F386967

General Info

Members Datasets Scaffolds Average Seq Length
285 161 285 235

Family's Representative Sequence

Representative Sequence 3300042439|Ga0439464_0087339|Ga0439464_0087339_113_877
Length 254
Sequence VVTPEGGATATCRRLMADMRSADVLLRLRGVTKDYRSLRPLRIAELDVPTGRSLALVGFDQTMAEVFVDLITGAILPDSGEVVAFGQPTSAIPDRDGWLATLDQFGLFTDRAVLVEQFTVEQNLALPLSVAVEQMSVDMRERVEKLATEVGLTHDLRRQAGVLAPAPRARIRLGRAIALAPKVLVAEHPNATLAADDASALAADISRIVETRGIASIVLTADHAFARAVAKEVLVLEPATGTLKPAAGWRRWFS

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
130 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.75
Rhizosphere 98.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001309 3300002459 Bacteria 5242
2 JGI25406J46586_10002269 3300003203 Bacteria 9065
3 JGI25406J46586_10013638 3300003203 Bacteria 3482
4 Ga0065714_10135764 3300005288 Bacteria 1209
5 Ga0065712_10000956 3300005290 Bacteria 9274
6 Ga0065712_10084703 3300005290 Bacteria 2746
7 Ga0065715_10002217 3300005293 Bacteria 5706
8 Ga0065715_10143052 3300005293 Bacteria 1825
9 Ga0065715_10202890 3300005293 Bacteria 1352
10 Ga0065707_10000688 3300005295 Bacteria 17386
11 Ga0065707_10227950 3300005295 Bacteria 1199
12 Ga0065707_10459361 3300005295 Unclassified 793
13 Ga0070658_10615866 3300005327 Bacteria 941
14 Ga0070676_10010333 3300005328 Bacteria 5063
15 Ga0070683_100160503 3300005329 Unclassified 2133
16 Ga0070690_100006932 3300005330 Bacteria 6448
17 Ga0070670_100208900 3300005331 Unclassified 1697
18 Ga0070670_100265505 3300005331 Unclassified 1497
19 Ga0070670_100401514 3300005331 Unclassified 1210
20 Ga0070677_10002455 3300005333 Bacteria 5928
21 Ga0070677_10028554 3300005333 Bacteria 2109
22 Ga0068869_100006683 3300005334 Bacteria 7326
23 Ga0068869_100031462 3300005334 Bacteria 3733
24 Ga0070666_10005709 3300005335 Bacteria 7636
25 Ga0070666_10016971 3300005335 Bacteria 4662
26 Ga0070680_100106740 3300005336 Unclassified 2329
27 Ga0070660_100229816 3300005339 Unclassified 1509
28 Ga0070689_100481307 3300005340 Bacteria 1060
29 Ga0070689_100695777 3300005340 Bacteria 887
30 Ga0070687_100019032 3300005343 Unclassified 3188
31 Ga0070687_100023435 3300005343 Bacteria 2934
32 Ga0070687_100163415 3300005343 Bacteria 1318
33 Ga0070692_10092220 3300005345 Bacteria 1648
34 Ga0070669_100016973 3300005353 Bacteria 5198
35 Ga0070669_100069501 3300005353 Unclassified 2601
36 Ga0070669_100077633 3300005353 Bacteria 2467
37 Ga0070669_100191047 3300005353 Bacteria 1606
38 Ga0070669_100707628 3300005353 Unclassified 851
39 Ga0070675_100066279 3300005354 Bacteria 2986
40 Ga0070675_100099991 3300005354 Bacteria 2442
41 Ga0070675_100158262 3300005354 Bacteria 1946
42 Ga0070671_100352537 3300005355 Bacteria 1256
43 Ga0070674_100012439 3300005356 Bacteria 5227
44 Ga0070673_100014303 3300005364 Bacteria 5520
45 Ga0070673_100331567 3300005364 Bacteria 1346
46 Ga0070688_100022258 3300005365 Unclassified 3710
47 Ga0070659_100023014 3300005366 Unclassified 4764
48 Ga0070667_100009583 3300005367 Bacteria 8030
49 Ga0070701_10191035 3300005438 Bacteria 1205
50 Ga0070711_100187494 3300005439 Archaea 1587
51 Ga0070700_100037258 3300005441 Unclassified 2956
52 Ga0070700_100043029 3300005441 Bacteria 2776
53 Ga0070694_100170789 3300005444 Bacteria 1602
54 Ga0070663_100091370 3300005455 Bacteria 2255
55 Ga0070678_100063544 3300005456 Bacteria 2732
56 Ga0070662_100019875 3300005457 Unclassified 4568
57 Ga0070662_100033931 3300005457 Bacteria 3597
58 Ga0070662_100500351 3300005457 Bacteria 1014
59 Ga0070681_10015746 3300005458 Bacteria 7537
60 Ga0068867_100091406 3300005459 Bacteria 2310
61 Ga0068867_100464033 3300005459 Bacteria 1082
62 Ga0070685_10005822 3300005466 Bacteria 6267
63 Ga0070685_10168536 3300005466 Bacteria 1402
64 Ga0070698_100205254 3300005471 Bacteria 1906
65 Ga0070698_100315775 3300005471 Bacteria 1493
66 Ga0070684_100439539 3300005535 Bacteria 1205
67 Ga0070672_100021626 3300005543 Bacteria 4711
68 Ga0070672_100041819 3300005543 Unclassified 3526
69 Ga0070672_100706046 3300005543 Unclassified 883
70 Ga0070686_100005388 3300005544 Bacteria 7078
71 Ga0070686_100469333 3300005544 Bacteria 971
72 Ga0070665_100031900 3300005548 Bacteria 5303
73 Ga0070665_100282314 3300005548 Bacteria 1662
74 Ga0070704_100096955 3300005549 Bacteria 2212
75 Ga0070704_100477602 3300005549 Unclassified 1078
76 Ga0070664_100006126 3300005564 Bacteria 9729
77 Ga0070702_100035610 3300005615 Bacteria 2751
78 Ga0070702_100292598 3300005615 Unclassified 1123
79 Ga0068859_100024267 3300005617 Bacteria 6085
80 Ga0068859_100143095 3300005617 Bacteria 2465
81 Ga0068859_100159470 3300005617 Bacteria 2335
82 Ga0068859_100167664 3300005617 Bacteria 2276
83 Ga0068859_100433430 3300005617 Bacteria 1411
84 Ga0068864_100026309 3300005618 Bacteria 4907
85 Ga0068864_100761176 3300005618 Unclassified 950
86 Ga0068861_100075638 3300005719 Unclassified 2622
87 Ga0068861_100124696 3300005719 Bacteria 2083
88 Ga0068861_100138791 3300005719 Bacteria 1982
89 Ga0068870_10030152 3300005840 Bacteria 2740
90 Ga0068870_10119424 3300005840 Bacteria 1516
91 Ga0068863_100009818 3300005841 Bacteria 9326
92 Ga0068863_100530056 3300005841 Unclassified 1162
93 Ga0068858_100075701 3300005842 Unclassified 3126
94 Ga0068860_100013602 3300005843 Bacteria 7977
95 Ga0068862_100030212 3300005844 Unclassified 4566
96 Ga0068862_100219510 3300005844 Bacteria 1721
97 Ga0081539_10000024 3300005985 Bacteria 354702
98 Ga0081539_10000222 3300005985 Bacteria 133128
99 Ga0081539_10004972 3300005985 Bacteria 14088
100 Ga0097621_100002410 3300006237 Bacteria 12807
101 Ga0097621_100041229 3300006237 Unclassified 3715
102 Ga0097621_100550328 3300006237 Unclassified 1050
103 Ga0068871_100093812 3300006358 Unclassified 2505
104 Ga0068871_100095668 3300006358 Unclassified 2480
105 Ga0068871_100500318 3300006358 Unclassified 1095
106 Ga0075428_100000076 3300006844 Bacteria 81732
107 Ga0075428_100004507 3300006844 Bacteria 15383
108 Ga0075428_100365557 3300006844 Bacteria 1547
109 Ga0075430_100012838 3300006846 Bacteria 7139
110 Ga0075430_100104648 3300006846 Bacteria 2363
111 Ga0075430_100370530 3300006846 Bacteria 1182
112 Ga0075431_100000501 3300006847 Bacteria 32696
113 Ga0075431_100066859 3300006847 Bacteria 3711
114 Ga0075433_10067179 3300006852 Unclassified 3147
115 Ga0075434_100048104 3300006871 Bacteria 4232
116 Ga0075434_100258435 3300006871 Bacteria 1760
117 Ga0075429_100075010 3300006880 Unclassified 2946
118 Ga0075429_100095238 3300006880 Bacteria 2596
119 Ga0075429_100122628 3300006880 Bacteria 2272
120 Ga0068865_100387393 3300006881 Unclassified 1142
121 Ga0097620_100024267 3300006931 Bacteria 6085
122 Ga0097620_100143085 3300006931 Bacteria 2465
123 Ga0097620_100159469 3300006931 Bacteria 2335
124 Ga0097620_100167667 3300006931 Bacteria 2276
125 Ga0097620_100433424 3300006931 Bacteria 1411
126 Ga0075435_100025636 3300007076 Bacteria 4591
127 Ga0111539_10000010 3300009094 Bacteria 366246
128 Ga0111539_10002377 3300009094 Bacteria 24991
129 Ga0111539_10004477 3300009094 Bacteria 18271
130 Ga0111539_10074826 3300009094 Bacteria 3991
131 Ga0111539_10331279 3300009094 Unclassified 1772
132 Ga0111539_10660070 3300009094 Bacteria 1218
133 Ga0111539_10886701 3300009094 Bacteria 1038
134 Ga0111539_11178425 3300009094 Bacteria 890
135 Ga0114129_10002083 3300009147 Bacteria 27496
136 Ga0105248_10016155 3300009177 Bacteria 8213
137 Ga0105248_10026197 3300009177 Bacteria 6487
138 Ga0105249_10332812 3300009553 Bacteria 1533
139 Ga0099796_10112411 3300010159 Bacteria 1038
140 Ga0157375_10046271 3300013308 Bacteria 4240
141 Ga0157380_10017200 3300014326 Bacteria 5348
142 Ga0157380_10039215 3300014326 Bacteria 3682
143 Ga0157380_10105936 3300014326 Bacteria 2352
144 Ga0157377_10010273 3300014745 Unclassified 4625
145 Ga0157377_10104880 3300014745 Unclassified 1691
146 Ga0157379_10019837 3300014968 Bacteria 5940
147 Ga0157376_10060384 3300014969 Bacteria 3183
148 Ga0157376_10357472 3300014969 Bacteria 1400
149 Ga0157376_10717993 3300014969 Unclassified 1006
150 Ga0163161_10160315 3300017792 Bacteria 1715
151 Ga0163161_10500433 3300017792 Bacteria 989
152 Ga0207697_10000148 3300025315 Bacteria 34368
153 Ga0207697_10119843 3300025315 Unclassified 1131
154 Ga0207682_10001026 3300025893 Bacteria 12922
155 Ga0207682_10016003 3300025893 Bacteria 2923
156 Ga0207682_10017331 3300025893 Bacteria 2813
157 Ga0207688_10006434 3300025901 Bacteria 6398
158 Ga0207688_10008902 3300025901 Bacteria 5462
159 Ga0207680_10004481 3300025903 Bacteria 6627
160 Ga0207680_10049509 3300025903 Bacteria 2501
161 Ga0207645_10000577 3300025907 Bacteria 30396
162 Ga0207645_10057469 3300025907 Bacteria 2483
163 Ga0207643_10001118 3300025908 Bacteria 15933
164 Ga0207643_10006580 3300025908 Bacteria 6230
165 Ga0207643_10018489 3300025908 Bacteria 3816
166 Ga0207707_10018192 3300025912 Bacteria 6124
167 Ga0207662_10031361 3300025918 Unclassified 3088
168 Ga0207662_10034960 3300025918 Bacteria 2934
169 Ga0207657_10456755 3300025919 Bacteria 1002
170 Ga0207652_10107726 3300025921 Unclassified 2468
171 Ga0207681_10005245 3300025923 Bacteria 7961
172 Ga0207681_10021662 3300025923 Bacteria 4089
173 Ga0207681_10254825 3300025923 Bacteria 1371
174 Ga0207650_10196242 3300025925 Bacteria 1615
175 Ga0207659_10019942 3300025926 Unclassified 4423
176 Ga0207659_10081654 3300025926 Bacteria 2391
177 Ga0207659_10226054 3300025926 Bacteria 1507
178 Ga0207659_10283631 3300025926 Bacteria 1355
179 Ga0207644_10276020 3300025931 Bacteria 1348
180 Ga0207690_10017268 3300025932 Bacteria 4403
181 Ga0207706_10062477 3300025933 Bacteria 3280
182 Ga0207706_10515365 3300025933 Bacteria 1031
183 Ga0207706_10552739 3300025933 Bacteria 991
184 Ga0207670_10074050 3300025936 Bacteria 2363
185 Ga0207669_10005661 3300025937 Bacteria 5634
186 Ga0207669_10232695 3300025937 Bacteria 1360
187 Ga0207691_10004463 3300025940 Bacteria 13556
188 Ga0207691_10139098 3300025940 Bacteria 2140
189 Ga0207691_10570871 3300025940 Unclassified 959
190 Ga0207711_10540220 3300025941 Bacteria 1087
191 Ga0207689_10028532 3300025942 Bacteria 4669
192 Ga0207689_10125590 3300025942 Bacteria 2111
193 Ga0207679_10041870 3300025945 Bacteria 3288
194 Ga0207712_10036176 3300025961 Unclassified 3361
195 Ga0207712_10222718 3300025961 Bacteria 1509
196 Ga0207658_10106232 3300025986 Unclassified 2210
197 Ga0207677_10148575 3300026023 Bacteria 1804
198 Ga0207703_10260448 3300026035 Bacteria 1567
199 Ga0207703_10387565 3300026035 Unclassified 1294
200 Ga0207678_10104153 3300026067 Bacteria 2421
201 Ga0207708_10015129 3300026075 Bacteria 5781
202 Ga0207708_10040767 3300026075 Unclassified 3541
203 Ga0207708_10149331 3300026075 Bacteria 1838
204 Ga0207641_10218929 3300026088 Bacteria 1764
205 Ga0207648_10023355 3300026089 Bacteria 5542
206 Ga0207648_10240883 3300026089 Bacteria 1610
207 Ga0207674_10444049 3300026116 Bacteria 1254
208 Ga0207675_100002044 3300026118 Bacteria 20130
209 Ga0207675_100045389 3300026118 Bacteria 4105
210 Ga0207675_100095724 3300026118 Unclassified 2794
211 Ga0207675_100319951 3300026118 Bacteria 1514
212 Ga0207683_10021778 3300026121 Bacteria 5495
213 Ga0207683_10046198 3300026121 Bacteria 3810
214 Ga0207683_10491200 3300026121 Unclassified 1133
215 Ga0207698_10101766 3300026142 Bacteria 2383
216 Ga0209971_1007664 3300027682 Bacteria 2562
217 Ga0207428_10000097 3300027907 Bacteria 122738
218 Ga0207428_10009962 3300027907 Bacteria 8508
219 Ga0207428_10343364 3300027907 Bacteria 1099
220 Ga0268265_10013120 3300028380 Bacteria 5628
221 Ga0268265_10018503 3300028380 Bacteria 4830
222 Ga0268265_10026732 3300028380 Bacteria 4108
223 Ga0268265_10356590 3300028380 Bacteria 1337
224 Ga0307408_100289933 3300031548 Bacteria 1366
225 Ga0307406_10024944 3300031901 Bacteria 3575
226 Ga0307412_10055768 3300031911 Unclassified 2630
227 Ga0307409_100016405 3300031995 Bacteria 4899
228 Ga0307416_100001361 3300032002 Bacteria 13193
229 Ga0307416_100008072 3300032002 Bacteria 6750
230 Ga0307414_10670643 3300032004 Bacteria 936
231 Ga0307415_100005514 3300032126 Bacteria 6727
232 Ga0373928_0028965 3300035084 Bacteria 1215
233 Ga0373934_0010883 3300035086 Bacteria 3420
234 Ga0373943_0053043 3300035170 Unclassified 2001
235 Ga0373931_0108374 3300035691 Bacteria 1572
236 Ga0373947_0040231 3300035725 Bacteria 2784
237 Ga0373937_0201523 3300036401 Archaea 1871
238 Ga0439439_0031866 3300041406 Bacteria 1345
239 Ga0451807_1055055 3300041486 Bacteria 1059
240 Ga0439450_011243 3300042008 Bacteria 1749
241 Ga0450920_036249 3300042122 Unclassified 978
242 Ga0439434_0068424 3300042435 Bacteria 1116
243 Ga0439435_0082720 3300042436 Unclassified 965
244 Ga0439464_0087339 3300042439 Unclassified 937
245 Ga0439460_0060903 3300042461 Unclassified 1152
246 Ga0439440_0031243 3300042993 Bacteria 1258
247 Ga0495592_0189473 3300046454 Unclassified 1395
248 Ga0495602_0124943 3300048088 Bacteria 2063
249 Ga0496102_0650020 3300048905 Bacteria 978
250 Ga0496109_0224732 3300048912 Bacteria 1766
251 Ga0496112_0095743 3300048915 Unclassified 2939
252 Ga0496112_0224928 3300048915 Bacteria 1832
253 Ga0501036_0481631 3300049572 Bacteria 1033
254 Ga0501046_0450461 3300049580 Bacteria 926
255 Ga0501046_0726573 3300049580 Bacteria 698
256 Ga0501048_0445488 3300049582 Bacteria 927
257 Ga0501072_0032645 3300049588 Bacteria 4078
258 Ga0501075_0053091 3300049591 Bacteria 3048
259 Ga0501081_0296266 3300049743 Bacteria 1186
260 Ga0501045_0240860 3300049824 Bacteria 1346
261 nmdc:mga09592_103255_c1 3300050508 Bacteria 2442
262 nmdc:mga09592_1151_c1 3300050508 Bacteria 21071
263 nmdc:mga09592_28758_c1 3300050508 Unclassified 4620
264 nmdc:mga0qj67_356381_c1 3300050509 Bacteria 1182
265 nmdc:mga0qj67_8763_c1 3300050509 Bacteria 7507
266 nmdc:mga06r32_77173_c1 3300050510 Unclassified 3236
267 nmdc:mga06r32_82108_c1 3300050510 Bacteria 3139
268 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
269 nmdc:mga08y16_58540_c1 3300050511 Bacteria 4026
270 nmdc:mga08y16_610494_c1 3300050511 Bacteria 1099
271 nmdc:mga08y16_847585_c1 3300050511 Unclassified 903
272 nmdc:mga08y16_8994_c1 3300050511 Bacteria 10490
273 nmdc:mga0n895_132989_c1 3300050512 Bacteria 2513
274 nmdc:mga0n895_163951_c1 3300050512 Bacteria 2254
275 nmdc:mga0rr50_17646_c1 3300050513 Bacteria 4770
276 nmdc:mga0a205_237756_c1 3300050515 Unclassified 1703
277 nmdc:mga0a205_4739_c1 3300050515 Bacteria 12219
278 Ga0495601_0227284 3300053077 Unclassified 1219
279 Ga0495619_0122479 3300053085 Unclassified 1783
280 Ga0590071_000331 3300059421 Bacteria 13900
281 Ga0590074_030340 3300059423 Bacteria 953
282 Ga0590077_000492 3300059426 Bacteria 11076
283 Ga0590077_010545 3300059426 Unclassified 1901
284 Ga0501082_0116650 3300060353 Bacteria 2312
285 Ga0530510_0044925 3300061734 Bacteria 3193

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0726573 Ga0501046_0726573_73_675 200
2 3300050511 nmdc:mga08y16_847585_c1 nmdc:mga08y16_847585_c1_208_810 200
3 3300005617 Ga0068859_100167664 Ga0068859_1001676643 206
4 3300006931 Ga0097620_100167667 Ga0097620_1001676673 206
5 3300009553 Ga0105249_10332812 Ga0105249_103328122 206
6 3300025961 Ga0207712_10222718 Ga0207712_102227182 206
7 3300026075 Ga0207708_10149331 Ga0207708_101493312 206
8 3300042993 Ga0439440_0031243 Ga0439440_0031243_216_971 208
9 3300027682 Ga0209971_1007664 Ga0209971_10076642 209
10 3300032002 Ga0307416_100008072 Ga0307416_1000080724 209
11 3300005353 Ga0070669_100707628 Ga0070669_1007076281 212
12 3300009147 Ga0114129_10002083 Ga0114129_1000208323 212
13 3300006237 Ga0097621_100002410 Ga0097621_10000241013 215
14 3300035084 Ga0373928_0028965 Ga0373928_0028965_420_1130 216
15 3300049580 Ga0501046_0450461 Ga0501046_0450461_144_842 218
16 3300005985 Ga0081539_10004972 Ga0081539_1000497215 226
17 3300042008 Ga0439450_011243 Ga0439450_011243_621_1340 227
18 3300005329 Ga0070683_100160503 Ga0070683_1001605033 230
19 3300006237 Ga0097621_100041229 Ga0097621_1000412293 230
20 3300006358 Ga0068871_100095668 Ga0068871_1000956684 230
21 3300007076 Ga0075435_100025636 Ga0075435_1000256364 230
22 3300036401 Ga0373937_0201523 Ga0373937_0201523_796_1506 230
23 3300050513 nmdc:mga0rr50_17646_c1 nmdc:mga0rr50_17646_c1_2005_2715 230
24 3300005353 Ga0070669_100191047 Ga0070669_1001910472 231
25 3300005441 Ga0070700_100043029 Ga0070700_1000430292 231
26 3300005617 Ga0068859_100143095 Ga0068859_1001430952 231
27 3300005719 Ga0068861_100138791 Ga0068861_1001387913 231
28 3300006847 Ga0075431_100066859 Ga0075431_1000668595 231
29 3300006931 Ga0097620_100143085 Ga0097620_1001430852 231
30 3300026118 Ga0207675_100319951 Ga0207675_1003199512 231
31 3300028380 Ga0268265_10026732 Ga0268265_100267325 231
32 3300050510 nmdc:mga06r32_82108_c1 nmdc:mga06r32_82108_c1_2118_2813 231
33 3300005331 Ga0070670_100265505 Ga0070670_1002655052 232
34 3300005343 Ga0070687_100163415 Ga0070687_1001634152 232
35 3300005471 Ga0070698_100315775 Ga0070698_1003157752 232
36 3300005548 Ga0070665_100031900 Ga0070665_1000319006 232
37 3300006844 Ga0075428_100000076 Ga0075428_10000007660 232
38 3300006844 Ga0075428_100365557 Ga0075428_1003655572 232
39 3300006846 Ga0075430_100370530 Ga0075430_1003705301 232
40 3300006880 Ga0075429_100122628 Ga0075429_1001226283 232
41 3300009094 Ga0111539_10000010 Ga0111539_10000010324 232
42 3300009094 Ga0111539_10886701 Ga0111539_108867012 232
43 3300027907 Ga0207428_10000097 Ga0207428_1000009723 232
44 3300027907 Ga0207428_10343364 Ga0207428_103433642 232
45 3300041486 Ga0451807_1055055 Ga0451807_1055055_154_855 232
46 3300042435 Ga0439434_0068424 Ga0439434_0068424_44_745 232
47 3300050508 nmdc:mga09592_103255_c1 nmdc:mga09592_103255_c1_476_1174 232
48 3300050509 nmdc:mga0qj67_356381_c1 nmdc:mga0qj67_356381_c1_419_1117 232
49 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_137837_138535 232
50 3300050511 nmdc:mga08y16_610494_c1 nmdc:mga08y16_610494_c1_192_893 232
51 3300003203 JGI25406J46586_10002269 JGI25406J46586_100022694 233
52 3300003203 JGI25406J46586_10013638 JGI25406J46586_100136385 233
53 3300005295 Ga0065707_10000688 Ga0065707_100006888 233
54 3300005331 Ga0070670_100401514 Ga0070670_1004015142 233
55 3300005353 Ga0070669_100069501 Ga0070669_1000695014 233
56 3300005471 Ga0070698_100205254 Ga0070698_1002052542 233
57 3300005719 Ga0068861_100075638 Ga0068861_1000756384 233
58 3300005985 Ga0081539_10000024 Ga0081539_10000024193 233
59 3300005985 Ga0081539_10000222 Ga0081539_10000222117 233
60 3300009094 Ga0111539_11178425 Ga0111539_111784252 233
61 3300025933 Ga0207706_10552739 Ga0207706_105527392 233
62 3300026118 Ga0207675_100095724 Ga0207675_1000957244 233
63 3300028380 Ga0268265_10018503 Ga0268265_100185034 233
64 3300005331 Ga0070670_100208900 Ga0070670_1002089002 234
65 3300005543 Ga0070672_100706046 Ga0070672_1007060461 234
66 3300006852 Ga0075433_10067179 Ga0075433_100671792 234
67 3300025925 Ga0207650_10196242 Ga0207650_101962422 234
68 3300025926 Ga0207659_10283631 Ga0207659_102836312 234
69 3300049582 Ga0501048_0445488 Ga0501048_0445488_173_877 234
70 3300049588 Ga0501072_0032645 Ga0501072_0032645_1861_2565 234
71 3300049591 Ga0501075_0053091 Ga0501075_0053091_693_1397 234
72 3300049743 Ga0501081_0296266 Ga0501081_0296266_452_1156 234
73 3300049824 Ga0501045_0240860 Ga0501045_0240860_203_907 234
74 3300050515 nmdc:mga0a205_237756_c1 nmdc:mga0a205_237756_c1_155_883 234
75 3300059426 Ga0590077_010545 Ga0590077_010545_1030_1743 234
76 3300060353 Ga0501082_0116650 Ga0501082_0116650_145_849 234
77 3300061734 Ga0530510_0044925 Ga0530510_0044925_1496_2200 234
78 3300005288 Ga0065714_10135764 Ga0065714_101357642 235
79 3300005290 Ga0065712_10000956 Ga0065712_100009563 235
80 3300005293 Ga0065715_10002217 Ga0065715_100022176 235
81 3300005293 Ga0065715_10202890 Ga0065715_102028901 235
82 3300005295 Ga0065707_10459361 Ga0065707_104593611 235
83 3300005328 Ga0070676_10010333 Ga0070676_100103335 235
84 3300005330 Ga0070690_100006932 Ga0070690_1000069327 235
85 3300005333 Ga0070677_10002455 Ga0070677_100024556 235
86 3300005333 Ga0070677_10028554 Ga0070677_100285542 235
87 3300005334 Ga0068869_100006683 Ga0068869_1000066836 235
88 3300005334 Ga0068869_100031462 Ga0068869_1000314622 235
89 3300005335 Ga0070666_10005709 Ga0070666_100057097 235
90 3300005335 Ga0070666_10016971 Ga0070666_100169714 235
91 3300005340 Ga0070689_100481307 Ga0070689_1004813072 235
92 3300005343 Ga0070687_100019032 Ga0070687_1000190321 235
93 3300005343 Ga0070687_100023435 Ga0070687_1000234352 235
94 3300005345 Ga0070692_10092220 Ga0070692_100922202 235
95 3300005353 Ga0070669_100016973 Ga0070669_1000169734 235
96 3300005353 Ga0070669_100077633 Ga0070669_1000776334 235
97 3300005354 Ga0070675_100066279 Ga0070675_1000662793 235
98 3300005354 Ga0070675_100099991 Ga0070675_1000999912 235
99 3300005354 Ga0070675_100158262 Ga0070675_1001582622 235
100 3300005355 Ga0070671_100352537 Ga0070671_1003525372 235
101 3300005356 Ga0070674_100012439 Ga0070674_1000124394 235
102 3300005364 Ga0070673_100014303 Ga0070673_1000143031 235
103 3300005364 Ga0070673_100331567 Ga0070673_1003315672 235
104 3300005365 Ga0070688_100022258 Ga0070688_1000222582 235
105 3300005367 Ga0070667_100009583 Ga0070667_1000095838 235
106 3300005438 Ga0070701_10191035 Ga0070701_101910351 235
107 3300005441 Ga0070700_100037258 Ga0070700_1000372582 235
108 3300005444 Ga0070694_100170789 Ga0070694_1001707892 235
109 3300005455 Ga0070663_100091370 Ga0070663_1000913702 235
110 3300005456 Ga0070678_100063544 Ga0070678_1000635443 235
111 3300005457 Ga0070662_100019875 Ga0070662_1000198755 235
112 3300005457 Ga0070662_100033931 Ga0070662_1000339312 235
113 3300005459 Ga0068867_100091406 Ga0068867_1000914063 235
114 3300005459 Ga0068867_100464033 Ga0068867_1004640332 235
115 3300005466 Ga0070685_10005822 Ga0070685_100058228 235
116 3300005466 Ga0070685_10168536 Ga0070685_101685362 235
117 3300005535 Ga0070684_100439539 Ga0070684_1004395392 235
118 3300005543 Ga0070672_100021626 Ga0070672_1000216265 235
119 3300005543 Ga0070672_100041819 Ga0070672_1000418195 235
120 3300005544 Ga0070686_100005388 Ga0070686_1000053886 235
121 3300005548 Ga0070665_100282314 Ga0070665_1002823142 235
122 3300005549 Ga0070704_100096955 Ga0070704_1000969551 235
123 3300005564 Ga0070664_100006126 Ga0070664_1000061269 235
124 3300005615 Ga0070702_100035610 Ga0070702_1000356102 235
125 3300005615 Ga0070702_100292598 Ga0070702_1002925982 235
126 3300005617 Ga0068859_100024267 Ga0068859_1000242672 235
127 3300005617 Ga0068859_100159470 Ga0068859_1001594704 235
128 3300005617 Ga0068859_100433430 Ga0068859_1004334302 235
129 3300005618 Ga0068864_100026309 Ga0068864_1000263095 235
130 3300005618 Ga0068864_100761176 Ga0068864_1007611761 235
131 3300005719 Ga0068861_100124696 Ga0068861_1001246963 235
132 3300005840 Ga0068870_10030152 Ga0068870_100301522 235
133 3300005840 Ga0068870_10119424 Ga0068870_101194243 235
134 3300005841 Ga0068863_100009818 Ga0068863_1000098189 235
135 3300005842 Ga0068858_100075701 Ga0068858_1000757013 235
136 3300005843 Ga0068860_100013602 Ga0068860_1000136027 235
137 3300005844 Ga0068862_100030212 Ga0068862_1000302125 235
138 3300005844 Ga0068862_100219510 Ga0068862_1002195103 235
139 3300006846 Ga0075430_100104648 Ga0075430_1001046482 235
140 3300006871 Ga0075434_100048104 Ga0075434_1000481046 235
141 3300006880 Ga0075429_100095238 Ga0075429_1000952382 235
142 3300006881 Ga0068865_100387393 Ga0068865_1003873932 235
143 3300006931 Ga0097620_100024267 Ga0097620_1000242672 235
144 3300006931 Ga0097620_100159469 Ga0097620_1001594694 235
145 3300006931 Ga0097620_100433424 Ga0097620_1004334242 235
146 3300009094 Ga0111539_10002377 Ga0111539_1000237726 235
147 3300009094 Ga0111539_10004477 Ga0111539_100044778 235
148 3300009094 Ga0111539_10074826 Ga0111539_100748265 235
149 3300009094 Ga0111539_10331279 Ga0111539_103312792 235
150 3300009177 Ga0105248_10016155 Ga0105248_100161559 235
151 3300013308 Ga0157375_10046271 Ga0157375_100462712 235
152 3300014326 Ga0157380_10017200 Ga0157380_100172002 235
153 3300014326 Ga0157380_10039215 Ga0157380_100392152 235
154 3300014326 Ga0157380_10105936 Ga0157380_101059365 235
155 3300014745 Ga0157377_10010273 Ga0157377_100102733 235
156 3300014745 Ga0157377_10104880 Ga0157377_101048802 235
157 3300014968 Ga0157379_10019837 Ga0157379_100198375 235
158 3300014969 Ga0157376_10357472 Ga0157376_103574722 235
159 3300017792 Ga0163161_10160315 Ga0163161_101603152 235
160 3300017792 Ga0163161_10500433 Ga0163161_105004332 235
161 3300025315 Ga0207697_10000148 Ga0207697_1000014831 235
162 3300025315 Ga0207697_10119843 Ga0207697_101198432 235
163 3300025893 Ga0207682_10001026 Ga0207682_100010266 235
164 3300025893 Ga0207682_10016003 Ga0207682_100160033 235
165 3300025893 Ga0207682_10017331 Ga0207682_100173313 235
166 3300025901 Ga0207688_10006434 Ga0207688_100064345 235
167 3300025901 Ga0207688_10008902 Ga0207688_100089025 235
168 3300025903 Ga0207680_10004481 Ga0207680_100044817 235
169 3300025903 Ga0207680_10049509 Ga0207680_100495093 235
170 3300025907 Ga0207645_10000577 Ga0207645_1000057728 235
171 3300025907 Ga0207645_10057469 Ga0207645_100574694 235
172 3300025908 Ga0207643_10001118 Ga0207643_100011189 235
173 3300025908 Ga0207643_10006580 Ga0207643_100065806 235
174 3300025908 Ga0207643_10018489 Ga0207643_100184894 235
175 3300025918 Ga0207662_10031361 Ga0207662_100313614 235
176 3300025918 Ga0207662_10034960 Ga0207662_100349602 235
177 3300025923 Ga0207681_10005245 Ga0207681_100052456 235
178 3300025923 Ga0207681_10021662 Ga0207681_100216622 235
179 3300025923 Ga0207681_10254825 Ga0207681_102548252 235
180 3300025926 Ga0207659_10019942 Ga0207659_100199425 235
181 3300025926 Ga0207659_10081654 Ga0207659_100816542 235
182 3300025926 Ga0207659_10226054 Ga0207659_102260542 235
183 3300025931 Ga0207644_10276020 Ga0207644_102760202 235
184 3300025933 Ga0207706_10062477 Ga0207706_100624773 235
185 3300025936 Ga0207670_10074050 Ga0207670_100740504 235
186 3300025937 Ga0207669_10005661 Ga0207669_100056615 235
187 3300025937 Ga0207669_10232695 Ga0207669_102326952 235
188 3300025940 Ga0207691_10004463 Ga0207691_1000446316 235
189 3300025940 Ga0207691_10139098 Ga0207691_101390982 235
190 3300025941 Ga0207711_10540220 Ga0207711_105402202 235
191 3300025942 Ga0207689_10028532 Ga0207689_100285325 235
192 3300025942 Ga0207689_10125590 Ga0207689_101255902 235
193 3300025945 Ga0207679_10041870 Ga0207679_100418705 235
194 3300025961 Ga0207712_10036176 Ga0207712_100361762 235
195 3300025986 Ga0207658_10106232 Ga0207658_101062321 235
196 3300026023 Ga0207677_10148575 Ga0207677_101485752 235
197 3300026035 Ga0207703_10260448 Ga0207703_102604481 235
198 3300026067 Ga0207678_10104153 Ga0207678_101041534 235
199 3300026075 Ga0207708_10015129 Ga0207708_100151296 235
200 3300026075 Ga0207708_10040767 Ga0207708_100407673 235
201 3300026088 Ga0207641_10218929 Ga0207641_102189292 235
202 3300026089 Ga0207648_10023355 Ga0207648_100233553 235
203 3300026089 Ga0207648_10240883 Ga0207648_102408832 235
204 3300026116 Ga0207674_10444049 Ga0207674_104440492 235
205 3300026118 Ga0207675_100002044 Ga0207675_10000204419 235
206 3300026118 Ga0207675_100045389 Ga0207675_1000453895 235
207 3300026121 Ga0207683_10021778 Ga0207683_100217785 235
208 3300026121 Ga0207683_10046198 Ga0207683_100461983 235
209 3300026121 Ga0207683_10491200 Ga0207683_104912002 235
210 3300026142 Ga0207698_10101766 Ga0207698_101017661 235
211 3300027907 Ga0207428_10009962 Ga0207428_100099626 235
212 3300028380 Ga0268265_10013120 Ga0268265_100131204 235
213 3300028380 Ga0268265_10356590 Ga0268265_103565902 235
214 3300035691 Ga0373931_0108374 Ga0373931_0108374_112_822 235
215 3300042122 Ga0450920_036249 Ga0450920_036249_25_759 235
216 3300042436 Ga0439435_0082720 Ga0439435_0082720_10_720 235
217 3300048905 Ga0496102_0650020 Ga0496102_0650020_134_844 235
218 3300048912 Ga0496109_0224732 Ga0496109_0224732_797_1507 235
219 3300050508 nmdc:mga09592_28758_c1 nmdc:mga09592_28758_c1_1475_2185 235
220 3300050511 nmdc:mga08y16_58540_c1 nmdc:mga08y16_58540_c1_2603_3313 235
221 3300050511 nmdc:mga08y16_8994_c1 nmdc:mga08y16_8994_c1_2525_3235 235
222 3300050512 nmdc:mga0n895_163951_c1 nmdc:mga0n895_163951_c1_456_1166 235
223 3300050515 nmdc:mga0a205_4739_c1 nmdc:mga0a205_4739_c1_4484_5194 235
224 3300009094 Ga0111539_10660070 Ga0111539_106600702 236
225 3300031548 Ga0307408_100289933 Ga0307408_1002899332 236
226 3300031901 Ga0307406_10024944 Ga0307406_100249443 236
227 3300031911 Ga0307412_10055768 Ga0307412_100557682 236
228 3300031995 Ga0307409_100016405 Ga0307409_1000164052 236
229 3300032002 Ga0307416_100001361 Ga0307416_10000136112 236
230 3300032004 Ga0307414_10670643 Ga0307414_106706432 236
231 3300032126 Ga0307415_100005514 Ga0307415_1000055142 236
232 3300041406 Ga0439439_0031866 Ga0439439_0031866_163_876 236
233 3300042461 Ga0439460_0060903 Ga0439460_0060903_351_1070 236
234 3300049572 Ga0501036_0481631 Ga0501036_0481631_30_749 236
235 3300005295 Ga0065707_10227950 Ga0065707_102279502 237
236 3300005327 Ga0070658_10615866 Ga0070658_106158661 237
237 3300025940 Ga0207691_10570871 Ga0207691_105708712 237
238 3300026035 Ga0207703_10387565 Ga0207703_103875652 237
239 3300006844 Ga0075428_100004507 Ga0075428_10000450710 238
240 3300006846 Ga0075430_100012838 Ga0075430_1000128383 238
241 3300006847 Ga0075431_100000501 Ga0075431_1000005015 238
242 3300006880 Ga0075429_100075010 Ga0075429_1000750103 238
243 3300050508 nmdc:mga09592_1151_c1 nmdc:mga09592_1151_c1_7466_8185 238
244 3300050509 nmdc:mga0qj67_8763_c1 nmdc:mga0qj67_8763_c1_3446_4165 238
245 3300050510 nmdc:mga06r32_77173_c1 nmdc:mga06r32_77173_c1_1917_2636 238
246 3300059421 Ga0590071_000331 Ga0590071_000331_5580_6305 238
247 3300059423 Ga0590074_030340 Ga0590074_030340_73_798 238
248 3300059426 Ga0590077_000492 Ga0590077_000492_4408_5133 238
249 3300006358 Ga0068871_100093812 Ga0068871_1000938124 240
250 3300009177 Ga0105248_10026197 Ga0105248_100261972 240
251 3300014969 Ga0157376_10717993 Ga0157376_107179932 240
252 3300042439 Ga0439464_0087339 Ga0439464_0087339_113_877 241
253 3300005290 Ga0065712_10084703 Ga0065712_100847032 242
254 3300005336 Ga0070680_100106740 Ga0070680_1001067402 242
255 3300005339 Ga0070660_100229816 Ga0070660_1002298162 242
256 3300005366 Ga0070659_100023014 Ga0070659_1000230142 242
257 3300005439 Ga0070711_100187494 Ga0070711_1001874942 242
258 3300005457 Ga0070662_100500351 Ga0070662_1005003512 242
259 3300005458 Ga0070681_10015746 Ga0070681_100157462 242
260 3300005841 Ga0068863_100530056 Ga0068863_1005300562 242
261 3300006237 Ga0097621_100550328 Ga0097621_1005503282 242
262 3300006358 Ga0068871_100500318 Ga0068871_1005003181 242
263 3300006871 Ga0075434_100258435 Ga0075434_1002584352 242
264 3300010159 Ga0099796_10112411 Ga0099796_101124111 242
265 3300014969 Ga0157376_10060384 Ga0157376_100603845 242
266 3300025912 Ga0207707_10018192 Ga0207707_100181927 242
267 3300025919 Ga0207657_10456755 Ga0207657_104567552 242
268 3300025921 Ga0207652_10107726 Ga0207652_101077262 242
269 3300025932 Ga0207690_10017268 Ga0207690_100172686 242
270 3300035086 Ga0373934_0010883 Ga0373934_0010883_151_879 242
271 3300035170 Ga0373943_0053043 Ga0373943_0053043_713_1441 242
272 3300035725 Ga0373947_0040231 Ga0373947_0040231_1814_2542 242
273 3300046454 Ga0495592_0189473 Ga0495592_0189473_491_1219 242
274 3300048088 Ga0495602_0124943 Ga0495602_0124943_637_1365 242
275 3300048915 Ga0496112_0095743 Ga0496112_0095743_962_1690 242
276 3300048915 Ga0496112_0224928 Ga0496112_0224928_870_1598 242
277 3300050512 nmdc:mga0n895_132989_c1 nmdc:mga0n895_132989_c1_1294_2022 242
278 3300053077 Ga0495601_0227284 Ga0495601_0227284_262_990 242
279 3300053085 Ga0495619_0122479 Ga0495619_0122479_537_1265 242
280 3300005293 Ga0065715_10143052 Ga0065715_101430521 243
281 3300005544 Ga0070686_100469333 Ga0070686_1004693331 243
282 3300005549 Ga0070704_100477602 Ga0070704_1004776022 243
283 3300025933 Ga0207706_10515365 Ga0207706_105153652 243
284 3300002459 JGI24751J29686_10001309 JGI24751J29686_100013092 244
285 3300005340 Ga0070689_100695777 Ga0070689_1006957771 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

191

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.8788 12 233
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.8741 12 234
2awo-assembly2.cif.gz_C crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8625 13 234
2yyz-assembly1.cif.gz_A crystal structure of sugar abc transporter, atp-binding protein 0.8595 13 231
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.8519 14 236
ID Description Score Start End Superfamily
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8726 9 233 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8693 14 234 3.40.50.300
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8671 12 233 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8666 8 232 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8578 39 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V8DKR1-F1-model_v4 ABC transporter domain-containing protein 0.9543 5 243 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2V8DKR1-F1-model_v4 ABC transporter domain-containing protein 0.9313 5 243 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A858U367-F1-model_v4 ATP-binding cassette domain-containing protein 0.9201 126 228 GO:0005524
GO:0016887
GO:0055052
AF-A0A349U1R7-F1-model_v4 ABC transporter domain-containing protein 0.8892 14 236 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A354XJ33-F1-model_v4 ABC transporter ATP-binding protein 0.889 34 214 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.36 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map