F386926
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 285 | 210 | 286 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300036647|Ga0316582_0241561|Ga0316582_0241561_322_915 |
| Length | 197 |
| Sequence | MQKETSLTDKIDGFKFRFRAFRGQPLHFIFYQEHTMPTFDIVSEVDKTEVKNALEQTNKEVSTRFDFKGSDARVEQAELKLTVWADNEFQLDQVQDILNGKLTKRGVDIKCLEISDKIEKVSGNKVKRECEVKVGVETELAKKIVKHLKDSKLKVQASIQGDTVRVSGKNRDDLQEAIAFVKKTITDFPLQFQNFRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 71 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 76 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 116 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 121 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 126 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 127 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 128 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 129 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 130 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 141 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 148 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 149 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 156 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 159 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 183 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 184 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 196 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 201 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 202 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 209 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.56 |
| Nodule | 0 |
| Rhizoplane | 4.56 |
| Rhizosphere | 83.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000157 | 3300002705 | Bacteria | 49961 |
| 2 | JGI25154J39366_1000959 | 3300002738 | Bacteria | 11885 |
| 3 | JGI25157J39369_1000114 | 3300002741 | Bacteria | 68725 |
| 4 | JGI25157J39369_1000232 | 3300002741 | Bacteria | 43715 |
| 5 | JGI25164J39214_1003953 | 3300002772 | Bacteria | 1774 |
| 6 | rootH1_10017942 | 3300003316 | Bacteria | 1014 |
| 7 | rootH1_10017942 | 3300003323 | Bacteria | 2836 |
| 8 | rootH2_10004656 | 3300003320 | Bacteria | 11378 |
| 9 | rootL2_10038102 | 3300003322 | Bacteria | 1998 |
| 10 | rootH1_10072715 | 3300003323 | Bacteria | 1173 |
| 11 | rootH1_10072716 | 3300003323 | Bacteria | 1567 |
| 12 | Ga0055533_1000024 | 3300003756 | Bacteria | 338067 |
| 13 | Ga0055525_1001136 | 3300003759 | Bacteria | 6383 |
| 14 | Ga0065707_10673889 | 3300005295 | Bacteria | 652 |
| 15 | Ga0070658_10192674 | 3300005327 | Bacteria | 1718 |
| 16 | Ga0070658_10643874 | 3300005327 | Bacteria | 919 |
| 17 | Ga0070676_10061175 | 3300005328 | Bacteria | 2238 |
| 18 | Ga0070683_101171939 | 3300005329 | Bacteria | 738 |
| 19 | Ga0070690_100142129 | 3300005330 | Bacteria | 1630 |
| 20 | Ga0068869_100021352 | 3300005334 | Bacteria | 4453 |
| 21 | Ga0070666_10072874 | 3300005335 | Bacteria | 2339 |
| 22 | Ga0070682_100221129 | 3300005337 | Bacteria | 1348 |
| 23 | Ga0070660_100082443 | 3300005339 | Bacteria | 2525 |
| 24 | Ga0070687_100405831 | 3300005343 | Bacteria | 895 |
| 25 | Ga0070661_101198717 | 3300005344 | Bacteria | 635 |
| 26 | Ga0070661_101297497 | 3300005344 | Bacteria | 611 |
| 27 | Ga0070668_100026646 | 3300005347 | Bacteria | 4387 |
| 28 | Ga0070669_100000016 | 3300005353 | Bacteria | 196825 |
| 29 | Ga0070674_100750913 | 3300005356 | Bacteria | 838 |
| 30 | Ga0070673_100051278 | 3300005364 | Bacteria | 3230 |
| 31 | Ga0070673_100125869 | 3300005364 | Bacteria | 2144 |
| 32 | Ga0070688_100580177 | 3300005365 | Bacteria | 856 |
| 33 | Ga0070659_100492219 | 3300005366 | Bacteria | 1044 |
| 34 | Ga0068867_101718311 | 3300005459 | Bacteria | 589 |
| 35 | Ga0070685_10003234 | 3300005466 | Bacteria | 8281 |
| 36 | Ga0070685_10117504 | 3300005466 | Bacteria | 1647 |
| 37 | Ga0070684_100260297 | 3300005535 | Bacteria | 1587 |
| 38 | Ga0068853_100155488 | 3300005539 | Bacteria | 2060 |
| 39 | Ga0070672_101174865 | 3300005543 | Bacteria | 683 |
| 40 | Ga0070686_100092903 | 3300005544 | Bacteria | 2022 |
| 41 | Ga0070686_100252799 | 3300005544 | Bacteria | 1288 |
| 42 | Ga0070665_100000114 | 3300005548 | Bacteria | 151271 |
| 43 | Ga0070665_100618772 | 3300005548 | Unclassified | 1096 |
| 44 | Ga0068855_100867385 | 3300005563 | Bacteria | 955 |
| 45 | Ga0068854_100005376 | 3300005578 | Bacteria | 8082 |
| 46 | Ga0068856_100002337 | 3300005614 | Bacteria | 19512 |
| 47 | Ga0068861_100062096 | 3300005719 | Bacteria | 2869 |
| 48 | Ga0068863_100097192 | 3300005841 | Bacteria | 2797 |
| 49 | Ga0068860_100000356 | 3300005843 | Bacteria | 60609 |
| 50 | Ga0068860_100104740 | 3300005843 | Bacteria | 2701 |
| 51 | Ga0068862_100000343 | 3300005844 | Bacteria | 50391 |
| 52 | Ga0070715_10214806 | 3300006163 | Bacteria | 985 |
| 53 | Ga0070716_100121321 | 3300006173 | Unclassified | 1637 |
| 54 | Ga0075366_10045467 | 3300006195 | Bacteria | 2602 |
| 55 | Ga0075433_10223899 | 3300006852 | Bacteria | 1671 |
| 56 | Ga0075434_100011586 | 3300006871 | Bacteria | 8324 |
| 57 | Ga0075434_100728499 | 3300006871 | Bacteria | 1009 |
| 58 | Ga0075436_100011620 | 3300006914 | Bacteria | 6042 |
| 59 | Ga0075436_100237070 | 3300006914 | Bacteria | 1297 |
| 60 | Ga0075435_100268587 | 3300007076 | Bacteria | 1455 |
| 61 | Ga0075435_100390339 | 3300007076 | Bacteria | 1196 |
| 62 | Ga0105240_10431933 | 3300009093 | Bacteria | 1478 |
| 63 | Ga0111539_10065211 | 3300009094 | Bacteria | 4305 |
| 64 | Ga0105245_10016652 | 3300009098 | Bacteria | 6419 |
| 65 | Ga0105245_10307369 | 3300009098 | Bacteria | 1558 |
| 66 | Ga0105245_10897392 | 3300009098 | Bacteria | 928 |
| 67 | Ga0105245_11744012 | 3300009098 | Bacteria | 675 |
| 68 | Ga0114129_10317568 | 3300009147 | Bacteria | 2071 |
| 69 | Ga0105242_10370842 | 3300009176 | Bacteria | 1328 |
| 70 | Ga0105242_10421621 | 3300009176 | Unclassified | 1251 |
| 71 | Ga0105248_11205881 | 3300009177 | Bacteria | 856 |
| 72 | Ga0105237_11263830 | 3300009545 | Bacteria | 745 |
| 73 | Ga0105238_10055186 | 3300009551 | Bacteria | 3989 |
| 74 | Ga0105238_10068419 | 3300009551 | Bacteria | 3552 |
| 75 | Ga0105249_10019529 | 3300009553 | Bacteria | 6047 |
| 76 | Ga0105239_10687493 | 3300010375 | Bacteria | 1169 |
| 77 | Ga0105246_10022454 | 3300011119 | Bacteria | 4071 |
| 78 | Ga0157370_10623235 | 3300013104 | Bacteria | 987 |
| 79 | Ga0157369_10176226 | 3300013105 | Bacteria | 2251 |
| 80 | Ga0157374_10010104 | 3300013296 | Bacteria | 8104 |
| 81 | Ga0163162_10053617 | 3300013306 | Bacteria | 4054 |
| 82 | Ga0157375_10430797 | 3300013308 | Unclassified | 1485 |
| 83 | Ga0157375_10655849 | 3300013308 | Bacteria | 1205 |
| 84 | Ga0163163_11798159 | 3300014325 | Bacteria | 673 |
| 85 | Ga0157380_11537190 | 3300014326 | Bacteria | 719 |
| 86 | Ga0157379_10363641 | 3300014968 | Unclassified | 1326 |
| 87 | Ga0182007_10097652 | 3300015262 | Bacteria | 970 |
| 88 | Ga0206356_11466010 | 3300020070 | Bacteria | 532 |
| 89 | Ga0213872_10000797 | 3300021361 | Bacteria | 22981 |
| 90 | Ga0213872_10271293 | 3300021361 | Bacteria | 710 |
| 91 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 92 | Ga0209563_100060 | 3300025230 | Bacteria | 284876 |
| 93 | Ga0207427_100806 | 3300025231 | Bacteria | 14184 |
| 94 | Ga0209258_100926 | 3300025242 | Bacteria | 14558 |
| 95 | Ga0209646_1000056 | 3300025246 | Bacteria | 269860 |
| 96 | Ga0209026_1000009 | 3300025250 | Bacteria | 531812 |
| 97 | Ga0209677_100088 | 3300025253 | Bacteria | 108817 |
| 98 | Ga0209677_100112 | 3300025253 | Bacteria | 85460 |
| 99 | Ga0209759_1000035 | 3300025256 | Bacteria | 264254 |
| 100 | Ga0209759_1002512 | 3300025256 | Bacteria | 7996 |
| 101 | Ga0209759_1012711 | 3300025256 | Bacteria | 2317 |
| 102 | Ga0207680_10330157 | 3300025903 | Bacteria | 1068 |
| 103 | Ga0207685_10710575 | 3300025905 | Bacteria | 548 |
| 104 | Ga0207699_10889894 | 3300025906 | Bacteria | 657 |
| 105 | Ga0207645_10046961 | 3300025907 | Bacteria | 2757 |
| 106 | Ga0207705_10059645 | 3300025909 | Bacteria | 2754 |
| 107 | Ga0207705_10726734 | 3300025909 | Bacteria | 772 |
| 108 | Ga0207695_10104400 | 3300025913 | Bacteria | 2823 |
| 109 | Ga0207671_10093020 | 3300025914 | Bacteria | 2274 |
| 110 | Ga0207662_10421659 | 3300025918 | Bacteria | 908 |
| 111 | Ga0207657_10225697 | 3300025919 | Bacteria | 1499 |
| 112 | Ga0207681_10000025 | 3300025923 | Bacteria | 203205 |
| 113 | Ga0207694_10013375 | 3300025924 | Bacteria | 6181 |
| 114 | Ga0207694_10500685 | 3300025924 | Bacteria | 1017 |
| 115 | Ga0207687_10009583 | 3300025927 | Bacteria | 6333 |
| 116 | Ga0207687_10663276 | 3300025927 | Bacteria | 883 |
| 117 | Ga0207687_11049256 | 3300025927 | Bacteria | 699 |
| 118 | Ga0207700_11505197 | 3300025928 | Bacteria | 597 |
| 119 | Ga0207690_10008610 | 3300025932 | Bacteria | 6050 |
| 120 | Ga0207690_11219926 | 3300025932 | Bacteria | 628 |
| 121 | Ga0207686_10456659 | 3300025934 | Bacteria | 984 |
| 122 | Ga0207670_10377253 | 3300025936 | Bacteria | 1129 |
| 123 | Ga0207669_11306987 | 3300025937 | Bacteria | 616 |
| 124 | Ga0207665_10184187 | 3300025939 | Unclassified | 1514 |
| 125 | Ga0207689_10016366 | 3300025942 | Bacteria | 6280 |
| 126 | Ga0207667_10372016 | 3300025949 | Bacteria | 1456 |
| 127 | Ga0207651_10031855 | 3300025960 | Bacteria | 3377 |
| 128 | Ga0207651_10035821 | 3300025960 | Bacteria | 3232 |
| 129 | Ga0207712_10028704 | 3300025961 | Bacteria | 3723 |
| 130 | Ga0207640_10028604 | 3300025981 | Bacteria | 3410 |
| 131 | Ga0207677_10371411 | 3300026023 | Unclassified | 1204 |
| 132 | Ga0207639_10301249 | 3300026041 | Bacteria | 1417 |
| 133 | Ga0207678_10617706 | 3300026067 | Bacteria | 951 |
| 134 | Ga0207702_10000501 | 3300026078 | Bacteria | 44092 |
| 135 | Ga0207675_100376961 | 3300026118 | Bacteria | 1394 |
| 136 | Ga0207698_10128363 | 3300026142 | Bacteria | 2162 |
| 137 | Ga0268266_10003732 | 3300028379 | Bacteria | 14971 |
| 138 | Ga0268265_10000315 | 3300028380 | Bacteria | 53210 |
| 139 | Ga0268264_10000557 | 3300028381 | Bacteria | 45934 |
| 140 | Ga0268264_10094978 | 3300028381 | Bacteria | 2579 |
| 141 | Ga0265336_10000039 | 3300028666 | Bacteria | 149376 |
| 142 | Ga0265336_10000435 | 3300028666 | Bacteria | 25645 |
| 143 | Ga0265336_10194909 | 3300028666 | Bacteria | 602 |
| 144 | Ga0265338_10220418 | 3300028800 | Unclassified | 1417 |
| 145 | Ga0265338_10313199 | 3300028800 | Bacteria | 1138 |
| 146 | Ga0265338_10649324 | 3300028800 | Bacteria | 731 |
| 147 | Ga0265324_10000775 | 3300029957 | Bacteria | 21048 |
| 148 | Ga0265324_10003205 | 3300029957 | Bacteria | 7914 |
| 149 | Ga0265324_10005714 | 3300029957 | Bacteria | 5306 |
| 150 | Ga0265324_10013633 | 3300029957 | Bacteria | 3026 |
| 151 | Ga0265328_10026857 | 3300031239 | Bacteria | 2162 |
| 152 | Ga0265325_10002082 | 3300031241 | Bacteria | 13690 |
| 153 | Ga0265339_10005378 | 3300031249 | Bacteria | 8529 |
| 154 | Ga0265339_10406616 | 3300031249 | Bacteria | 636 |
| 155 | Ga0265331_10004158 | 3300031250 | Bacteria | 9072 |
| 156 | Ga0265331_10013874 | 3300031250 | Bacteria | 4312 |
| 157 | Ga0265331_10060972 | 3300031250 | Bacteria | 1781 |
| 158 | Ga0265331_10139160 | 3300031250 | Unclassified | 1105 |
| 159 | Ga0265327_10000715 | 3300031251 | Bacteria | 52402 |
| 160 | Ga0265327_10009939 | 3300031251 | Bacteria | 6780 |
| 161 | Ga0265327_10160765 | 3300031251 | Bacteria | 1037 |
| 162 | Ga0265316_10394644 | 3300031344 | Bacteria | 997 |
| 163 | Ga0307508_10056250 | 3300031616 | Bacteria | 3484 |
| 164 | Ga0316575_10000309 | 3300031665 | Bacteria | 13701 |
| 165 | Ga0316575_10140088 | 3300031665 | Bacteria | 995 |
| 166 | Ga0265314_10001294 | 3300031711 | Bacteria | 28367 |
| 167 | Ga0307516_10022929 | 3300031730 | Bacteria | 6406 |
| 168 | Ga0307410_11277729 | 3300031852 | Bacteria | 641 |
| 169 | Ga0307407_10489077 | 3300031903 | Bacteria | 900 |
| 170 | Ga0307414_10132833 | 3300032004 | Bacteria | 1935 |
| 171 | Ga0307414_10142388 | 3300032004 | Bacteria | 1879 |
| 172 | Ga0307411_11208806 | 3300032005 | Bacteria | 686 |
| 173 | Ga0316583_10009359 | 3300032133 | Bacteria | 3527 |
| 174 | Ga0373929_0000004 | 3300035085 | Bacteria | 462745 |
| 175 | Ga0373934_0044961 | 3300035086 | Bacteria | 1746 |
| 176 | Ga0373961_0000896 | 3300035241 | Bacteria | 9991 |
| 177 | Ga0373927_0261461 | 3300035695 | Bacteria | 1138 |
| 178 | Ga0373933_0364169 | 3300035724 | Bacteria | 940 |
| 179 | Ga0373933_0654899 | 3300035724 | Bacteria | 690 |
| 180 | Ga0316582_0241561 | 3300036647 | Bacteria | 1237 |
| 181 | Ga0395899_0259226 | 3300037312 | Bacteria | 1190 |
| 182 | Ga0395899_0601939 | 3300037312 | Bacteria | 700 |
| 183 | Ga0395900_0185778 | 3300037418 | Bacteria | 2110 |
| 184 | Ga0395898_0006486 | 3300037466 | Bacteria | 12497 |
| 185 | Ga0395905_0000643 | 3300037471 | Bacteria | 46669 |
| 186 | Ga0395905_0020472 | 3300037471 | Bacteria | 6267 |
| 187 | Ga0395905_0080867 | 3300037471 | Bacteria | 3045 |
| 188 | Ga0395905_0237368 | 3300037471 | Bacteria | 1704 |
| 189 | Ga0395901_0003254 | 3300038443 | Bacteria | 16337 |
| 190 | Ga0436361_0194134 | 3300039447 | Bacteria | 2075 |
| 191 | Ga0436361_0264199 | 3300039447 | Bacteria | 2627 |
| 192 | Ga0436361_0269507 | 3300039447 | Bacteria | 102308 |
| 193 | Ga0436361_0856436 | 3300039447 | Bacteria | 79246 |
| 194 | Ga0451791_0023732 | 3300041451 | Bacteria | 878 |
| 195 | Ga0451793_0792451 | 3300041452 | Bacteria | 678 |
| 196 | Ga0451807_1065197 | 3300041486 | Bacteria | 2783 |
| 197 | Ga0451849_0602241 | 3300041505 | Bacteria | 926 |
| 198 | Ga0451577_0000080 | 3300042876 | Bacteria | 218034 |
| 199 | Ga0451577_0004030 | 3300042876 | Bacteria | 15799 |
| 200 | Ga0451577_0013690 | 3300042876 | Bacteria | 7581 |
| 201 | Ga0451577_0250813 | 3300042876 | Bacteria | 1602 |
| 202 | Ga0466969_0023886 | 3300044656 | Bacteria | 3146 |
| 203 | Ga0466977_0012168 | 3300044666 | Bacteria | 4997 |
| 204 | Ga0453683_0000049 | 3300044673 | Bacteria | 206697 |
| 205 | Ga0453683_0067965 | 3300044673 | Bacteria | 2228 |
| 206 | Ga0466965_0011132 | 3300044683 | Bacteria | 4209 |
| 207 | Ga0466966_0002135 | 3300044684 | Bacteria | 12815 |
| 208 | Ga0466961_0035111 | 3300044693 | Bacteria | 3219 |
| 209 | Ga0466963_0190630 | 3300044694 | Bacteria | 1432 |
| 210 | Ga0466963_0285439 | 3300044694 | Bacteria | 1160 |
| 211 | Ga0466964_0028444 | 3300044706 | Bacteria | 2202 |
| 212 | Ga0453684_0000237 | 3300044712 | Bacteria | 236999 |
| 213 | Ga0453684_0000286 | 3300044712 | Bacteria | 218034 |
| 214 | Ga0453684_0000768 | 3300044712 | Bacteria | 111227 |
| 215 | Ga0453684_0087887 | 3300044712 | Bacteria | 3850 |
| 216 | Ga0453684_0365336 | 3300044712 | Bacteria | 1624 |
| 217 | Ga0453684_0433320 | 3300044712 | Unclassified | 1466 |
| 218 | Ga0453684_1693000 | 3300044712 | Bacteria | 646 |
| 219 | Ga0466968_0027888 | 3300044735 | Bacteria | 2326 |
| 220 | Ga0466970_0024507 | 3300044765 | Bacteria | 3155 |
| 221 | Ga0466957_0024740 | 3300044842 | Bacteria | 3555 |
| 222 | Ga0466960_0542250 | 3300044901 | Bacteria | 685 |
| 223 | Ga0466959_0296111 | 3300045049 | Bacteria | 1108 |
| 224 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 225 | Ga0451576_0000102 | 3300045051 | Bacteria | 218034 |
| 226 | Ga0451576_0062968 | 3300045051 | Bacteria | 3866 |
| 227 | Ga0451576_0146389 | 3300045051 | Bacteria | 2463 |
| 228 | Ga0495651_0285205 | 3300046462 | Bacteria | 1114 |
| 229 | Ga0495585_0036564 | 3300046492 | Bacteria | 2768 |
| 230 | Ga0495585_0061658 | 3300046492 | Bacteria | 2061 |
| 231 | Ga0495607_0293115 | 3300046501 | Bacteria | 768 |
| 232 | Ga0495606_0000787 | 3300046507 | Bacteria | 48504 |
| 233 | Ga0495633_0040605 | 3300046558 | Bacteria | 2215 |
| 234 | Ga0495656_0308606 | 3300046615 | Bacteria | 812 |
| 235 | Ga0495668_0060839 | 3300046616 | Bacteria | 2083 |
| 236 | Ga0495611_0107299 | 3300046648 | Bacteria | 1299 |
| 237 | Ga0495661_0005359 | 3300046665 | Bacteria | 9120 |
| 238 | Ga0495671_0228796 | 3300046692 | Bacteria | 899 |
| 239 | Ga0495683_0084531 | 3300047323 | Bacteria | 1544 |
| 240 | Ga0495686_0418286 | 3300047472 | Bacteria | 717 |
| 241 | Ga0495615_0208445 | 3300048090 | Bacteria | 606 |
| 242 | Ga0495626_0167469 | 3300048091 | Bacteria | 918 |
| 243 | Ga0496100_0021661 | 3300048903 | Bacteria | 3876 |
| 244 | Ga0496100_0035471 | 3300048903 | Bacteria | 3137 |
| 245 | Ga0496100_0868375 | 3300048903 | Bacteria | 708 |
| 246 | Ga0496104_1146079 | 3300048907 | Bacteria | 681 |
| 247 | Ga0496105_0450953 | 3300048908 | Bacteria | 1015 |
| 248 | Ga0496106_0558701 | 3300048909 | Bacteria | 918 |
| 249 | Ga0496109_1123005 | 3300048912 | Bacteria | 723 |
| 250 | Ga0496114_0000073 | 3300048917 | Bacteria | 71711 |
| 251 | Ga0496115_0013709 | 3300048918 | Bacteria | 6137 |
| 252 | Ga0496115_0341934 | 3300048918 | Bacteria | 1221 |
| 253 | Ga0496117_0220714 | 3300048920 | Bacteria | 1055 |
| 254 | Ga0496126_0165244 | 3300048929 | Bacteria | 1889 |
| 255 | Ga0501031_0334378 | 3300049568 | Bacteria | 981 |
| 256 | Ga0501034_0633183 | 3300049571 | Bacteria | 972 |
| 257 | Ga0501038_0071753 | 3300049574 | Bacteria | 2936 |
| 258 | Ga0501039_0830190 | 3300049575 | Bacteria | 720 |
| 259 | Ga0501043_0715525 | 3300049579 | Bacteria | 730 |
| 260 | Ga0501067_0076576 | 3300049583 | Bacteria | 1853 |
| 261 | Ga0501069_0353289 | 3300049585 | Bacteria | 866 |
| 262 | Ga0501070_0179194 | 3300049586 | Unclassified | 1744 |
| 263 | Ga0501070_0305851 | 3300049586 | Bacteria | 1294 |
| 264 | Ga0501070_0757044 | 3300049586 | Bacteria | 765 |
| 265 | Ga0501074_0067053 | 3300049590 | Bacteria | 2581 |
| 266 | Ga0501075_0073395 | 3300049591 | Bacteria | 2587 |
| 267 | Ga0501077_0000046 | 3300049593 | Bacteria | 62239 |
| 268 | Ga0501247_026468 | 3300049677 | Unclassified | 774 |
| 269 | Ga0501080_0767471 | 3300049742 | Bacteria | 847 |
| 270 | Ga0501081_0432685 | 3300049743 | Bacteria | 976 |
| 271 | Ga0501083_0000445 | 3300049744 | Bacteria | 26530 |
| 272 | Ga0501035_0146165 | 3300049822 | Bacteria | 2053 |
| 273 | nmdc:mga0k408_11403_c1 | 3300050493 | Bacteria | 4839 |
| 274 | nmdc:mga07m45_6415_c1 | 3300050496 | Bacteria | 5942 |
| 275 | nmdc:mga08y16_108174_c1 | 3300050511 | Bacteria | 2894 |
| 276 | nmdc:mga0n895_15023_c1 | 3300050512 | Bacteria | 7055 |
| 277 | nmdc:mga0n895_49490_c1 | 3300050512 | Bacteria | 4118 |
| 278 | nmdc:mga0rr50_116409_c1 | 3300050513 | Bacteria | 2122 |
| 279 | nmdc:mga0rr50_233939_c1 | 3300050513 | Bacteria | 1521 |
| 280 | nmdc:mga0rr50_246859_c1 | 3300050513 | Bacteria | 1481 |
| 281 | nmdc:mga08x19_529_c1 | 3300050514 | Bacteria | 25388 |
| 282 | nmdc:mga0a205_195779_c1 | 3300050515 | Bacteria | 1912 |
| 283 | Ga0495655_0010346 | 3300053083 | Bacteria | 1839 |
| 284 | Ga0500559_0061795 | 3300053136 | Bacteria | 1671 |
| 285 | Ga0501082_0003647 | 3300060353 | Bacteria | 13446 |
| 286 | Ga0466962_0015962 | 3300061719 | Bacteria | 3623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_11744012 | Ga0105245_117440122 | 137 |
| 2 | 3300025927 | Ga0207687_11049256 | Ga0207687_110492561 | 137 |
| 3 | 3300037471 | Ga0395905_0237368 | Ga0395905_0237368_739_1236 | 139 |
| 4 | 3300044666 | Ga0466977_0012168 | Ga0466977_0012168_4129_4719 | 140 |
| 5 | 3300048920 | Ga0496117_0220714 | Ga0496117_0220714_185_682 | 143 |
| 6 | 3300048929 | Ga0496126_0165244 | Ga0496126_0165244_1272_1769 | 143 |
| 7 | 3300031250 | Ga0265331_10139160 | Ga0265331_101391602 | 144 |
| 8 | 3300015262 | Ga0182007_10097652 | Ga0182007_100976522 | 148 |
| 9 | 3300028800 | Ga0265338_10649324 | Ga0265338_106493242 | 149 |
| 10 | 3300031249 | Ga0265339_10406616 | Ga0265339_104066161 | 149 |
| 11 | 3300046692 | Ga0495671_0228796 | Ga0495671_0228796_32_484 | 150 |
| 12 | 3300049586 | Ga0501070_0757044 | Ga0501070_0757044_203_700 | 151 |
| 13 | 3300046462 | Ga0495651_0285205 | Ga0495651_0285205_557_1051 | 152 |
| 14 | 3300031730 | Ga0307516_10022929 | Ga0307516_100229292 | 153 |
| 15 | 3300035724 | Ga0373933_0654899 | Ga0373933_0654899_200_661 | 153 |
| 16 | 3300037471 | Ga0395905_0020472 | Ga0395905_0020472_3578_4075 | 153 |
| 17 | 3300046492 | Ga0495585_0061658 | Ga0495585_0061658_164_625 | 153 |
| 18 | 3300053136 | Ga0500559_0061795 | Ga0500559_0061795_953_1447 | 153 |
| 19 | 3300035695 | Ga0373927_0261461 | Ga0373927_0261461_521_1015 | 159 |
| 20 | 3300005295 | Ga0065707_10673889 | Ga0065707_106738891 | 161 |
| 21 | 3300005328 | Ga0070676_10061175 | Ga0070676_100611753 | 161 |
| 22 | 3300005335 | Ga0070666_10072874 | Ga0070666_100728742 | 161 |
| 23 | 3300005337 | Ga0070682_100221129 | Ga0070682_1002211292 | 161 |
| 24 | 3300005343 | Ga0070687_100405831 | Ga0070687_1004058312 | 161 |
| 25 | 3300005344 | Ga0070661_101198717 | Ga0070661_1011987171 | 161 |
| 26 | 3300005347 | Ga0070668_100026646 | Ga0070668_1000266464 | 161 |
| 27 | 3300005353 | Ga0070669_100000016 | Ga0070669_1000000166 | 161 |
| 28 | 3300005356 | Ga0070674_100750913 | Ga0070674_1007509131 | 161 |
| 29 | 3300005364 | Ga0070673_100125869 | Ga0070673_1001258692 | 161 |
| 30 | 3300005365 | Ga0070688_100580177 | Ga0070688_1005801771 | 161 |
| 31 | 3300005466 | Ga0070685_10003234 | Ga0070685_100032346 | 161 |
| 32 | 3300005543 | Ga0070672_101174865 | Ga0070672_1011748651 | 161 |
| 33 | 3300005544 | Ga0070686_100252799 | Ga0070686_1002527992 | 161 |
| 34 | 3300005548 | Ga0070665_100000114 | Ga0070665_10000011447 | 161 |
| 35 | 3300005548 | Ga0070665_100618772 | Ga0070665_1006187721 | 161 |
| 36 | 3300005841 | Ga0068863_100097192 | Ga0068863_1000971922 | 161 |
| 37 | 3300005843 | Ga0068860_100000356 | Ga0068860_10000035631 | 161 |
| 38 | 3300005844 | Ga0068862_100000343 | Ga0068862_10000034319 | 161 |
| 39 | 3300006163 | Ga0070715_10214806 | Ga0070715_102148062 | 161 |
| 40 | 3300006173 | Ga0070716_100121321 | Ga0070716_1001213213 | 161 |
| 41 | 3300006852 | Ga0075433_10223899 | Ga0075433_102238992 | 161 |
| 42 | 3300006871 | Ga0075434_100011586 | Ga0075434_1000115863 | 161 |
| 43 | 3300006871 | Ga0075434_100728499 | Ga0075434_1007284992 | 161 |
| 44 | 3300006914 | Ga0075436_100011620 | Ga0075436_1000116202 | 161 |
| 45 | 3300006914 | Ga0075436_100237070 | Ga0075436_1002370702 | 161 |
| 46 | 3300007076 | Ga0075435_100268587 | Ga0075435_1002685872 | 161 |
| 47 | 3300007076 | Ga0075435_100390339 | Ga0075435_1003903392 | 161 |
| 48 | 3300009093 | Ga0105240_10431933 | Ga0105240_104319332 | 161 |
| 49 | 3300009094 | Ga0111539_10065211 | Ga0111539_100652113 | 161 |
| 50 | 3300009098 | Ga0105245_10016652 | Ga0105245_100166524 | 161 |
| 51 | 3300009098 | Ga0105245_10307369 | Ga0105245_103073692 | 161 |
| 52 | 3300009147 | Ga0114129_10317568 | Ga0114129_103175683 | 161 |
| 53 | 3300009176 | Ga0105242_10421621 | Ga0105242_104216212 | 161 |
| 54 | 3300009177 | Ga0105248_11205881 | Ga0105248_112058812 | 161 |
| 55 | 3300009551 | Ga0105238_10068419 | Ga0105238_100684194 | 161 |
| 56 | 3300009553 | Ga0105249_10019529 | Ga0105249_100195294 | 161 |
| 57 | 3300010375 | Ga0105239_10687493 | Ga0105239_106874932 | 161 |
| 58 | 3300013296 | Ga0157374_10010104 | Ga0157374_100101045 | 161 |
| 59 | 3300013306 | Ga0163162_10053617 | Ga0163162_100536174 | 161 |
| 60 | 3300013308 | Ga0157375_10430797 | Ga0157375_104307972 | 161 |
| 61 | 3300014325 | Ga0163163_11798159 | Ga0163163_117981592 | 161 |
| 62 | 3300014326 | Ga0157380_11537190 | Ga0157380_115371901 | 161 |
| 63 | 3300014968 | Ga0157379_10363641 | Ga0157379_103636411 | 161 |
| 64 | 3300021361 | Ga0213872_10000797 | Ga0213872_1000079714 | 161 |
| 65 | 3300021361 | Ga0213872_10271293 | Ga0213872_102712931 | 161 |
| 66 | 3300025903 | Ga0207680_10330157 | Ga0207680_103301572 | 161 |
| 67 | 3300025905 | Ga0207685_10710575 | Ga0207685_107105751 | 161 |
| 68 | 3300025906 | Ga0207699_10889894 | Ga0207699_108898941 | 161 |
| 69 | 3300025907 | Ga0207645_10046961 | Ga0207645_100469613 | 161 |
| 70 | 3300025918 | Ga0207662_10421659 | Ga0207662_104216592 | 161 |
| 71 | 3300025923 | Ga0207681_10000025 | Ga0207681_10000025169 | 161 |
| 72 | 3300025924 | Ga0207694_10500685 | Ga0207694_105006851 | 161 |
| 73 | 3300025927 | Ga0207687_10009583 | Ga0207687_100095834 | 161 |
| 74 | 3300025928 | Ga0207700_11505197 | Ga0207700_115051971 | 161 |
| 75 | 3300025936 | Ga0207670_10377253 | Ga0207670_103772532 | 161 |
| 76 | 3300025937 | Ga0207669_11306987 | Ga0207669_113069871 | 161 |
| 77 | 3300025939 | Ga0207665_10184187 | Ga0207665_101841871 | 161 |
| 78 | 3300025960 | Ga0207651_10031855 | Ga0207651_100318554 | 161 |
| 79 | 3300025961 | Ga0207712_10028704 | Ga0207712_100287042 | 161 |
| 80 | 3300026023 | Ga0207677_10371411 | Ga0207677_103714112 | 161 |
| 81 | 3300028379 | Ga0268266_10003732 | Ga0268266_1000373210 | 161 |
| 82 | 3300028380 | Ga0268265_10000315 | Ga0268265_1000031519 | 161 |
| 83 | 3300028381 | Ga0268264_10000557 | Ga0268264_100005573 | 161 |
| 84 | 3300028800 | Ga0265338_10220418 | Ga0265338_102204182 | 161 |
| 85 | 3300031239 | Ga0265328_10026857 | Ga0265328_100268572 | 161 |
| 86 | 3300031249 | Ga0265339_10005378 | Ga0265339_100053786 | 161 |
| 87 | 3300031616 | Ga0307508_10056250 | Ga0307508_100562502 | 161 |
| 88 | 3300031665 | Ga0316575_10140088 | Ga0316575_101400882 | 161 |
| 89 | 3300032004 | Ga0307414_10132833 | Ga0307414_101328332 | 161 |
| 90 | 3300032004 | Ga0307414_10142388 | Ga0307414_101423882 | 161 |
| 91 | 3300035085 | Ga0373929_0000004 | Ga0373929_0000004_97638_98135 | 161 |
| 92 | 3300035241 | Ga0373961_0000896 | Ga0373961_0000896_8195_8695 | 161 |
| 93 | 3300035724 | Ga0373933_0364169 | Ga0373933_0364169_116_610 | 161 |
| 94 | 3300039447 | Ga0436361_0194134 | Ga0436361_0194134_710_1195 | 161 |
| 95 | 3300039447 | Ga0436361_0269507 | Ga0436361_0269507_25402_26049 | 161 |
| 96 | 3300039447 | Ga0436361_0856436 | Ga0436361_0856436_73549_74034 | 161 |
| 97 | 3300041451 | Ga0451791_0023732 | Ga0451791_0023732_170_670 | 161 |
| 98 | 3300041452 | Ga0451793_0792451 | Ga0451793_0792451_92_592 | 161 |
| 99 | 3300041486 | Ga0451807_1065197 | Ga0451807_1065197_507_1004 | 161 |
| 100 | 3300041505 | Ga0451849_0602241 | Ga0451849_0602241_129_626 | 161 |
| 101 | 3300042876 | Ga0451577_0250813 | Ga0451577_0250813_992_1489 | 161 |
| 102 | 3300044694 | Ga0466963_0190630 | Ga0466963_0190630_412_909 | 161 |
| 103 | 3300044712 | Ga0453684_0000768 | Ga0453684_0000768_18651_19136 | 161 |
| 104 | 3300044712 | Ga0453684_0433320 | Ga0453684_0433320_409_906 | 161 |
| 105 | 3300046492 | Ga0495585_0036564 | Ga0495585_0036564_1661_2146 | 161 |
| 106 | 3300046501 | Ga0495607_0293115 | Ga0495607_0293115_155_640 | 161 |
| 107 | 3300046507 | Ga0495606_0000787 | Ga0495606_0000787_47604_48089 | 161 |
| 108 | 3300046558 | Ga0495633_0040605 | Ga0495633_0040605_1182_1667 | 161 |
| 109 | 3300046615 | Ga0495656_0308606 | Ga0495656_0308606_305_790 | 161 |
| 110 | 3300046616 | Ga0495668_0060839 | Ga0495668_0060839_44_529 | 161 |
| 111 | 3300046648 | Ga0495611_0107299 | Ga0495611_0107299_563_1048 | 161 |
| 112 | 3300046665 | Ga0495661_0005359 | Ga0495661_0005359_7895_8380 | 161 |
| 113 | 3300047323 | Ga0495683_0084531 | Ga0495683_0084531_867_1352 | 161 |
| 114 | 3300047472 | Ga0495686_0418286 | Ga0495686_0418286_57_557 | 161 |
| 115 | 3300048090 | Ga0495615_0208445 | Ga0495615_0208445_49_534 | 161 |
| 116 | 3300048091 | Ga0495626_0167469 | Ga0495626_0167469_261_746 | 161 |
| 117 | 3300048903 | Ga0496100_0035471 | Ga0496100_0035471_2468_2962 | 161 |
| 118 | 3300048907 | Ga0496104_1146079 | Ga0496104_1146079_114_608 | 161 |
| 119 | 3300048908 | Ga0496105_0450953 | Ga0496105_0450953_243_743 | 161 |
| 120 | 3300048912 | Ga0496109_1123005 | Ga0496109_1123005_114_611 | 161 |
| 121 | 3300048917 | Ga0496114_0000073 | Ga0496114_0000073_62818_63315 | 161 |
| 122 | 3300048918 | Ga0496115_0013709 | Ga0496115_0013709_4979_5473 | 161 |
| 123 | 3300048918 | Ga0496115_0341934 | Ga0496115_0341934_398_883 | 161 |
| 124 | 3300049583 | Ga0501067_0076576 | Ga0501067_0076576_513_1010 | 161 |
| 125 | 3300049585 | Ga0501069_0353289 | Ga0501069_0353289_200_685 | 161 |
| 126 | 3300049586 | Ga0501070_0179194 | Ga0501070_0179194_348_833 | 161 |
| 127 | 3300049586 | Ga0501070_0305851 | Ga0501070_0305851_125_610 | 161 |
| 128 | 3300049590 | Ga0501074_0067053 | Ga0501074_0067053_1711_2196 | 161 |
| 129 | 3300049591 | Ga0501075_0073395 | Ga0501075_0073395_845_1342 | 161 |
| 130 | 3300049593 | Ga0501077_0000046 | Ga0501077_0000046_31396_31893 | 161 |
| 131 | 3300049677 | Ga0501247_026468 | Ga0501247_026468_66_563 | 161 |
| 132 | 3300049742 | Ga0501080_0767471 | Ga0501080_0767471_190_675 | 161 |
| 133 | 3300049743 | Ga0501081_0432685 | Ga0501081_0432685_274_768 | 161 |
| 134 | 3300049744 | Ga0501083_0000445 | Ga0501083_0000445_12143_12640 | 161 |
| 135 | 3300050511 | nmdc:mga08y16_108174_c1 | nmdc:mga08y16_108174_c1_510_1007 | 161 |
| 136 | 3300050512 | nmdc:mga0n895_15023_c1 | nmdc:mga0n895_15023_c1_1681_2181 | 161 |
| 137 | 3300050512 | nmdc:mga0n895_49490_c1 | nmdc:mga0n895_49490_c1_854_1354 | 161 |
| 138 | 3300050513 | nmdc:mga0rr50_116409_c1 | nmdc:mga0rr50_116409_c1_1384_1884 | 161 |
| 139 | 3300050513 | nmdc:mga0rr50_233939_c1 | nmdc:mga0rr50_233939_c1_480_977 | 161 |
| 140 | 3300050513 | nmdc:mga0rr50_246859_c1 | nmdc:mga0rr50_246859_c1_605_1102 | 161 |
| 141 | 3300050514 | nmdc:mga08x19_529_c1 | nmdc:mga08x19_529_c1_5524_6021 | 161 |
| 142 | 3300050515 | nmdc:mga0a205_195779_c1 | nmdc:mga0a205_195779_c1_671_1171 | 161 |
| 143 | 3300053083 | Ga0495655_0010346 | Ga0495655_0010346_1150_1650 | 161 |
| 144 | 3300060353 | Ga0501082_0003647 | Ga0501082_0003647_12122_12619 | 161 |
| 145 | 3300028666 | Ga0265336_10000435 | Ga0265336_1000043511 | 162 |
| 146 | 3300028666 | Ga0265336_10194909 | Ga0265336_101949091 | 162 |
| 147 | 3300028800 | Ga0265338_10313199 | Ga0265338_103131992 | 162 |
| 148 | 3300029957 | Ga0265324_10000775 | Ga0265324_1000077511 | 162 |
| 149 | 3300029957 | Ga0265324_10005714 | Ga0265324_100057146 | 162 |
| 150 | 3300029957 | Ga0265324_10013633 | Ga0265324_100136334 | 162 |
| 151 | 3300031241 | Ga0265325_10002082 | Ga0265325_100020827 | 162 |
| 152 | 3300031250 | Ga0265331_10004158 | Ga0265331_100041586 | 162 |
| 153 | 3300031250 | Ga0265331_10013874 | Ga0265331_100138745 | 162 |
| 154 | 3300031250 | Ga0265331_10060972 | Ga0265331_100609722 | 162 |
| 155 | 3300031251 | Ga0265327_10000715 | Ga0265327_1000071534 | 162 |
| 156 | 3300031251 | Ga0265327_10009939 | Ga0265327_100099398 | 162 |
| 157 | 3300031251 | Ga0265327_10160765 | Ga0265327_101607652 | 162 |
| 158 | 3300031344 | Ga0265316_10394644 | Ga0265316_103946442 | 162 |
| 159 | 3300031665 | Ga0316575_10000309 | Ga0316575_100003097 | 162 |
| 160 | 3300031711 | Ga0265314_10001294 | Ga0265314_1000129425 | 162 |
| 161 | 3300032133 | Ga0316583_10009359 | Ga0316583_100093592 | 162 |
| 162 | 3300036647 | Ga0316582_0241561 | Ga0316582_0241561_322_915 | 162 |
| 163 | 3300042876 | Ga0451577_0000080 | Ga0451577_0000080_64566_65054 | 162 |
| 164 | 3300042876 | Ga0451577_0004030 | Ga0451577_0004030_55_543 | 162 |
| 165 | 3300042876 | Ga0451577_0013690 | Ga0451577_0013690_5760_6248 | 162 |
| 166 | 3300044673 | Ga0453683_0000049 | Ga0453683_0000049_64566_65054 | 162 |
| 167 | 3300044673 | Ga0453683_0067965 | Ga0453683_0067965_1140_1628 | 162 |
| 168 | 3300044712 | Ga0453684_0000237 | Ga0453684_0000237_86681_87169 | 162 |
| 169 | 3300044712 | Ga0453684_0000286 | Ga0453684_0000286_152981_153469 | 162 |
| 170 | 3300044712 | Ga0453684_0087887 | Ga0453684_0087887_313_801 | 162 |
| 171 | 3300044712 | Ga0453684_0365336 | Ga0453684_0365336_638_1126 | 162 |
| 172 | 3300044712 | Ga0453684_1693000 | Ga0453684_1693000_12_500 | 162 |
| 173 | 3300045051 | Ga0451576_0000013 | Ga0451576_0000013_476254_476742 | 162 |
| 174 | 3300045051 | Ga0451576_0000102 | Ga0451576_0000102_64566_65054 | 162 |
| 175 | 3300045051 | Ga0451576_0062968 | Ga0451576_0062968_3305_3850 | 162 |
| 176 | 3300045051 | Ga0451576_0146389 | Ga0451576_0146389_1666_2154 | 162 |
| 177 | 3300049568 | Ga0501031_0334378 | Ga0501031_0334378_108_596 | 162 |
| 178 | 3300049571 | Ga0501034_0633183 | Ga0501034_0633183_378_866 | 162 |
| 179 | 3300049574 | Ga0501038_0071753 | Ga0501038_0071753_1358_1846 | 162 |
| 180 | 3300049575 | Ga0501039_0830190 | Ga0501039_0830190_214_702 | 162 |
| 181 | 3300049579 | Ga0501043_0715525 | Ga0501043_0715525_219_707 | 162 |
| 182 | 3300049822 | Ga0501035_0146165 | Ga0501035_0146165_903_1391 | 162 |
| 183 | 3300031852 | Ga0307410_11277729 | Ga0307410_112777291 | 163 |
| 184 | 3300031903 | Ga0307407_10489077 | Ga0307407_104890772 | 163 |
| 185 | 3300032005 | Ga0307411_11208806 | Ga0307411_112088061 | 163 |
| 186 | 3300037418 | Ga0395900_0185778 | Ga0395900_0185778_1433_1930 | 163 |
| 187 | 3300037471 | Ga0395905_0000643 | Ga0395905_0000643_30283_30780 | 163 |
| 188 | 3300037471 | Ga0395905_0080867 | Ga0395905_0080867_370_867 | 163 |
| 189 | 3300048903 | Ga0496100_0021661 | Ga0496100_0021661_899_1396 | 163 |
| 190 | 3300048909 | Ga0496106_0558701 | Ga0496106_0558701_191_688 | 163 |
| 191 | 3300002705 | JGI25156J39149_1000157 | JGI25156J39149_100015716 | 164 |
| 192 | 3300002738 | JGI25154J39366_1000959 | JGI25154J39366_10009594 | 164 |
| 193 | 3300002741 | JGI25157J39369_1000114 | JGI25157J39369_100011431 | 164 |
| 194 | 3300002741 | JGI25157J39369_1000232 | JGI25157J39369_100023232 | 164 |
| 195 | 3300002772 | JGI25164J39214_1003953 | JGI25164J39214_10039532 | 164 |
| 196 | 3300003316 | rootH1_10017942 | rootH1_100179422 | 164 |
| 197 | 3300003320 | rootH2_10004656 | rootH2_1000465611 | 164 |
| 198 | 3300003322 | rootL2_10038102 | rootL2_100381023 | 164 |
| 199 | 3300003323 | rootH1_10072715 | rootH1_100727152 | 164 |
| 200 | 3300003323 | rootH1_10072716 | rootH1_100727162 | 164 |
| 201 | 3300003756 | Ga0055533_1000024 | Ga0055533_1000024146 | 164 |
| 202 | 3300003759 | Ga0055525_1001136 | Ga0055525_10011362 | 164 |
| 203 | 3300005327 | Ga0070658_10192674 | Ga0070658_101926742 | 164 |
| 204 | 3300005327 | Ga0070658_10643874 | Ga0070658_106438741 | 164 |
| 205 | 3300005329 | Ga0070683_101171939 | Ga0070683_1011719391 | 164 |
| 206 | 3300005330 | Ga0070690_100142129 | Ga0070690_1001421291 | 164 |
| 207 | 3300005334 | Ga0068869_100021352 | Ga0068869_1000213523 | 164 |
| 208 | 3300005339 | Ga0070660_100082443 | Ga0070660_1000824432 | 164 |
| 209 | 3300005344 | Ga0070661_101297497 | Ga0070661_1012974971 | 164 |
| 210 | 3300005364 | Ga0070673_100051278 | Ga0070673_1000512782 | 164 |
| 211 | 3300005366 | Ga0070659_100492219 | Ga0070659_1004922192 | 164 |
| 212 | 3300005459 | Ga0068867_101718311 | Ga0068867_1017183111 | 164 |
| 213 | 3300005466 | Ga0070685_10117504 | Ga0070685_101175042 | 164 |
| 214 | 3300005535 | Ga0070684_100260297 | Ga0070684_1002602972 | 164 |
| 215 | 3300005539 | Ga0068853_100155488 | Ga0068853_1001554882 | 164 |
| 216 | 3300005544 | Ga0070686_100092903 | Ga0070686_1000929032 | 164 |
| 217 | 3300005563 | Ga0068855_100867385 | Ga0068855_1008673852 | 164 |
| 218 | 3300005578 | Ga0068854_100005376 | Ga0068854_1000053763 | 164 |
| 219 | 3300005614 | Ga0068856_100002337 | Ga0068856_1000023373 | 164 |
| 220 | 3300005719 | Ga0068861_100062096 | Ga0068861_1000620962 | 164 |
| 221 | 3300005843 | Ga0068860_100104740 | Ga0068860_1001047402 | 164 |
| 222 | 3300006195 | Ga0075366_10045467 | Ga0075366_100454673 | 164 |
| 223 | 3300009098 | Ga0105245_10897392 | Ga0105245_108973922 | 164 |
| 224 | 3300009176 | Ga0105242_10370842 | Ga0105242_103708422 | 164 |
| 225 | 3300009545 | Ga0105237_11263830 | Ga0105237_112638301 | 164 |
| 226 | 3300009551 | Ga0105238_10055186 | Ga0105238_100551863 | 164 |
| 227 | 3300011119 | Ga0105246_10022454 | Ga0105246_100224543 | 164 |
| 228 | 3300013104 | Ga0157370_10623235 | Ga0157370_106232352 | 164 |
| 229 | 3300013105 | Ga0157369_10176226 | Ga0157369_101762263 | 164 |
| 230 | 3300013308 | Ga0157375_10655849 | Ga0157375_106558492 | 164 |
| 231 | 3300020070 | Ga0206356_11466010 | Ga0206356_114660101 | 164 |
| 232 | 3300025226 | Ga0209674_100007 | Ga0209674_100007190 | 164 |
| 233 | 3300025230 | Ga0209563_100060 | Ga0209563_10006078 | 164 |
| 234 | 3300025231 | Ga0207427_100806 | Ga0207427_1008067 | 164 |
| 235 | 3300025242 | Ga0209258_100926 | Ga0209258_1009264 | 164 |
| 236 | 3300025246 | Ga0209646_1000056 | Ga0209646_100005624 | 164 |
| 237 | 3300025250 | Ga0209026_1000009 | Ga0209026_1000009224 | 164 |
| 238 | 3300025253 | Ga0209677_100088 | Ga0209677_10008862 | 164 |
| 239 | 3300025253 | Ga0209677_100112 | Ga0209677_10011221 | 164 |
| 240 | 3300025256 | Ga0209759_1000035 | Ga0209759_1000035239 | 164 |
| 241 | 3300025256 | Ga0209759_1002512 | Ga0209759_10025124 | 164 |
| 242 | 3300025256 | Ga0209759_1012711 | Ga0209759_10127113 | 164 |
| 243 | 3300025909 | Ga0207705_10059645 | Ga0207705_100596452 | 164 |
| 244 | 3300025909 | Ga0207705_10726734 | Ga0207705_107267341 | 164 |
| 245 | 3300025913 | Ga0207695_10104400 | Ga0207695_101044002 | 164 |
| 246 | 3300025914 | Ga0207671_10093020 | Ga0207671_100930202 | 164 |
| 247 | 3300025919 | Ga0207657_10225697 | Ga0207657_102256972 | 164 |
| 248 | 3300025924 | Ga0207694_10013375 | Ga0207694_100133753 | 164 |
| 249 | 3300025927 | Ga0207687_10663276 | Ga0207687_106632762 | 164 |
| 250 | 3300025932 | Ga0207690_10008610 | Ga0207690_100086107 | 164 |
| 251 | 3300025932 | Ga0207690_11219926 | Ga0207690_112199261 | 164 |
| 252 | 3300025934 | Ga0207686_10456659 | Ga0207686_104566592 | 164 |
| 253 | 3300025942 | Ga0207689_10016366 | Ga0207689_100163663 | 164 |
| 254 | 3300025949 | Ga0207667_10372016 | Ga0207667_103720162 | 164 |
| 255 | 3300025960 | Ga0207651_10035821 | Ga0207651_100358214 | 164 |
| 256 | 3300025981 | Ga0207640_10028604 | Ga0207640_100286043 | 164 |
| 257 | 3300026041 | Ga0207639_10301249 | Ga0207639_103012492 | 164 |
| 258 | 3300026067 | Ga0207678_10617706 | Ga0207678_106177062 | 164 |
| 259 | 3300026078 | Ga0207702_10000501 | Ga0207702_1000050127 | 164 |
| 260 | 3300026118 | Ga0207675_100376961 | Ga0207675_1003769612 | 164 |
| 261 | 3300026142 | Ga0207698_10128363 | Ga0207698_101283633 | 164 |
| 262 | 3300028381 | Ga0268264_10094978 | Ga0268264_100949783 | 164 |
| 263 | 3300028666 | Ga0265336_10000039 | Ga0265336_100000398 | 164 |
| 264 | 3300029957 | Ga0265324_10003205 | Ga0265324_100032053 | 164 |
| 265 | 3300035086 | Ga0373934_0044961 | Ga0373934_0044961_1029_1523 | 164 |
| 266 | 3300037312 | Ga0395899_0259226 | Ga0395899_0259226_420_914 | 164 |
| 267 | 3300037312 | Ga0395899_0601939 | Ga0395899_0601939_65_559 | 164 |
| 268 | 3300037466 | Ga0395898_0006486 | Ga0395898_0006486_3695_4189 | 164 |
| 269 | 3300038443 | Ga0395901_0003254 | Ga0395901_0003254_10277_10771 | 164 |
| 270 | 3300039447 | Ga0436361_0264199 | Ga0436361_0264199_371_865 | 164 |
| 271 | 3300044656 | Ga0466969_0023886 | Ga0466969_0023886_1345_1839 | 164 |
| 272 | 3300044683 | Ga0466965_0011132 | Ga0466965_0011132_2545_3039 | 164 |
| 273 | 3300044684 | Ga0466966_0002135 | Ga0466966_0002135_294_788 | 164 |
| 274 | 3300044693 | Ga0466961_0035111 | Ga0466961_0035111_1028_1522 | 164 |
| 275 | 3300044694 | Ga0466963_0285439 | Ga0466963_0285439_615_1109 | 164 |
| 276 | 3300044706 | Ga0466964_0028444 | Ga0466964_0028444_438_932 | 164 |
| 277 | 3300044735 | Ga0466968_0027888 | Ga0466968_0027888_1806_2300 | 164 |
| 278 | 3300044765 | Ga0466970_0024507 | Ga0466970_0024507_2190_2684 | 164 |
| 279 | 3300044842 | Ga0466957_0024740 | Ga0466957_0024740_2603_3097 | 164 |
| 280 | 3300044901 | Ga0466960_0542250 | Ga0466960_0542250_106_600 | 164 |
| 281 | 3300045049 | Ga0466959_0296111 | Ga0466959_0296111_553_1047 | 164 |
| 282 | 3300048903 | Ga0496100_0868375 | Ga0496100_0868375_175_669 | 164 |
| 283 | 3300050493 | nmdc:mga0k408_11403_c1 | nmdc:mga0k408_11403_c1_2441_2935 | 164 |
| 284 | 3300050496 | nmdc:mga07m45_6415_c1 | nmdc:mga07m45_6415_c1_1764_2408 | 164 |
| 285 | 3300061719 | Ga0466962_0015962 | Ga0466962_0015962_106_600 | 164 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.9132 | 3 | 160 |
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.8972 | 3 | 160 |
| 5b7w-assembly2.cif.gz_B | crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris | 0.8427 | 1 | 160 |
| 5b7w-assembly2.cif.gz_B | crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris | 0.838 | 1 | 160 |
| 4pwu-assembly2.cif.gz_C | crystal structure of a modulator protein mzra (kpn_03524) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.45 a resolution | 0.7529 | 98 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1in0B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9437 | 98 | 160 | 3.30.70.860 |
| 1in0A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.942 | 9 | 95 | 3.30.70.990 |
| 1in0A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.8834 | 9 | 95 | 3.30.70.990 |
| 5b7wB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.8493 | 9 | 94 | 3.30.70.990 |
| 1in0B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8411 | 98 | 160 | 3.30.70.860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0U3F072-F1-model_v4 | UPF0234 protein AT984_11050 | 0.9874 | 1 | 160 |
GO:0000166
GO:0005829 |
| AF-A0A520G4M7-F1-model_v4 | YajQ family cyclic di-GMP-binding protein | 0.9858 | 1 | 130 |
GO:0000166
GO:0005829 |
| AF-A0A0U3F072-F1-model_v4 | UPF0234 protein AT984_11050 | 0.9813 | 1 | 160 |
GO:0000166
GO:0005829 |
| AF-A0A5C6ZYJ0-F1-model_v4 | UPF0234 protein FUT87_06090 | 0.9796 | 1 | 160 |
GO:0000166
GO:0005829 |
| AF-A1TNA0-F1-model_v4 | UPF0234 protein Aave_1854 | 0.9771 | 1 | 160 |
GO:0000166
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar