 Bacteria 675
68 Ga0114129_10317568 3300009147 Bacteria 2071
69 Ga0105242_10370842 3300009176 Bacteria 1328
70 Ga0105242_10421621 3300009176 Unclassified 1251
71 Ga0105248_11205881 3300009177 Bacteria 856
72 Ga0105237_11263830 3300009545 Bacteria 745
73 Ga0105238_10055186 3300009551 Bacteria 3989
74 Ga0105238_10068419 3300009551 Bacteria 3552
75 Ga0105249_10019529 3300009553 Bacteria 6047
76 Ga0105239_10687493 3300010375 Bacteria 1169
77 Ga0105246_10022454 3300011119 Bacteria 4071
78 Ga0157370_10623235 3300013104 Bacteria 987
79 Ga0157369_10176226 3300013105 Bacteria 2251
80 Ga0157374_10010104 3300013296 Bacteria 8104
81 Ga0163162_10053617 3300013306 Bacteria 4054
82 Ga0157375_10430797 3300013308 Unclassified 1485
83 Ga0157375_10655849 3300013308 Bacteria 1205
84 Ga0163163_11798159 3300014325 Bacteria 673
85 Ga0157380_11537190 3300014326 Bacteria 719
86 Ga0157379_10363641 3300014968 Unclassified 1326
87 Ga0182007_10097652 3300015262 Bacteria 970
88 Ga0206356_11466010 3300020070 Bacteria 532
89 Ga0213872_10000797 3300021361 Bacteria 22981
90 Ga0213872_10271293 3300021361 Bacteria 710
91 Ga0209674_100007 3300025226 Bacteria 1077082
92 Ga0209563_100060 3300025230 Bacteria 284876
93 Ga0207427_100806 3300025231 Bacteria 14184
94 Ga0209258_100926 3300025242 Bacteria 14558
95 Ga0209646_1000056 3300025246 Bacteria 269860
96 Ga0209026_1000009 3300025250 Bacteria 531812
97 Ga0209677_100088 3300025253 Bacteria 108817
98 Ga0209677_100112 3300025253 Bacteria 85460
99 Ga0209759_1000035 3300025256 Bacteria 264254
100 Ga0209759_1002512 3300025256 Bacteria 7996
101 Ga0209759_1012711 3300025256 Bacteria 2317
102 Ga0207680_10330157 3300025903 Bacteria 1068
103 Ga0207685_10710575 3300025905 Bacteria 548
104 Ga0207699_10889894 3300025906 Bacteria 657
105 Ga0207645_10046961 3300025907 Bacteria 2757
106 Ga0207705_10059645 3300025909 Bacteria 2754
107 Ga0207705_10726734 3300025909 Bacteria 772
108 Ga0207695_10104400 3300025913 Bacteria 2823
109 Ga0207671_10093020 3300025914 Bacteria 2274
110 Ga0207662_10421659 3300025918 Bacteria 908
111 Ga0207657_10225697 3300025919 Bacteria 1499
112 Ga0207681_10000025 3300025923 Bacteria 203205
113 Ga0207694_10013375 3300025924 Bacteria 6181
114 Ga0207694_10500685 3300025924 Bacteria 1017
115 Ga0207687_10009583 3300025927 Bacteria 6333
116 Ga0207687_10663276 3300025927 Bacteria 883
117 Ga0207687_11049256 3300025927 Bacteria 699
118 Ga0207700_11505197 3300025928 Bacteria 597
119 Ga0207690_10008610 3300025932 Bacteria 6050
120 Ga0207690_11219926 3300025932 Bacteria 628
121 Ga0207686_10456659 3300025934 Bacteria 984
122 Ga0207670_10377253 3300025936 Bacteria 1129
123 Ga0207669_11306987 3300025937 Bacteria 616
124 Ga0207665_10184187 3300025939 Unclassified 1514
125 Ga0207689_10016366 3300025942 Bacteria 6280
126 Ga0207667_10372016 3300025949 Bacteria 1456
127 Ga0207651_10031855 3300025960 Bacteria 3377
128 Ga0207651_10035821 3300025960 Bacteria 3232
129 Ga0207712_10028704 3300025961 Bacteria 3723
130 Ga0207640_10028604 3300025981 Bacteria 3410
131 Ga0207677_10371411 3300026023 Unclassified 1204
132 Ga0207639_10301249 3300026041 Bacteria 1417
133 Ga0207678_10617706 3300026067 Bacteria 951
134 Ga0207702_10000501 3300026078 Bacteria 44092
135 Ga0207675_100376961 3300026118 Bacteria 1394
136 Ga0207698_10128363 3300026142 Bacteria 2162
137 Ga0268266_10003732 3300028379 Bacteria 14971
138 Ga0268265_10000315 3300028380 Bacteria 53210
139 Ga0268264_10000557 3300028381 Bacteria 45934
140 Ga0268264_10094978 3300028381 Bacteria 2579
141 Ga0265336_10000039 3300028666 Bacteria 149376
142 Ga0265336_10000435 3300028666 Bacteria 25645
143 Ga0265336_10194909 3300028666 Bacteria 602
144 Ga0265338_10220418 3300028800 Unclassified 1417
145 Ga0265338_10313199 3300028800 Bacteria 1138
146 Ga0265338_10649324 3300028800 Bacteria 731
147 Ga0265324_10000775 3300029957 Bacteria 21048
148 Ga0265324_10003205 3300029957 Bacteria 7914
149 Ga0265324_10005714 3300029957 Bacteria 5306
150 Ga0265324_10013633 3300029957 Bacteria 3026
151 Ga0265328_10026857 3300031239 Bacteria 2162
152 Ga0265325_10002082 3300031241 Bacteria 13690
153 Ga0265339_10005378 3300031249 Bacteria 8529
154 Ga0265339_10406616 3300031249 Bacteria 636
155 Ga0265331_10004158 3300031250 Bacteria 9072
156 Ga0265331_10013874 3300031250 Bacteria 4312
157 Ga0265331_10060972 3300031250 Bacteria 1781
158 Ga0265331_10139160 3300031250 Unclassified 1105
159 Ga0265327_10000715 3300031251 Bacteria 52402
160 Ga0265327_10009939 3300031251 Bacteria 6780
161 Ga0265327_10160765 3300031251 Bacteria 1037
162 Ga0265316_10394644 3300031344 Bacteria 997
163 Ga0307508_10056250 3300031616 Bacteria 3484
164 Ga0316575_10000309 3300031665 Bacteria 13701
165 Ga0316575_10140088 3300031665 Bacteria 995
166 Ga0265314_10001294 3300031711 Bacteria 28367
167 Ga0307516_10022929 3300031730 Bacteria 6406
168 Ga0307410_11277729 3300031852 Bacteria 641
169 Ga0307407_10489077 3300031903 Bacteria 900
170 Ga0307414_10132833 3300032004 Bacteria 1935
171 Ga0307414_10142388 3300032004 Bacteria 1879
172 Ga0307411_11208806 3300032005 Bacteria 686
173 Ga0316583_10009359 3300032133 Bacteria 3527
174 Ga0373929_0000004 3300035085 Bacteria 462745
175 Ga0373934_0044961 3300035086 Bacteria 1746
176 Ga0373961_0000896 3300035241 Bacteria 9991
177 Ga0373927_0261461 3300035695 Bacteria 1138
178 Ga0373933_0364169 3300035724 Bacteria 940
179 Ga0373933_0654899 3300035724 Bacteria 690
180 Ga0316582_0241561 3300036647 Bacteria 1237
181 Ga0395899_0259226 3300037312 Bacteria 1190
182 Ga0395899_0601939 3300037312 Bacteria 700
183 Ga0395900_0185778 3300037418 Bacteria 2110
184 Ga0395898_0006486 3300037466 Bacteria 12497
185 Ga0395905_0000643 3300037471 Bacteria 46669
186 Ga0395905_0020472 3300037471 Bacteria 6267
187 Ga0395905_0080867 3300037471 Bacteria 3045
188 Ga0395905_0237368 3300037471 Bacteria 1704
189 Ga0395901_0003254 3300038443 Bacteria 16337
190 Ga0436361_0194134 3300039447 Bacteria 2075
191 Ga0436361_0264199 3300039447 Bacteria 2627
192 Ga0436361_0269507 3300039447 Bacteria 102308
193 Ga0436361_0856436 3300039447 Bacteria 79246
194 Ga0451791_0023732 3300041451 Bacteria 878
195 Ga0451793_0792451 3300041452 Bacteria 678
196 Ga0451807_1065197 3300041486 Bacteria 2783
197 Ga0451849_0602241 3300041505 Bacteria 926
198 Ga0451577_0000080 3300042876 Bacteria 218034
199 Ga0451577_0004030 3300042876 Bacteria 15799
200 Ga0451577_0013690 3300042876 Bacteria 7581
201 Ga0451577_0250813 3300042876 Bacteria 1602
202 Ga0466969_0023886 3300044656 Bacteria 3146
203 Ga0466977_0012168 3300044666 Bacteria 4997
204 Ga0453683_0000049 3300044673 Bacteria 206697
205 Ga0453683_0067965 3300044673 Bacteria 2228
206 Ga0466965_0011132 3300044683 Bacteria 4209
207 Ga0466966_0002135 3300044684 Bacteria 12815
208 Ga0466961_0035111 3300044693 Bacteria 3219
209 Ga0466963_0190630 3300044694 Bacteria 1432
210 Ga0466963_0285439 3300044694 Bacteria 1160
211 Ga0466964_0028444 3300044706 Bacteria 2202
212 Ga0453684_0000237 3300044712 Bacteria 236999
213 Ga0453684_0000286 3300044712 Bacteria 218034
214 Ga0453684_0000768 3300044712 Bacteria 111227
215 Ga0453684_0087887 3300044712 Bacteria 3850
216 Ga0453684_0365336 3300044712 Bacteria 1624
217 Ga0453684_0433320 3300044712 Unclassified 1466
218 Ga0453684_1693000 3300044712 Bacteria 646
219 Ga0466968_0027888 3300044735 Bacteria 2326
220 Ga0466970_0024507 3300044765 Bacteria 3155
221 Ga0466957_0024740 3300044842 Bacteria 3555
222 Ga0466960_0542250 3300044901 Bacteria 685
223 Ga0466959_0296111 3300045049 Bacteria 1108
224 Ga0451576_0000013 3300045051 Bacteria 665120
225 Ga0451576_0000102 3300045051 Bacteria 218034
226 Ga0451576_0062968 3300045051 Bacteria 3866
227 Ga0451576_0146389 3300045051 Bacteria 2463
228 Ga0495651_0285205 3300046462 Bacteria 1114
229 Ga0495585_0036564 3300046492 Bacteria 2768
230 Ga0495585_0061658 3300046492 Bacteria 2061
231 Ga0495607_0293115 3300046501 Bacteria 768
232 Ga0495606_0000787 3300046507 Bacteria 48504
233 Ga0495633_0040605 3300046558 Bacteria 2215
234 Ga0495656_0308606 3300046615 Bacteria 812
235 Ga0495668_0060839 3300046616 Bacteria 2083
236 Ga0495611_0107299 3300046648 Bacteria 1299
237 Ga0495661_0005359 3300046665 Bacteria 9120
238 Ga0495671_0228796 3300046692 Bacteria 899
239 Ga0495683_0084531 3300047323 Bacteria 1544
240 Ga0495686_0418286 3300047472 Bacteria 717
241 Ga0495615_0208445 3300048090 Bacteria 606
242 Ga0495626_0167469 3300048091 Bacteria 918
243 Ga0496100_0021661 3300048903 Bacteria 3876
244 Ga0496100_0035471 3300048903 Bacteria 3137
245 Ga0496100_0868375 3300048903 Bacteria 708
246 Ga0496104_1146079 3300048907 Bacteria 681
247 Ga0496105_0450953 3300048908 Bacteria 1015
248 Ga0496106_0558701 3300048909 Bacteria 918
249 Ga0496109_1123005 3300048912 Bacteria 723
250 Ga0496114_0000073 3300048917 Bacteria 71711
251 Ga0496115_0013709 3300048918 Bacteria 6137
252 Ga0496115_0341934 3300048918 Bacteria 1221
253 Ga0496117_0220714 3300048920 Bacteria 1055
254 Ga0496126_0165244 3300048929 Bacteria 1889
255 Ga0501031_0334378 3300049568 Bacteria 981
256 Ga0501034_0633183 3300049571 Bacteria 972
257 Ga0501038_0071753 3300049574 Bacteria 2936
258 Ga0501039_0830190 3300049575 Bacteria 720
259 Ga0501043_0715525 3300049579 Bacteria 730
260 Ga0501067_0076576 3300049583 Bacteria 1853
261 Ga0501069_0353289 3300049585 Bacteria 866
262 Ga0501070_0179194 3300049586 Unclassified 1744
263 Ga0501070_0305851 3300049586 Bacteria 1294
264 Ga0501070_0757044 3300049586 Bacteria 765
265 Ga0501074_0067053 3300049590 Bacteria 2581
266 Ga0501075_0073395 3300049591 Bacteria 2587
267 Ga0501077_0000046 3300049593 Bacteria 62239
268 Ga0501247_026468 3300049677 Unclassified 774
269 Ga0501080_0767471 3300049742 Bacteria 847
270 Ga0501081_0432685 3300049743 Bacteria 976
271 Ga0501083_0000445 3300049744 Bacteria 26530
272 Ga0501035_0146165 3300049822 Bacteria 2053
273 nmdc:mga0k408_11403_c1 3300050493 Bacteria 4839
274 nmdc:mga07m45_6415_c1 3300050496 Bacteria 5942
275 nmdc:mga08y16_108174_c1 3300050511 Bacteria 2894
276 nmdc:mga0n895_15023_c1 3300050512 Bacteria 7055
277 nmdc:mga0n895_49490_c1 3300050512 Bacteria 4118
278 nmdc:mga0rr50_116409_c1 3300050513 Bacteria 2122
279 nmdc:mga0rr50_233939_c1 3300050513 Bacteria 1521
280 nmdc:mga0rr50_246859_c1 3300050513 Bacteria 1481
281 nmdc:mga08x19_529_c1 3300050514 Bacteria 25388
282 nmdc:mga0a205_195779_c1 3300050515 Bacteria 1912
283 Ga0495655_0010346 3300053083 Bacteria 1839
284 Ga0500559_0061795 3300053136 Bacteria 1671
285 Ga0501082_0003647 3300060353 Bacteria 13446
286 Ga0466962_0015962 3300061719 Bacteria 3623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_11744012 Ga0105245_117440122 137
2 3300025927 Ga0207687_11049256 Ga0207687_110492561 137
3 3300037471 Ga0395905_0237368 Ga0395905_0237368_739_1236 139
4 3300044666 Ga0466977_0012168 Ga0466977_0012168_4129_4719 140
5 3300048920 Ga0496117_0220714 Ga0496117_0220714_185_682 143
6 3300048929 Ga0496126_0165244 Ga0496126_0165244_1272_1769 143
7 3300031250 Ga0265331_10139160 Ga0265331_101391602 144
8 3300015262 Ga0182007_10097652 Ga0182007_100976522 148
9 3300028800 Ga0265338_10649324 Ga0265338_106493242 149
10 3300031249 Ga0265339_10406616 Ga0265339_104066161 149
11 3300046692 Ga0495671_0228796 Ga0495671_0228796_32_484 150
12 3300049586 Ga0501070_0757044 Ga0501070_0757044_203_700 151
13 3300046462 Ga0495651_0285205 Ga0495651_0285205_557_1051 152
14 3300031730 Ga0307516_10022929 Ga0307516_100229292 153
15 3300035724 Ga0373933_0654899 Ga0373933_0654899_200_661 153
16 3300037471 Ga0395905_0020472 Ga0395905_0020472_3578_4075 153
17 3300046492 Ga0495585_0061658 Ga0495585_0061658_164_625 153
18 3300053136 Ga0500559_0061795 Ga0500559_0061795_953_1447 153
19 3300035695 Ga0373927_0261461 Ga0373927_0261461_521_1015 159
20 3300005295 Ga0065707_10673889 Ga0065707_106738891 161
21 3300005328 Ga0070676_10061175 Ga0070676_100611753 161
22 3300005335 Ga0070666_10072874 Ga0070666_100728742 161
23 3300005337 Ga0070682_100221129 Ga0070682_1002211292 161
24 3300005343 Ga0070687_100405831 Ga0070687_1004058312 161
25 3300005344 Ga0070661_101198717 Ga0070661_1011987171 161
26 3300005347 Ga0070668_100026646 Ga0070668_1000266464 161
27 3300005353 Ga0070669_100000016 Ga0070669_1000000166 161
28 3300005356 Ga0070674_100750913 Ga0070674_1007509131 161
29 3300005364 Ga0070673_100125869 Ga0070673_1001258692 161
30 3300005365 Ga0070688_100580177 Ga0070688_1005801771 161
31 3300005466 Ga0070685_10003234 Ga0070685_100032346 161
32 3300005543 Ga0070672_101174865 Ga0070672_1011748651 161
33 3300005544 Ga0070686_100252799 Ga0070686_1002527992 161
34 3300005548 Ga0070665_100000114 Ga0070665_10000011447 161
35 3300005548 Ga0070665_100618772 Ga0070665_1006187721 161
36 3300005841 Ga0068863_100097192 Ga0068863_1000971922 161
37 3300005843 Ga0068860_100000356 Ga0068860_10000035631 161
38 3300005844 Ga0068862_100000343 Ga0068862_10000034319 161
39 3300006163 Ga0070715_10214806 Ga0070715_102148062 161
40 3300006173 Ga0070716_100121321 Ga0070716_1001213213 161
41 3300006852 Ga0075433_10223899 Ga0075433_102238992 161
42 3300006871 Ga0075434_100011586 Ga0075434_1000115863 161
43 3300006871 Ga0075434_100728499 Ga0075434_1007284992 161
44 3300006914 Ga0075436_100011620 Ga0075436_1000116202 161
45 3300006914 Ga0075436_100237070 Ga0075436_1002370702 161
46 3300007076 Ga0075435_100268587 Ga0075435_1002685872 161
47 3300007076 Ga0075435_100390339 Ga0075435_1003903392 161
48 3300009093 Ga0105240_10431933 Ga0105240_104319332 161
49 3300009094 Ga0111539_10065211 Ga0111539_100652113 161
50 3300009098 Ga0105245_10016652 Ga0105245_100166524 161
51 3300009098 Ga0105245_10307369 Ga0105245_103073692 161
52 3300009147 Ga0114129_10317568 Ga0114129_103175683 161
53 3300009176 Ga0105242_10421621 Ga0105242_104216212 161
54 3300009177 Ga0105248_11205881 Ga0105248_112058812 161
55 3300009551 Ga0105238_10068419 Ga0105238_100684194 161
56 3300009553 Ga0105249_10019529 Ga0105249_100195294 161
57 3300010375 Ga0105239_10687493 Ga0105239_106874932 161
58 3300013296 Ga0157374_10010104 Ga0157374_100101045 161
59 3300013306 Ga0163162_10053617 Ga0163162_100536174 161
60 3300013308 Ga0157375_10430797 Ga0157375_104307972 161
61 3300014325 Ga0163163_11798159 Ga0163163_117981592 161
62 3300014326 Ga0157380_11537190 Ga0157380_115371901 161
63 3300014968 Ga0157379_10363641 Ga0157379_103636411 161
64 3300021361 Ga0213872_10000797 Ga0213872_1000079714 161
65 3300021361 Ga0213872_10271293 Ga0213872_102712931 161
66 3300025903 Ga0207680_10330157 Ga0207680_103301572 161
67 3300025905 Ga0207685_10710575 Ga0207685_107105751 161
68 3300025906 Ga0207699_10889894 Ga0207699_108898941 161
69 3300025907 Ga0207645_10046961 Ga0207645_100469613 161
70 3300025918 Ga0207662_10421659 Ga0207662_104216592 161
71 3300025923 Ga0207681_10000025 Ga0207681_10000025169 161
72 3300025924 Ga0207694_10500685 Ga0207694_105006851 161
73 3300025927 Ga0207687_10009583 Ga0207687_100095834 161
74 3300025928 Ga0207700_11505197 Ga0207700_115051971 161
75 3300025936 Ga0207670_10377253 Ga0207670_103772532 161
76 3300025937 Ga0207669_11306987 Ga0207669_113069871 161
77 3300025939 Ga0207665_10184187 Ga0207665_101841871 161
78 3300025960 Ga0207651_10031855 Ga0207651_100318554 161
79 3300025961 Ga0207712_10028704 Ga0207712_100287042 161
80 3300026023 Ga0207677_10371411 Ga0207677_103714112 161
81 3300028379 Ga0268266_10003732 Ga0268266_1000373210 161
82 3300028380 Ga0268265_10000315 Ga0268265_1000031519 161
83 3300028381 Ga0268264_10000557 Ga0268264_100005573 161
84 3300028800 Ga0265338_10220418 Ga0265338_102204182 161
85 3300031239 Ga0265328_10026857 Ga0265328_100268572 161
86 3300031249 Ga0265339_10005378 Ga0265339_100053786 161
87 3300031616 Ga0307508_10056250 Ga0307508_100562502 161
88 3300031665 Ga0316575_10140088 Ga0316575_101400882 161
89 3300032004 Ga0307414_10132833 Ga0307414_101328332 161
90 3300032004 Ga0307414_10142388 Ga0307414_101423882 161
91 3300035085 Ga0373929_0000004 Ga0373929_0000004_97638_98135 161
92 3300035241 Ga0373961_0000896 Ga0373961_0000896_8195_8695 161
93 3300035724 Ga0373933_0364169 Ga0373933_0364169_116_610 161
94 3300039447 Ga0436361_0194134 Ga0436361_0194134_710_1195 161
95 3300039447 Ga0436361_0269507 Ga0436361_0269507_25402_26049 161
96 3300039447 Ga0436361_0856436 Ga0436361_0856436_73549_74034 161
97 3300041451 Ga0451791_0023732 Ga0451791_0023732_170_670 161
98 3300041452 Ga0451793_0792451 Ga0451793_0792451_92_592 161
99 3300041486 Ga0451807_1065197 Ga0451807_1065197_507_1004 161
100 3300041505 Ga0451849_0602241 Ga0451849_0602241_129_626 161
101 3300042876 Ga0451577_0250813 Ga0451577_0250813_992_1489 161
102 3300044694 Ga0466963_0190630 Ga0466963_0190630_412_909 161
103 3300044712 Ga0453684_0000768 Ga0453684_0000768_18651_19136 161
104 3300044712 Ga0453684_0433320 Ga0453684_0433320_409_906 161
105 3300046492 Ga0495585_0036564 Ga0495585_0036564_1661_2146 161
106 3300046501 Ga0495607_0293115 Ga0495607_0293115_155_640 161
107 3300046507 Ga0495606_0000787 Ga0495606_0000787_47604_48089 161
108 3300046558 Ga0495633_0040605 Ga0495633_0040605_1182_1667 161
109 3300046615 Ga0495656_0308606 Ga0495656_0308606_305_790 161
110 3300046616 Ga0495668_0060839 Ga0495668_0060839_44_529 161
111 3300046648 Ga0495611_0107299 Ga0495611_0107299_563_1048 161
112 3300046665 Ga0495661_0005359 Ga0495661_0005359_7895_8380 161
113 3300047323 Ga0495683_0084531 Ga0495683_0084531_867_1352 161
114 3300047472 Ga0495686_0418286 Ga0495686_0418286_57_557 161
115 3300048090 Ga0495615_0208445 Ga0495615_0208445_49_534 161
116 3300048091 Ga0495626_0167469 Ga0495626_0167469_261_746 161
117 3300048903 Ga0496100_0035471 Ga0496100_0035471_2468_2962 161
118 3300048907 Ga0496104_1146079 Ga0496104_1146079_114_608 161
119 3300048908 Ga0496105_0450953 Ga0496105_0450953_243_743 161
120 3300048912 Ga0496109_1123005 Ga0496109_1123005_114_611 161
121 3300048917 Ga0496114_0000073 Ga0496114_0000073_62818_63315 161
122 3300048918 Ga0496115_0013709 Ga0496115_0013709_4979_5473 161
123 3300048918 Ga0496115_0341934 Ga0496115_0341934_398_883 161
124 3300049583 Ga0501067_0076576 Ga0501067_0076576_513_1010 161
125 3300049585 Ga0501069_0353289 Ga0501069_0353289_200_685 161
126 3300049586 Ga0501070_0179194 Ga0501070_0179194_348_833 161
127 3300049586 Ga0501070_0305851 Ga0501070_0305851_125_610 161
128 3300049590 Ga0501074_0067053 Ga0501074_0067053_1711_2196 161
129 3300049591 Ga0501075_0073395 Ga0501075_0073395_845_1342 161
130 3300049593 Ga0501077_0000046 Ga0501077_0000046_31396_31893 161
131 3300049677 Ga0501247_026468 Ga0501247_026468_66_563 161
132 3300049742 Ga0501080_0767471 Ga0501080_0767471_190_675 161
133 3300049743 Ga0501081_0432685 Ga0501081_0432685_274_768 161
134 3300049744 Ga0501083_0000445 Ga0501083_0000445_12143_12640 161
135 3300050511 nmdc:mga08y16_108174_c1 nmdc:mga08y16_108174_c1_510_1007 161
136 3300050512 nmdc:mga0n895_15023_c1 nmdc:mga0n895_15023_c1_1681_2181 161
137 3300050512 nmdc:mga0n895_49490_c1 nmdc:mga0n895_49490_c1_854_1354 161
138 3300050513 nmdc:mga0rr50_116409_c1 nmdc:mga0rr50_116409_c1_1384_1884 161
139 3300050513 nmdc:mga0rr50_233939_c1 nmdc:mga0rr50_233939_c1_480_977 161
140 3300050513 nmdc:mga0rr50_246859_c1 nmdc:mga0rr50_246859_c1_605_1102 161
141 3300050514 nmdc:mga08x19_529_c1 nmdc:mga08x19_529_c1_5524_6021 161
142 3300050515 nmdc:mga0a205_195779_c1 nmdc:mga0a205_195779_c1_671_1171 161
143 3300053083 Ga0495655_0010346 Ga0495655_0010346_1150_1650 161
144 3300060353 Ga0501082_0003647 Ga0501082_0003647_12122_12619 161
145 3300028666 Ga0265336_10000435 Ga0265336_1000043511 162
146 3300028666 Ga0265336_10194909 Ga0265336_101949091 162
147 3300028800 Ga0265338_10313199 Ga0265338_103131992 162
148 3300029957 Ga0265324_10000775 Ga0265324_1000077511 162
149 3300029957 Ga0265324_10005714 Ga0265324_100057146 162
150 3300029957 Ga0265324_10013633 Ga0265324_100136334 162
151 3300031241 Ga0265325_10002082 Ga0265325_100020827 162
152 3300031250 Ga0265331_10004158 Ga0265331_100041586 162
153 3300031250 Ga0265331_10013874 Ga0265331_100138745 162
154 3300031250 Ga0265331_10060972 Ga0265331_100609722 162
155 3300031251 Ga0265327_10000715 Ga0265327_1000071534 162
156 3300031251 Ga0265327_10009939 Ga0265327_100099398 162
157 3300031251 Ga0265327_10160765 Ga0265327_101607652 162
158 3300031344 Ga0265316_10394644 Ga0265316_103946442 162
159 3300031665 Ga0316575_10000309 Ga0316575_100003097 162
160 3300031711 Ga0265314_10001294 Ga0265314_1000129425 162
161 3300032133 Ga0316583_10009359 Ga0316583_100093592 162
162 3300036647 Ga0316582_0241561 Ga0316582_0241561_322_915 162
163 3300042876 Ga0451577_0000080 Ga0451577_0000080_64566_65054 162
164 3300042876 Ga0451577_0004030 Ga0451577_0004030_55_543 162
165 3300042876 Ga0451577_0013690 Ga0451577_0013690_5760_6248 162
166 3300044673 Ga0453683_0000049 Ga0453683_0000049_64566_65054 162
167 3300044673 Ga0453683_0067965 Ga0453683_0067965_1140_1628 162
168 3300044712 Ga0453684_0000237 Ga0453684_0000237_86681_87169 162
169 3300044712 Ga0453684_0000286 Ga0453684_0000286_152981_153469 162
170 3300044712 Ga0453684_0087887 Ga0453684_0087887_313_801 162
171 3300044712 Ga0453684_0365336 Ga0453684_0365336_638_1126 162
172 3300044712 Ga0453684_1693000 Ga0453684_1693000_12_500 162
173 3300045051 Ga0451576_0000013 Ga0451576_0000013_476254_476742 162
174 3300045051 Ga0451576_0000102 Ga0451576_0000102_64566_65054 162
175 3300045051 Ga0451576_0062968 Ga0451576_0062968_3305_3850 162
176 3300045051 Ga0451576_0146389 Ga0451576_0146389_1666_2154 162
177 3300049568 Ga0501031_0334378 Ga0501031_0334378_108_596 162
178 3300049571 Ga0501034_0633183 Ga0501034_0633183_378_866 162
179 3300049574 Ga0501038_0071753 Ga0501038_0071753_1358_1846 162
180 3300049575 Ga0501039_0830190 Ga0501039_0830190_214_702 162
181 3300049579 Ga0501043_0715525 Ga0501043_0715525_219_707 162
182 3300049822 Ga0501035_0146165 Ga0501035_0146165_903_1391 162
183 3300031852 Ga0307410_11277729 Ga0307410_112777291 163
184 3300031903 Ga0307407_10489077 Ga0307407_104890772 163
185 3300032005 Ga0307411_11208806 Ga0307411_112088061 163
186 3300037418 Ga0395900_0185778 Ga0395900_0185778_1433_1930 163
187 3300037471 Ga0395905_0000643 Ga0395905_0000643_30283_30780 163
188 3300037471 Ga0395905_0080867 Ga0395905_0080867_370_867 163
189 3300048903 Ga0496100_0021661 Ga0496100_0021661_899_1396 163
190 3300048909 Ga0496106_0558701 Ga0496106_0558701_191_688 163
191 3300002705 JGI25156J39149_1000157 JGI25156J39149_100015716 164
192 3300002738 JGI25154J39366_1000959 JGI25154J39366_10009594 164
193 3300002741 JGI25157J39369_1000114 JGI25157J39369_100011431 164
194 3300002741 JGI25157J39369_1000232 JGI25157J39369_100023232 164
195 3300002772 JGI25164J39214_1003953 JGI25164J39214_10039532 164
196 3300003316 rootH1_10017942 rootH1_100179422 164
197 3300003320 rootH2_10004656 rootH2_1000465611 164
198 3300003322 rootL2_10038102 rootL2_100381023 164
199 3300003323 rootH1_10072715 rootH1_100727152 164
200 3300003323 rootH1_10072716 rootH1_100727162 164
201 3300003756 Ga0055533_1000024 Ga0055533_1000024146 164
202 3300003759 Ga0055525_1001136 Ga0055525_10011362 164
203 3300005327 Ga0070658_10192674 Ga0070658_101926742 164
204 3300005327 Ga0070658_10643874 Ga0070658_106438741 164
205 3300005329 Ga0070683_101171939 Ga0070683_1011719391 164
206 3300005330 Ga0070690_100142129 Ga0070690_1001421291 164
207 3300005334 Ga0068869_100021352 Ga0068869_1000213523 164
208 3300005339 Ga0070660_100082443 Ga0070660_1000824432 164
209 3300005344 Ga0070661_101297497 Ga0070661_1012974971 164
210 3300005364 Ga0070673_100051278 Ga0070673_1000512782 164
211 3300005366 Ga0070659_100492219 Ga0070659_1004922192 164
212 3300005459 Ga0068867_101718311 Ga0068867_1017183111 164
213 3300005466 Ga0070685_10117504 Ga0070685_101175042 164
214 3300005535 Ga0070684_100260297 Ga0070684_1002602972 164
215 3300005539 Ga0068853_100155488 Ga0068853_1001554882 164
216 3300005544 Ga0070686_100092903 Ga0070686_1000929032 164
217 3300005563 Ga0068855_100867385 Ga0068855_1008673852 164
218 3300005578 Ga0068854_100005376 Ga0068854_1000053763 164
219 3300005614 Ga0068856_100002337 Ga0068856_1000023373 164
220 3300005719 Ga0068861_100062096 Ga0068861_1000620962 164
221 3300005843 Ga0068860_100104740 Ga0068860_1001047402 164
222 3300006195 Ga0075366_10045467 Ga0075366_100454673 164
223 3300009098 Ga0105245_10897392 Ga0105245_108973922 164
224 3300009176 Ga0105242_10370842 Ga0105242_103708422 164
225 3300009545 Ga0105237_11263830 Ga0105237_112638301 164
226 3300009551 Ga0105238_10055186 Ga0105238_100551863 164
227 3300011119 Ga0105246_10022454 Ga0105246_100224543 164
228 3300013104 Ga0157370_10623235 Ga0157370_106232352 164
229 3300013105 Ga0157369_10176226 Ga0157369_101762263 164
230 3300013308 Ga0157375_10655849 Ga0157375_106558492 164
231 3300020070 Ga0206356_11466010 Ga0206356_114660101 164
232 3300025226 Ga0209674_100007 Ga0209674_100007190 164
233 3300025230 Ga0209563_100060 Ga0209563_10006078 164
234 3300025231 Ga0207427_100806 Ga0207427_1008067 164
235 3300025242 Ga0209258_100926 Ga0209258_1009264 164
236 3300025246 Ga0209646_1000056 Ga0209646_100005624 164
237 3300025250 Ga0209026_1000009 Ga0209026_1000009224 164
238 3300025253 Ga0209677_100088 Ga0209677_10008862 164
239 3300025253 Ga0209677_100112 Ga0209677_10011221 164
240 3300025256 Ga0209759_1000035 Ga0209759_1000035239 164
241 3300025256 Ga0209759_1002512 Ga0209759_10025124 164
242 3300025256 Ga0209759_1012711 Ga0209759_10127113 164
243 3300025909 Ga0207705_10059645 Ga0207705_100596452 164
244 3300025909 Ga0207705_10726734 Ga0207705_107267341 164
245 3300025913 Ga0207695_10104400 Ga0207695_101044002 164
246 3300025914 Ga0207671_10093020 Ga0207671_100930202 164
247 3300025919 Ga0207657_10225697 Ga0207657_102256972 164
248 3300025924 Ga0207694_10013375 Ga0207694_100133753 164
249 3300025927 Ga0207687_10663276 Ga0207687_106632762 164
250 3300025932 Ga0207690_10008610 Ga0207690_100086107 164
251 3300025932 Ga0207690_11219926 Ga0207690_112199261 164
252 3300025934 Ga0207686_10456659 Ga0207686_104566592 164
253 3300025942 Ga0207689_10016366 Ga0207689_100163663 164
254 3300025949 Ga0207667_10372016 Ga0207667_103720162 164
255 3300025960 Ga0207651_10035821 Ga0207651_100358214 164
256 3300025981 Ga0207640_10028604 Ga0207640_100286043 164
257 3300026041 Ga0207639_10301249 Ga0207639_103012492 164
258 3300026067 Ga0207678_10617706 Ga0207678_106177062 164
259 3300026078 Ga0207702_10000501 Ga0207702_1000050127 164
260 3300026118 Ga0207675_100376961 Ga0207675_1003769612 164
261 3300026142 Ga0207698_10128363 Ga0207698_101283633 164
262 3300028381 Ga0268264_10094978 Ga0268264_100949783 164
263 3300028666 Ga0265336_10000039 Ga0265336_100000398 164
264 3300029957 Ga0265324_10003205 Ga0265324_100032053 164
265 3300035086 Ga0373934_0044961 Ga0373934_0044961_1029_1523 164
266 3300037312 Ga0395899_0259226 Ga0395899_0259226_420_914 164
267 3300037312 Ga0395899_0601939 Ga0395899_0601939_65_559 164
268 3300037466 Ga0395898_0006486 Ga0395898_0006486_3695_4189 164
269 3300038443 Ga0395901_0003254 Ga0395901_0003254_10277_10771 164
270 3300039447 Ga0436361_0264199 Ga0436361_0264199_371_865 164
271 3300044656 Ga0466969_0023886 Ga0466969_0023886_1345_1839 164
272 3300044683 Ga0466965_0011132 Ga0466965_0011132_2545_3039 164
273 3300044684 Ga0466966_0002135 Ga0466966_0002135_294_788 164
274 3300044693 Ga0466961_0035111 Ga0466961_0035111_1028_1522 164
275 3300044694 Ga0466963_0285439 Ga0466963_0285439_615_1109 164
276 3300044706 Ga0466964_0028444 Ga0466964_0028444_438_932 164
277 3300044735 Ga0466968_0027888 Ga0466968_0027888_1806_2300 164
278 3300044765 Ga0466970_0024507 Ga0466970_0024507_2190_2684 164
279 3300044842 Ga0466957_0024740 Ga0466957_0024740_2603_3097 164
280 3300044901 Ga0466960_0542250 Ga0466960_0542250_106_600 164
281 3300045049 Ga0466959_0296111 Ga0466959_0296111_553_1047 164
282 3300048903 Ga0496100_0868375 Ga0496100_0868375_175_669 164
283 3300050493 nmdc:mga0k408_11403_c1 nmdc:mga0k408_11403_c1_2441_2935 164
284 3300050496 nmdc:mga07m45_6415_c1 nmdc:mga07m45_6415_c1_1764_2408 164
285 3300061719 Ga0466962_0015962 Ga0466962_0015962_106_600 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

37

196

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.9132 3 160
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8972 3 160
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8427 1 160
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.838 1 160
4pwu-assembly2.cif.gz_C crystal structure of a modulator protein mzra (kpn_03524) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.45 a resolution 0.7529 98 156
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9437 98 160 3.30.70.860
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.942 9 95 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.8834 9 95 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.8493 9 94 3.30.70.990
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8411 98 160 3.30.70.860
ID Description Score Start End GO Terms
AF-A0A0U3F072-F1-model_v4 UPF0234 protein AT984_11050 0.9874 1 160 GO:0000166
GO:0005829
AF-A0A520G4M7-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9858 1 130 GO:0000166
GO:0005829
AF-A0A0U3F072-F1-model_v4 UPF0234 protein AT984_11050 0.9813 1 160 GO:0000166
GO:0005829
AF-A0A5C6ZYJ0-F1-model_v4 UPF0234 protein FUT87_06090 0.9796 1 160 GO:0000166
GO:0005829
AF-A1TNA0-F1-model_v4 UPF0234 protein Aave_1854 0.9771 1 160 GO:0000166
GO:0005829

Feature Viewer

pLDDT pTM Quality
95.46 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map