F386967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 285 | 161 | 285 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300042439|Ga0439464_0087339|Ga0439464_0087339_113_877 |
| Length | 254 |
| Sequence | VVTPEGGATATCRRLMADMRSADVLLRLRGVTKDYRSLRPLRIAELDVPTGRSLALVGFDQTMAEVFVDLITGAILPDSGEVVAFGQPTSAIPDRDGWLATLDQFGLFTDRAVLVEQFTVEQNLALPLSVAVEQMSVDMRERVEKLATEVGLTHDLRRQAGVLAPAPRARIRLGRAIALAPKVLVAEHPNATLAADDASALAADISRIVETRGIASIVLTADHAFARAVAKEVLVLEPATGTLKPAAGWRRWFS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 128 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 129 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 130 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 131 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 132 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 133 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 134 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 135 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 136 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 139 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 158 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 159 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 160 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.75 |
| Rhizosphere | 98.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10001309 | 3300002459 | Bacteria | 5242 |
| 2 | JGI25406J46586_10002269 | 3300003203 | Bacteria | 9065 |
| 3 | JGI25406J46586_10013638 | 3300003203 | Bacteria | 3482 |
| 4 | Ga0065714_10135764 | 3300005288 | Bacteria | 1209 |
| 5 | Ga0065712_10000956 | 3300005290 | Bacteria | 9274 |
| 6 | Ga0065712_10084703 | 3300005290 | Bacteria | 2746 |
| 7 | Ga0065715_10002217 | 3300005293 | Bacteria | 5706 |
| 8 | Ga0065715_10143052 | 3300005293 | Bacteria | 1825 |
| 9 | Ga0065715_10202890 | 3300005293 | Bacteria | 1352 |
| 10 | Ga0065707_10000688 | 3300005295 | Bacteria | 17386 |
| 11 | Ga0065707_10227950 | 3300005295 | Bacteria | 1199 |
| 12 | Ga0065707_10459361 | 3300005295 | Unclassified | 793 |
| 13 | Ga0070658_10615866 | 3300005327 | Bacteria | 941 |
| 14 | Ga0070676_10010333 | 3300005328 | Bacteria | 5063 |
| 15 | Ga0070683_100160503 | 3300005329 | Unclassified | 2133 |
| 16 | Ga0070690_100006932 | 3300005330 | Bacteria | 6448 |
| 17 | Ga0070670_100208900 | 3300005331 | Unclassified | 1697 |
| 18 | Ga0070670_100265505 | 3300005331 | Unclassified | 1497 |
| 19 | Ga0070670_100401514 | 3300005331 | Unclassified | 1210 |
| 20 | Ga0070677_10002455 | 3300005333 | Bacteria | 5928 |
| 21 | Ga0070677_10028554 | 3300005333 | Bacteria | 2109 |
| 22 | Ga0068869_100006683 | 3300005334 | Bacteria | 7326 |
| 23 | Ga0068869_100031462 | 3300005334 | Bacteria | 3733 |
| 24 | Ga0070666_10005709 | 3300005335 | Bacteria | 7636 |
| 25 | Ga0070666_10016971 | 3300005335 | Bacteria | 4662 |
| 26 | Ga0070680_100106740 | 3300005336 | Unclassified | 2329 |
| 27 | Ga0070660_100229816 | 3300005339 | Unclassified | 1509 |
| 28 | Ga0070689_100481307 | 3300005340 | Bacteria | 1060 |
| 29 | Ga0070689_100695777 | 3300005340 | Bacteria | 887 |
| 30 | Ga0070687_100019032 | 3300005343 | Unclassified | 3188 |
| 31 | Ga0070687_100023435 | 3300005343 | Bacteria | 2934 |
| 32 | Ga0070687_100163415 | 3300005343 | Bacteria | 1318 |
| 33 | Ga0070692_10092220 | 3300005345 | Bacteria | 1648 |
| 34 | Ga0070669_100016973 | 3300005353 | Bacteria | 5198 |
| 35 | Ga0070669_100069501 | 3300005353 | Unclassified | 2601 |
| 36 | Ga0070669_100077633 | 3300005353 | Bacteria | 2467 |
| 37 | Ga0070669_100191047 | 3300005353 | Bacteria | 1606 |
| 38 | Ga0070669_100707628 | 3300005353 | Unclassified | 851 |
| 39 | Ga0070675_100066279 | 3300005354 | Bacteria | 2986 |
| 40 | Ga0070675_100099991 | 3300005354 | Bacteria | 2442 |
| 41 | Ga0070675_100158262 | 3300005354 | Bacteria | 1946 |
| 42 | Ga0070671_100352537 | 3300005355 | Bacteria | 1256 |
| 43 | Ga0070674_100012439 | 3300005356 | Bacteria | 5227 |
| 44 | Ga0070673_100014303 | 3300005364 | Bacteria | 5520 |
| 45 | Ga0070673_100331567 | 3300005364 | Bacteria | 1346 |
| 46 | Ga0070688_100022258 | 3300005365 | Unclassified | 3710 |
| 47 | Ga0070659_100023014 | 3300005366 | Unclassified | 4764 |
| 48 | Ga0070667_100009583 | 3300005367 | Bacteria | 8030 |
| 49 | Ga0070701_10191035 | 3300005438 | Bacteria | 1205 |
| 50 | Ga0070711_100187494 | 3300005439 | Archaea | 1587 |
| 51 | Ga0070700_100037258 | 3300005441 | Unclassified | 2956 |
| 52 | Ga0070700_100043029 | 3300005441 | Bacteria | 2776 |
| 53 | Ga0070694_100170789 | 3300005444 | Bacteria | 1602 |
| 54 | Ga0070663_100091370 | 3300005455 | Bacteria | 2255 |
| 55 | Ga0070678_100063544 | 3300005456 | Bacteria | 2732 |
| 56 | Ga0070662_100019875 | 3300005457 | Unclassified | 4568 |
| 57 | Ga0070662_100033931 | 3300005457 | Bacteria | 3597 |
| 58 | Ga0070662_100500351 | 3300005457 | Bacteria | 1014 |
| 59 | Ga0070681_10015746 | 3300005458 | Bacteria | 7537 |
| 60 | Ga0068867_100091406 | 3300005459 | Bacteria | 2310 |
| 61 | Ga0068867_100464033 | 3300005459 | Bacteria | 1082 |
| 62 | Ga0070685_10005822 | 3300005466 | Bacteria | 6267 |
| 63 | Ga0070685_10168536 | 3300005466 | Bacteria | 1402 |
| 64 | Ga0070698_100205254 | 3300005471 | Bacteria | 1906 |
| 65 | Ga0070698_100315775 | 3300005471 | Bacteria | 1493 |
| 66 | Ga0070684_100439539 | 3300005535 | Bacteria | 1205 |
| 67 | Ga0070672_100021626 | 3300005543 | Bacteria | 4711 |
| 68 | Ga0070672_100041819 | 3300005543 | Unclassified | 3526 |
| 69 | Ga0070672_100706046 | 3300005543 | Unclassified | 883 |
| 70 | Ga0070686_100005388 | 3300005544 | Bacteria | 7078 |
| 71 | Ga0070686_100469333 | 3300005544 | Bacteria | 971 |
| 72 | Ga0070665_100031900 | 3300005548 | Bacteria | 5303 |
| 73 | Ga0070665_100282314 | 3300005548 | Bacteria | 1662 |
| 74 | Ga0070704_100096955 | 3300005549 | Bacteria | 2212 |
| 75 | Ga0070704_100477602 | 3300005549 | Unclassified | 1078 |
| 76 | Ga0070664_100006126 | 3300005564 | Bacteria | 9729 |
| 77 | Ga0070702_100035610 | 3300005615 | Bacteria | 2751 |
| 78 | Ga0070702_100292598 | 3300005615 | Unclassified | 1123 |
| 79 | Ga0068859_100024267 | 3300005617 | Bacteria | 6085 |
| 80 | Ga0068859_100143095 | 3300005617 | Bacteria | 2465 |
| 81 | Ga0068859_100159470 | 3300005617 | Bacteria | 2335 |
| 82 | Ga0068859_100167664 | 3300005617 | Bacteria | 2276 |
| 83 | Ga0068859_100433430 | 3300005617 | Bacteria | 1411 |
| 84 | Ga0068864_100026309 | 3300005618 | Bacteria | 4907 |
| 85 | Ga0068864_100761176 | 3300005618 | Unclassified | 950 |
| 86 | Ga0068861_100075638 | 3300005719 | Unclassified | 2622 |
| 87 | Ga0068861_100124696 | 3300005719 | Bacteria | 2083 |
| 88 | Ga0068861_100138791 | 3300005719 | Bacteria | 1982 |
| 89 | Ga0068870_10030152 | 3300005840 | Bacteria | 2740 |
| 90 | Ga0068870_10119424 | 3300005840 | Bacteria | 1516 |
| 91 | Ga0068863_100009818 | 3300005841 | Bacteria | 9326 |
| 92 | Ga0068863_100530056 | 3300005841 | Unclassified | 1162 |
| 93 | Ga0068858_100075701 | 3300005842 | Unclassified | 3126 |
| 94 | Ga0068860_100013602 | 3300005843 | Bacteria | 7977 |
| 95 | Ga0068862_100030212 | 3300005844 | Unclassified | 4566 |
| 96 | Ga0068862_100219510 | 3300005844 | Bacteria | 1721 |
| 97 | Ga0081539_10000024 | 3300005985 | Bacteria | 354702 |
| 98 | Ga0081539_10000222 | 3300005985 | Bacteria | 133128 |
| 99 | Ga0081539_10004972 | 3300005985 | Bacteria | 14088 |
| 100 | Ga0097621_100002410 | 3300006237 | Bacteria | 12807 |
| 101 | Ga0097621_100041229 | 3300006237 | Unclassified | 3715 |
| 102 | Ga0097621_100550328 | 3300006237 | Unclassified | 1050 |
| 103 | Ga0068871_100093812 | 3300006358 | Unclassified | 2505 |
| 104 | Ga0068871_100095668 | 3300006358 | Unclassified | 2480 |
| 105 | Ga0068871_100500318 | 3300006358 | Unclassified | 1095 |
| 106 | Ga0075428_100000076 | 3300006844 | Bacteria | 81732 |
| 107 | Ga0075428_100004507 | 3300006844 | Bacteria | 15383 |
| 108 | Ga0075428_100365557 | 3300006844 | Bacteria | 1547 |
| 109 | Ga0075430_100012838 | 3300006846 | Bacteria | 7139 |
| 110 | Ga0075430_100104648 | 3300006846 | Bacteria | 2363 |
| 111 | Ga0075430_100370530 | 3300006846 | Bacteria | 1182 |
| 112 | Ga0075431_100000501 | 3300006847 | Bacteria | 32696 |
| 113 | Ga0075431_100066859 | 3300006847 | Bacteria | 3711 |
| 114 | Ga0075433_10067179 | 3300006852 | Unclassified | 3147 |
| 115 | Ga0075434_100048104 | 3300006871 | Bacteria | 4232 |
| 116 | Ga0075434_100258435 | 3300006871 | Bacteria | 1760 |
| 117 | Ga0075429_100075010 | 3300006880 | Unclassified | 2946 |
| 118 | Ga0075429_100095238 | 3300006880 | Bacteria | 2596 |
| 119 | Ga0075429_100122628 | 3300006880 | Bacteria | 2272 |
| 120 | Ga0068865_100387393 | 3300006881 | Unclassified | 1142 |
| 121 | Ga0097620_100024267 | 3300006931 | Bacteria | 6085 |
| 122 | Ga0097620_100143085 | 3300006931 | Bacteria | 2465 |
| 123 | Ga0097620_100159469 | 3300006931 | Bacteria | 2335 |
| 124 | Ga0097620_100167667 | 3300006931 | Bacteria | 2276 |
| 125 | Ga0097620_100433424 | 3300006931 | Bacteria | 1411 |
| 126 | Ga0075435_100025636 | 3300007076 | Bacteria | 4591 |
| 127 | Ga0111539_10000010 | 3300009094 | Bacteria | 366246 |
| 128 | Ga0111539_10002377 | 3300009094 | Bacteria | 24991 |
| 129 | Ga0111539_10004477 | 3300009094 | Bacteria | 18271 |
| 130 | Ga0111539_10074826 | 3300009094 | Bacteria | 3991 |
| 131 | Ga0111539_10331279 | 3300009094 | Unclassified | 1772 |
| 132 | Ga0111539_10660070 | 3300009094 | Bacteria | 1218 |
| 133 | Ga0111539_10886701 | 3300009094 | Bacteria | 1038 |
| 134 | Ga0111539_11178425 | 3300009094 | Bacteria | 890 |
| 135 | Ga0114129_10002083 | 3300009147 | Bacteria | 27496 |
| 136 | Ga0105248_10016155 | 3300009177 | Bacteria | 8213 |
| 137 | Ga0105248_10026197 | 3300009177 | Bacteria | 6487 |
| 138 | Ga0105249_10332812 | 3300009553 | Bacteria | 1533 |
| 139 | Ga0099796_10112411 | 3300010159 | Bacteria | 1038 |
| 140 | Ga0157375_10046271 | 3300013308 | Bacteria | 4240 |
| 141 | Ga0157380_10017200 | 3300014326 | Bacteria | 5348 |
| 142 | Ga0157380_10039215 | 3300014326 | Bacteria | 3682 |
| 143 | Ga0157380_10105936 | 3300014326 | Bacteria | 2352 |
| 144 | Ga0157377_10010273 | 3300014745 | Unclassified | 4625 |
| 145 | Ga0157377_10104880 | 3300014745 | Unclassified | 1691 |
| 146 | Ga0157379_10019837 | 3300014968 | Bacteria | 5940 |
| 147 | Ga0157376_10060384 | 3300014969 | Bacteria | 3183 |
| 148 | Ga0157376_10357472 | 3300014969 | Bacteria | 1400 |
| 149 | Ga0157376_10717993 | 3300014969 | Unclassified | 1006 |
| 150 | Ga0163161_10160315 | 3300017792 | Bacteria | 1715 |
| 151 | Ga0163161_10500433 | 3300017792 | Bacteria | 989 |
| 152 | Ga0207697_10000148 | 3300025315 | Bacteria | 34368 |
| 153 | Ga0207697_10119843 | 3300025315 | Unclassified | 1131 |
| 154 | Ga0207682_10001026 | 3300025893 | Bacteria | 12922 |
| 155 | Ga0207682_10016003 | 3300025893 | Bacteria | 2923 |
| 156 | Ga0207682_10017331 | 3300025893 | Bacteria | 2813 |
| 157 | Ga0207688_10006434 | 3300025901 | Bacteria | 6398 |
| 158 | Ga0207688_10008902 | 3300025901 | Bacteria | 5462 |
| 159 | Ga0207680_10004481 | 3300025903 | Bacteria | 6627 |
| 160 | Ga0207680_10049509 | 3300025903 | Bacteria | 2501 |
| 161 | Ga0207645_10000577 | 3300025907 | Bacteria | 30396 |
| 162 | Ga0207645_10057469 | 3300025907 | Bacteria | 2483 |
| 163 | Ga0207643_10001118 | 3300025908 | Bacteria | 15933 |
| 164 | Ga0207643_10006580 | 3300025908 | Bacteria | 6230 |
| 165 | Ga0207643_10018489 | 3300025908 | Bacteria | 3816 |
| 166 | Ga0207707_10018192 | 3300025912 | Bacteria | 6124 |
| 167 | Ga0207662_10031361 | 3300025918 | Unclassified | 3088 |
| 168 | Ga0207662_10034960 | 3300025918 | Bacteria | 2934 |
| 169 | Ga0207657_10456755 | 3300025919 | Bacteria | 1002 |
| 170 | Ga0207652_10107726 | 3300025921 | Unclassified | 2468 |
| 171 | Ga0207681_10005245 | 3300025923 | Bacteria | 7961 |
| 172 | Ga0207681_10021662 | 3300025923 | Bacteria | 4089 |
| 173 | Ga0207681_10254825 | 3300025923 | Bacteria | 1371 |
| 174 | Ga0207650_10196242 | 3300025925 | Bacteria | 1615 |
| 175 | Ga0207659_10019942 | 3300025926 | Unclassified | 4423 |
| 176 | Ga0207659_10081654 | 3300025926 | Bacteria | 2391 |
| 177 | Ga0207659_10226054 | 3300025926 | Bacteria | 1507 |
| 178 | Ga0207659_10283631 | 3300025926 | Bacteria | 1355 |
| 179 | Ga0207644_10276020 | 3300025931 | Bacteria | 1348 |
| 180 | Ga0207690_10017268 | 3300025932 | Bacteria | 4403 |
| 181 | Ga0207706_10062477 | 3300025933 | Bacteria | 3280 |
| 182 | Ga0207706_10515365 | 3300025933 | Bacteria | 1031 |
| 183 | Ga0207706_10552739 | 3300025933 | Bacteria | 991 |
| 184 | Ga0207670_10074050 | 3300025936 | Bacteria | 2363 |
| 185 | Ga0207669_10005661 | 3300025937 | Bacteria | 5634 |
| 186 | Ga0207669_10232695 | 3300025937 | Bacteria | 1360 |
| 187 | Ga0207691_10004463 | 3300025940 | Bacteria | 13556 |
| 188 | Ga0207691_10139098 | 3300025940 | Bacteria | 2140 |
| 189 | Ga0207691_10570871 | 3300025940 | Unclassified | 959 |
| 190 | Ga0207711_10540220 | 3300025941 | Bacteria | 1087 |
| 191 | Ga0207689_10028532 | 3300025942 | Bacteria | 4669 |
| 192 | Ga0207689_10125590 | 3300025942 | Bacteria | 2111 |
| 193 | Ga0207679_10041870 | 3300025945 | Bacteria | 3288 |
| 194 | Ga0207712_10036176 | 3300025961 | Unclassified | 3361 |
| 195 | Ga0207712_10222718 | 3300025961 | Bacteria | 1509 |
| 196 | Ga0207658_10106232 | 3300025986 | Unclassified | 2210 |
| 197 | Ga0207677_10148575 | 3300026023 | Bacteria | 1804 |
| 198 | Ga0207703_10260448 | 3300026035 | Bacteria | 1567 |
| 199 | Ga0207703_10387565 | 3300026035 | Unclassified | 1294 |
| 200 | Ga0207678_10104153 | 3300026067 | Bacteria | 2421 |
| 201 | Ga0207708_10015129 | 3300026075 | Bacteria | 5781 |
| 202 | Ga0207708_10040767 | 3300026075 | Unclassified | 3541 |
| 203 | Ga0207708_10149331 | 3300026075 | Bacteria | 1838 |
| 204 | Ga0207641_10218929 | 3300026088 | Bacteria | 1764 |
| 205 | Ga0207648_10023355 | 3300026089 | Bacteria | 5542 |
| 206 | Ga0207648_10240883 | 3300026089 | Bacteria | 1610 |
| 207 | Ga0207674_10444049 | 3300026116 | Bacteria | 1254 |
| 208 | Ga0207675_100002044 | 3300026118 | Bacteria | 20130 |
| 209 | Ga0207675_100045389 | 3300026118 | Bacteria | 4105 |
| 210 | Ga0207675_100095724 | 3300026118 | Unclassified | 2794 |
| 211 | Ga0207675_100319951 | 3300026118 | Bacteria | 1514 |
| 212 | Ga0207683_10021778 | 3300026121 | Bacteria | 5495 |
| 213 | Ga0207683_10046198 | 3300026121 | Bacteria | 3810 |
| 214 | Ga0207683_10491200 | 3300026121 | Unclassified | 1133 |
| 215 | Ga0207698_10101766 | 3300026142 | Bacteria | 2383 |
| 216 | Ga0209971_1007664 | 3300027682 | Bacteria | 2562 |
| 217 | Ga0207428_10000097 | 3300027907 | Bacteria | 122738 |
| 218 | Ga0207428_10009962 | 3300027907 | Bacteria | 8508 |
| 219 | Ga0207428_10343364 | 3300027907 | Bacteria | 1099 |
| 220 | Ga0268265_10013120 | 3300028380 | Bacteria | 5628 |
| 221 | Ga0268265_10018503 | 3300028380 | Bacteria | 4830 |
| 222 | Ga0268265_10026732 | 3300028380 | Bacteria | 4108 |
| 223 | Ga0268265_10356590 | 3300028380 | Bacteria | 1337 |
| 224 | Ga0307408_100289933 | 3300031548 | Bacteria | 1366 |
| 225 | Ga0307406_10024944 | 3300031901 | Bacteria | 3575 |
| 226 | Ga0307412_10055768 | 3300031911 | Unclassified | 2630 |
| 227 | Ga0307409_100016405 | 3300031995 | Bacteria | 4899 |
| 228 | Ga0307416_100001361 | 3300032002 | Bacteria | 13193 |
| 229 | Ga0307416_100008072 | 3300032002 | Bacteria | 6750 |
| 230 | Ga0307414_10670643 | 3300032004 | Bacteria | 936 |
| 231 | Ga0307415_100005514 | 3300032126 | Bacteria | 6727 |
| 232 | Ga0373928_0028965 | 3300035084 | Bacteria | 1215 |
| 233 | Ga0373934_0010883 | 3300035086 | Bacteria | 3420 |
| 234 | Ga0373943_0053043 | 3300035170 | Unclassified | 2001 |
| 235 | Ga0373931_0108374 | 3300035691 | Bacteria | 1572 |
| 236 | Ga0373947_0040231 | 3300035725 | Bacteria | 2784 |
| 237 | Ga0373937_0201523 | 3300036401 | Archaea | 1871 |
| 238 | Ga0439439_0031866 | 3300041406 | Bacteria | 1345 |
| 239 | Ga0451807_1055055 | 3300041486 | Bacteria | 1059 |
| 240 | Ga0439450_011243 | 3300042008 | Bacteria | 1749 |
| 241 | Ga0450920_036249 | 3300042122 | Unclassified | 978 |
| 242 | Ga0439434_0068424 | 3300042435 | Bacteria | 1116 |
| 243 | Ga0439435_0082720 | 3300042436 | Unclassified | 965 |
| 244 | Ga0439464_0087339 | 3300042439 | Unclassified | 937 |
| 245 | Ga0439460_0060903 | 3300042461 | Unclassified | 1152 |
| 246 | Ga0439440_0031243 | 3300042993 | Bacteria | 1258 |
| 247 | Ga0495592_0189473 | 3300046454 | Unclassified | 1395 |
| 248 | Ga0495602_0124943 | 3300048088 | Bacteria | 2063 |
| 249 | Ga0496102_0650020 | 3300048905 | Bacteria | 978 |
| 250 | Ga0496109_0224732 | 3300048912 | Bacteria | 1766 |
| 251 | Ga0496112_0095743 | 3300048915 | Unclassified | 2939 |
| 252 | Ga0496112_0224928 | 3300048915 | Bacteria | 1832 |
| 253 | Ga0501036_0481631 | 3300049572 | Bacteria | 1033 |
| 254 | Ga0501046_0450461 | 3300049580 | Bacteria | 926 |
| 255 | Ga0501046_0726573 | 3300049580 | Bacteria | 698 |
| 256 | Ga0501048_0445488 | 3300049582 | Bacteria | 927 |
| 257 | Ga0501072_0032645 | 3300049588 | Bacteria | 4078 |
| 258 | Ga0501075_0053091 | 3300049591 | Bacteria | 3048 |
| 259 | Ga0501081_0296266 | 3300049743 | Bacteria | 1186 |
| 260 | Ga0501045_0240860 | 3300049824 | Bacteria | 1346 |
| 261 | nmdc:mga09592_103255_c1 | 3300050508 | Bacteria | 2442 |
| 262 | nmdc:mga09592_1151_c1 | 3300050508 | Bacteria | 21071 |
| 263 | nmdc:mga09592_28758_c1 | 3300050508 | Unclassified | 4620 |
| 264 | nmdc:mga0qj67_356381_c1 | 3300050509 | Bacteria | 1182 |
| 265 | nmdc:mga0qj67_8763_c1 | 3300050509 | Bacteria | 7507 |
| 266 | nmdc:mga06r32_77173_c1 | 3300050510 | Unclassified | 3236 |
| 267 | nmdc:mga06r32_82108_c1 | 3300050510 | Bacteria | 3139 |
| 268 | nmdc:mga08y16_10_c1 | 3300050511 | Bacteria | 470512 |
| 269 | nmdc:mga08y16_58540_c1 | 3300050511 | Bacteria | 4026 |
| 270 | nmdc:mga08y16_610494_c1 | 3300050511 | Bacteria | 1099 |
| 271 | nmdc:mga08y16_847585_c1 | 3300050511 | Unclassified | 903 |
| 272 | nmdc:mga08y16_8994_c1 | 3300050511 | Bacteria | 10490 |
| 273 | nmdc:mga0n895_132989_c1 | 3300050512 | Bacteria | 2513 |
| 274 | nmdc:mga0n895_163951_c1 | 3300050512 | Bacteria | 2254 |
| 275 | nmdc:mga0rr50_17646_c1 | 3300050513 | Bacteria | 4770 |
| 276 | nmdc:mga0a205_237756_c1 | 3300050515 | Unclassified | 1703 |
| 277 | nmdc:mga0a205_4739_c1 | 3300050515 | Bacteria | 12219 |
| 278 | Ga0495601_0227284 | 3300053077 | Unclassified | 1219 |
| 279 | Ga0495619_0122479 | 3300053085 | Unclassified | 1783 |
| 280 | Ga0590071_000331 | 3300059421 | Bacteria | 13900 |
| 281 | Ga0590074_030340 | 3300059423 | Bacteria | 953 |
| 282 | Ga0590077_000492 | 3300059426 | Bacteria | 11076 |
| 283 | Ga0590077_010545 | 3300059426 | Unclassified | 1901 |
| 284 | Ga0501082_0116650 | 3300060353 | Bacteria | 2312 |
| 285 | Ga0530510_0044925 | 3300061734 | Bacteria | 3193 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0726573 | Ga0501046_0726573_73_675 | 200 |
| 2 | 3300050511 | nmdc:mga08y16_847585_c1 | nmdc:mga08y16_847585_c1_208_810 | 200 |
| 3 | 3300005617 | Ga0068859_100167664 | Ga0068859_1001676643 | 206 |
| 4 | 3300006931 | Ga0097620_100167667 | Ga0097620_1001676673 | 206 |
| 5 | 3300009553 | Ga0105249_10332812 | Ga0105249_103328122 | 206 |
| 6 | 3300025961 | Ga0207712_10222718 | Ga0207712_102227182 | 206 |
| 7 | 3300026075 | Ga0207708_10149331 | Ga0207708_101493312 | 206 |
| 8 | 3300042993 | Ga0439440_0031243 | Ga0439440_0031243_216_971 | 208 |
| 9 | 3300027682 | Ga0209971_1007664 | Ga0209971_10076642 | 209 |
| 10 | 3300032002 | Ga0307416_100008072 | Ga0307416_1000080724 | 209 |
| 11 | 3300005353 | Ga0070669_100707628 | Ga0070669_1007076281 | 212 |
| 12 | 3300009147 | Ga0114129_10002083 | Ga0114129_1000208323 | 212 |
| 13 | 3300006237 | Ga0097621_100002410 | Ga0097621_10000241013 | 215 |
| 14 | 3300035084 | Ga0373928_0028965 | Ga0373928_0028965_420_1130 | 216 |
| 15 | 3300049580 | Ga0501046_0450461 | Ga0501046_0450461_144_842 | 218 |
| 16 | 3300005985 | Ga0081539_10004972 | Ga0081539_1000497215 | 226 |
| 17 | 3300042008 | Ga0439450_011243 | Ga0439450_011243_621_1340 | 227 |
| 18 | 3300005329 | Ga0070683_100160503 | Ga0070683_1001605033 | 230 |
| 19 | 3300006237 | Ga0097621_100041229 | Ga0097621_1000412293 | 230 |
| 20 | 3300006358 | Ga0068871_100095668 | Ga0068871_1000956684 | 230 |
| 21 | 3300007076 | Ga0075435_100025636 | Ga0075435_1000256364 | 230 |
| 22 | 3300036401 | Ga0373937_0201523 | Ga0373937_0201523_796_1506 | 230 |
| 23 | 3300050513 | nmdc:mga0rr50_17646_c1 | nmdc:mga0rr50_17646_c1_2005_2715 | 230 |
| 24 | 3300005353 | Ga0070669_100191047 | Ga0070669_1001910472 | 231 |
| 25 | 3300005441 | Ga0070700_100043029 | Ga0070700_1000430292 | 231 |
| 26 | 3300005617 | Ga0068859_100143095 | Ga0068859_1001430952 | 231 |
| 27 | 3300005719 | Ga0068861_100138791 | Ga0068861_1001387913 | 231 |
| 28 | 3300006847 | Ga0075431_100066859 | Ga0075431_1000668595 | 231 |
| 29 | 3300006931 | Ga0097620_100143085 | Ga0097620_1001430852 | 231 |
| 30 | 3300026118 | Ga0207675_100319951 | Ga0207675_1003199512 | 231 |
| 31 | 3300028380 | Ga0268265_10026732 | Ga0268265_100267325 | 231 |
| 32 | 3300050510 | nmdc:mga06r32_82108_c1 | nmdc:mga06r32_82108_c1_2118_2813 | 231 |
| 33 | 3300005331 | Ga0070670_100265505 | Ga0070670_1002655052 | 232 |
| 34 | 3300005343 | Ga0070687_100163415 | Ga0070687_1001634152 | 232 |
| 35 | 3300005471 | Ga0070698_100315775 | Ga0070698_1003157752 | 232 |
| 36 | 3300005548 | Ga0070665_100031900 | Ga0070665_1000319006 | 232 |
| 37 | 3300006844 | Ga0075428_100000076 | Ga0075428_10000007660 | 232 |
| 38 | 3300006844 | Ga0075428_100365557 | Ga0075428_1003655572 | 232 |
| 39 | 3300006846 | Ga0075430_100370530 | Ga0075430_1003705301 | 232 |
| 40 | 3300006880 | Ga0075429_100122628 | Ga0075429_1001226283 | 232 |
| 41 | 3300009094 | Ga0111539_10000010 | Ga0111539_10000010324 | 232 |
| 42 | 3300009094 | Ga0111539_10886701 | Ga0111539_108867012 | 232 |
| 43 | 3300027907 | Ga0207428_10000097 | Ga0207428_1000009723 | 232 |
| 44 | 3300027907 | Ga0207428_10343364 | Ga0207428_103433642 | 232 |
| 45 | 3300041486 | Ga0451807_1055055 | Ga0451807_1055055_154_855 | 232 |
| 46 | 3300042435 | Ga0439434_0068424 | Ga0439434_0068424_44_745 | 232 |
| 47 | 3300050508 | nmdc:mga09592_103255_c1 | nmdc:mga09592_103255_c1_476_1174 | 232 |
| 48 | 3300050509 | nmdc:mga0qj67_356381_c1 | nmdc:mga0qj67_356381_c1_419_1117 | 232 |
| 49 | 3300050511 | nmdc:mga08y16_10_c1 | nmdc:mga08y16_10_c1_137837_138535 | 232 |
| 50 | 3300050511 | nmdc:mga08y16_610494_c1 | nmdc:mga08y16_610494_c1_192_893 | 232 |
| 51 | 3300003203 | JGI25406J46586_10002269 | JGI25406J46586_100022694 | 233 |
| 52 | 3300003203 | JGI25406J46586_10013638 | JGI25406J46586_100136385 | 233 |
| 53 | 3300005295 | Ga0065707_10000688 | Ga0065707_100006888 | 233 |
| 54 | 3300005331 | Ga0070670_100401514 | Ga0070670_1004015142 | 233 |
| 55 | 3300005353 | Ga0070669_100069501 | Ga0070669_1000695014 | 233 |
| 56 | 3300005471 | Ga0070698_100205254 | Ga0070698_1002052542 | 233 |
| 57 | 3300005719 | Ga0068861_100075638 | Ga0068861_1000756384 | 233 |
| 58 | 3300005985 | Ga0081539_10000024 | Ga0081539_10000024193 | 233 |
| 59 | 3300005985 | Ga0081539_10000222 | Ga0081539_10000222117 | 233 |
| 60 | 3300009094 | Ga0111539_11178425 | Ga0111539_111784252 | 233 |
| 61 | 3300025933 | Ga0207706_10552739 | Ga0207706_105527392 | 233 |
| 62 | 3300026118 | Ga0207675_100095724 | Ga0207675_1000957244 | 233 |
| 63 | 3300028380 | Ga0268265_10018503 | Ga0268265_100185034 | 233 |
| 64 | 3300005331 | Ga0070670_100208900 | Ga0070670_1002089002 | 234 |
| 65 | 3300005543 | Ga0070672_100706046 | Ga0070672_1007060461 | 234 |
| 66 | 3300006852 | Ga0075433_10067179 | Ga0075433_100671792 | 234 |
| 67 | 3300025925 | Ga0207650_10196242 | Ga0207650_101962422 | 234 |
| 68 | 3300025926 | Ga0207659_10283631 | Ga0207659_102836312 | 234 |
| 69 | 3300049582 | Ga0501048_0445488 | Ga0501048_0445488_173_877 | 234 |
| 70 | 3300049588 | Ga0501072_0032645 | Ga0501072_0032645_1861_2565 | 234 |
| 71 | 3300049591 | Ga0501075_0053091 | Ga0501075_0053091_693_1397 | 234 |
| 72 | 3300049743 | Ga0501081_0296266 | Ga0501081_0296266_452_1156 | 234 |
| 73 | 3300049824 | Ga0501045_0240860 | Ga0501045_0240860_203_907 | 234 |
| 74 | 3300050515 | nmdc:mga0a205_237756_c1 | nmdc:mga0a205_237756_c1_155_883 | 234 |
| 75 | 3300059426 | Ga0590077_010545 | Ga0590077_010545_1030_1743 | 234 |
| 76 | 3300060353 | Ga0501082_0116650 | Ga0501082_0116650_145_849 | 234 |
| 77 | 3300061734 | Ga0530510_0044925 | Ga0530510_0044925_1496_2200 | 234 |
| 78 | 3300005288 | Ga0065714_10135764 | Ga0065714_101357642 | 235 |
| 79 | 3300005290 | Ga0065712_10000956 | Ga0065712_100009563 | 235 |
| 80 | 3300005293 | Ga0065715_10002217 | Ga0065715_100022176 | 235 |
| 81 | 3300005293 | Ga0065715_10202890 | Ga0065715_102028901 | 235 |
| 82 | 3300005295 | Ga0065707_10459361 | Ga0065707_104593611 | 235 |
| 83 | 3300005328 | Ga0070676_10010333 | Ga0070676_100103335 | 235 |
| 84 | 3300005330 | Ga0070690_100006932 | Ga0070690_1000069327 | 235 |
| 85 | 3300005333 | Ga0070677_10002455 | Ga0070677_100024556 | 235 |
| 86 | 3300005333 | Ga0070677_10028554 | Ga0070677_100285542 | 235 |
| 87 | 3300005334 | Ga0068869_100006683 | Ga0068869_1000066836 | 235 |
| 88 | 3300005334 | Ga0068869_100031462 | Ga0068869_1000314622 | 235 |
| 89 | 3300005335 | Ga0070666_10005709 | Ga0070666_100057097 | 235 |
| 90 | 3300005335 | Ga0070666_10016971 | Ga0070666_100169714 | 235 |
| 91 | 3300005340 | Ga0070689_100481307 | Ga0070689_1004813072 | 235 |
| 92 | 3300005343 | Ga0070687_100019032 | Ga0070687_1000190321 | 235 |
| 93 | 3300005343 | Ga0070687_100023435 | Ga0070687_1000234352 | 235 |
| 94 | 3300005345 | Ga0070692_10092220 | Ga0070692_100922202 | 235 |
| 95 | 3300005353 | Ga0070669_100016973 | Ga0070669_1000169734 | 235 |
| 96 | 3300005353 | Ga0070669_100077633 | Ga0070669_1000776334 | 235 |
| 97 | 3300005354 | Ga0070675_100066279 | Ga0070675_1000662793 | 235 |
| 98 | 3300005354 | Ga0070675_100099991 | Ga0070675_1000999912 | 235 |
| 99 | 3300005354 | Ga0070675_100158262 | Ga0070675_1001582622 | 235 |
| 100 | 3300005355 | Ga0070671_100352537 | Ga0070671_1003525372 | 235 |
| 101 | 3300005356 | Ga0070674_100012439 | Ga0070674_1000124394 | 235 |
| 102 | 3300005364 | Ga0070673_100014303 | Ga0070673_1000143031 | 235 |
| 103 | 3300005364 | Ga0070673_100331567 | Ga0070673_1003315672 | 235 |
| 104 | 3300005365 | Ga0070688_100022258 | Ga0070688_1000222582 | 235 |
| 105 | 3300005367 | Ga0070667_100009583 | Ga0070667_1000095838 | 235 |
| 106 | 3300005438 | Ga0070701_10191035 | Ga0070701_101910351 | 235 |
| 107 | 3300005441 | Ga0070700_100037258 | Ga0070700_1000372582 | 235 |
| 108 | 3300005444 | Ga0070694_100170789 | Ga0070694_1001707892 | 235 |
| 109 | 3300005455 | Ga0070663_100091370 | Ga0070663_1000913702 | 235 |
| 110 | 3300005456 | Ga0070678_100063544 | Ga0070678_1000635443 | 235 |
| 111 | 3300005457 | Ga0070662_100019875 | Ga0070662_1000198755 | 235 |
| 112 | 3300005457 | Ga0070662_100033931 | Ga0070662_1000339312 | 235 |
| 113 | 3300005459 | Ga0068867_100091406 | Ga0068867_1000914063 | 235 |
| 114 | 3300005459 | Ga0068867_100464033 | Ga0068867_1004640332 | 235 |
| 115 | 3300005466 | Ga0070685_10005822 | Ga0070685_100058228 | 235 |
| 116 | 3300005466 | Ga0070685_10168536 | Ga0070685_101685362 | 235 |
| 117 | 3300005535 | Ga0070684_100439539 | Ga0070684_1004395392 | 235 |
| 118 | 3300005543 | Ga0070672_100021626 | Ga0070672_1000216265 | 235 |
| 119 | 3300005543 | Ga0070672_100041819 | Ga0070672_1000418195 | 235 |
| 120 | 3300005544 | Ga0070686_100005388 | Ga0070686_1000053886 | 235 |
| 121 | 3300005548 | Ga0070665_100282314 | Ga0070665_1002823142 | 235 |
| 122 | 3300005549 | Ga0070704_100096955 | Ga0070704_1000969551 | 235 |
| 123 | 3300005564 | Ga0070664_100006126 | Ga0070664_1000061269 | 235 |
| 124 | 3300005615 | Ga0070702_100035610 | Ga0070702_1000356102 | 235 |
| 125 | 3300005615 | Ga0070702_100292598 | Ga0070702_1002925982 | 235 |
| 126 | 3300005617 | Ga0068859_100024267 | Ga0068859_1000242672 | 235 |
| 127 | 3300005617 | Ga0068859_100159470 | Ga0068859_1001594704 | 235 |
| 128 | 3300005617 | Ga0068859_100433430 | Ga0068859_1004334302 | 235 |
| 129 | 3300005618 | Ga0068864_100026309 | Ga0068864_1000263095 | 235 |
| 130 | 3300005618 | Ga0068864_100761176 | Ga0068864_1007611761 | 235 |
| 131 | 3300005719 | Ga0068861_100124696 | Ga0068861_1001246963 | 235 |
| 132 | 3300005840 | Ga0068870_10030152 | Ga0068870_100301522 | 235 |
| 133 | 3300005840 | Ga0068870_10119424 | Ga0068870_101194243 | 235 |
| 134 | 3300005841 | Ga0068863_100009818 | Ga0068863_1000098189 | 235 |
| 135 | 3300005842 | Ga0068858_100075701 | Ga0068858_1000757013 | 235 |
| 136 | 3300005843 | Ga0068860_100013602 | Ga0068860_1000136027 | 235 |
| 137 | 3300005844 | Ga0068862_100030212 | Ga0068862_1000302125 | 235 |
| 138 | 3300005844 | Ga0068862_100219510 | Ga0068862_1002195103 | 235 |
| 139 | 3300006846 | Ga0075430_100104648 | Ga0075430_1001046482 | 235 |
| 140 | 3300006871 | Ga0075434_100048104 | Ga0075434_1000481046 | 235 |
| 141 | 3300006880 | Ga0075429_100095238 | Ga0075429_1000952382 | 235 |
| 142 | 3300006881 | Ga0068865_100387393 | Ga0068865_1003873932 | 235 |
| 143 | 3300006931 | Ga0097620_100024267 | Ga0097620_1000242672 | 235 |
| 144 | 3300006931 | Ga0097620_100159469 | Ga0097620_1001594694 | 235 |
| 145 | 3300006931 | Ga0097620_100433424 | Ga0097620_1004334242 | 235 |
| 146 | 3300009094 | Ga0111539_10002377 | Ga0111539_1000237726 | 235 |
| 147 | 3300009094 | Ga0111539_10004477 | Ga0111539_100044778 | 235 |
| 148 | 3300009094 | Ga0111539_10074826 | Ga0111539_100748265 | 235 |
| 149 | 3300009094 | Ga0111539_10331279 | Ga0111539_103312792 | 235 |
| 150 | 3300009177 | Ga0105248_10016155 | Ga0105248_100161559 | 235 |
| 151 | 3300013308 | Ga0157375_10046271 | Ga0157375_100462712 | 235 |
| 152 | 3300014326 | Ga0157380_10017200 | Ga0157380_100172002 | 235 |
| 153 | 3300014326 | Ga0157380_10039215 | Ga0157380_100392152 | 235 |
| 154 | 3300014326 | Ga0157380_10105936 | Ga0157380_101059365 | 235 |
| 155 | 3300014745 | Ga0157377_10010273 | Ga0157377_100102733 | 235 |
| 156 | 3300014745 | Ga0157377_10104880 | Ga0157377_101048802 | 235 |
| 157 | 3300014968 | Ga0157379_10019837 | Ga0157379_100198375 | 235 |
| 158 | 3300014969 | Ga0157376_10357472 | Ga0157376_103574722 | 235 |
| 159 | 3300017792 | Ga0163161_10160315 | Ga0163161_101603152 | 235 |
| 160 | 3300017792 | Ga0163161_10500433 | Ga0163161_105004332 | 235 |
| 161 | 3300025315 | Ga0207697_10000148 | Ga0207697_1000014831 | 235 |
| 162 | 3300025315 | Ga0207697_10119843 | Ga0207697_101198432 | 235 |
| 163 | 3300025893 | Ga0207682_10001026 | Ga0207682_100010266 | 235 |
| 164 | 3300025893 | Ga0207682_10016003 | Ga0207682_100160033 | 235 |
| 165 | 3300025893 | Ga0207682_10017331 | Ga0207682_100173313 | 235 |
| 166 | 3300025901 | Ga0207688_10006434 | Ga0207688_100064345 | 235 |
| 167 | 3300025901 | Ga0207688_10008902 | Ga0207688_100089025 | 235 |
| 168 | 3300025903 | Ga0207680_10004481 | Ga0207680_100044817 | 235 |
| 169 | 3300025903 | Ga0207680_10049509 | Ga0207680_100495093 | 235 |
| 170 | 3300025907 | Ga0207645_10000577 | Ga0207645_1000057728 | 235 |
| 171 | 3300025907 | Ga0207645_10057469 | Ga0207645_100574694 | 235 |
| 172 | 3300025908 | Ga0207643_10001118 | Ga0207643_100011189 | 235 |
| 173 | 3300025908 | Ga0207643_10006580 | Ga0207643_100065806 | 235 |
| 174 | 3300025908 | Ga0207643_10018489 | Ga0207643_100184894 | 235 |
| 175 | 3300025918 | Ga0207662_10031361 | Ga0207662_100313614 | 235 |
| 176 | 3300025918 | Ga0207662_10034960 | Ga0207662_100349602 | 235 |
| 177 | 3300025923 | Ga0207681_10005245 | Ga0207681_100052456 | 235 |
| 178 | 3300025923 | Ga0207681_10021662 | Ga0207681_100216622 | 235 |
| 179 | 3300025923 | Ga0207681_10254825 | Ga0207681_102548252 | 235 |
| 180 | 3300025926 | Ga0207659_10019942 | Ga0207659_100199425 | 235 |
| 181 | 3300025926 | Ga0207659_10081654 | Ga0207659_100816542 | 235 |
| 182 | 3300025926 | Ga0207659_10226054 | Ga0207659_102260542 | 235 |
| 183 | 3300025931 | Ga0207644_10276020 | Ga0207644_102760202 | 235 |
| 184 | 3300025933 | Ga0207706_10062477 | Ga0207706_100624773 | 235 |
| 185 | 3300025936 | Ga0207670_10074050 | Ga0207670_100740504 | 235 |
| 186 | 3300025937 | Ga0207669_10005661 | Ga0207669_100056615 | 235 |
| 187 | 3300025937 | Ga0207669_10232695 | Ga0207669_102326952 | 235 |
| 188 | 3300025940 | Ga0207691_10004463 | Ga0207691_1000446316 | 235 |
| 189 | 3300025940 | Ga0207691_10139098 | Ga0207691_101390982 | 235 |
| 190 | 3300025941 | Ga0207711_10540220 | Ga0207711_105402202 | 235 |
| 191 | 3300025942 | Ga0207689_10028532 | Ga0207689_100285325 | 235 |
| 192 | 3300025942 | Ga0207689_10125590 | Ga0207689_101255902 | 235 |
| 193 | 3300025945 | Ga0207679_10041870 | Ga0207679_100418705 | 235 |
| 194 | 3300025961 | Ga0207712_10036176 | Ga0207712_100361762 | 235 |
| 195 | 3300025986 | Ga0207658_10106232 | Ga0207658_101062321 | 235 |
| 196 | 3300026023 | Ga0207677_10148575 | Ga0207677_101485752 | 235 |
| 197 | 3300026035 | Ga0207703_10260448 | Ga0207703_102604481 | 235 |
| 198 | 3300026067 | Ga0207678_10104153 | Ga0207678_101041534 | 235 |
| 199 | 3300026075 | Ga0207708_10015129 | Ga0207708_100151296 | 235 |
| 200 | 3300026075 | Ga0207708_10040767 | Ga0207708_100407673 | 235 |
| 201 | 3300026088 | Ga0207641_10218929 | Ga0207641_102189292 | 235 |
| 202 | 3300026089 | Ga0207648_10023355 | Ga0207648_100233553 | 235 |
| 203 | 3300026089 | Ga0207648_10240883 | Ga0207648_102408832 | 235 |
| 204 | 3300026116 | Ga0207674_10444049 | Ga0207674_104440492 | 235 |
| 205 | 3300026118 | Ga0207675_100002044 | Ga0207675_10000204419 | 235 |
| 206 | 3300026118 | Ga0207675_100045389 | Ga0207675_1000453895 | 235 |
| 207 | 3300026121 | Ga0207683_10021778 | Ga0207683_100217785 | 235 |
| 208 | 3300026121 | Ga0207683_10046198 | Ga0207683_100461983 | 235 |
| 209 | 3300026121 | Ga0207683_10491200 | Ga0207683_104912002 | 235 |
| 210 | 3300026142 | Ga0207698_10101766 | Ga0207698_101017661 | 235 |
| 211 | 3300027907 | Ga0207428_10009962 | Ga0207428_100099626 | 235 |
| 212 | 3300028380 | Ga0268265_10013120 | Ga0268265_100131204 | 235 |
| 213 | 3300028380 | Ga0268265_10356590 | Ga0268265_103565902 | 235 |
| 214 | 3300035691 | Ga0373931_0108374 | Ga0373931_0108374_112_822 | 235 |
| 215 | 3300042122 | Ga0450920_036249 | Ga0450920_036249_25_759 | 235 |
| 216 | 3300042436 | Ga0439435_0082720 | Ga0439435_0082720_10_720 | 235 |
| 217 | 3300048905 | Ga0496102_0650020 | Ga0496102_0650020_134_844 | 235 |
| 218 | 3300048912 | Ga0496109_0224732 | Ga0496109_0224732_797_1507 | 235 |
| 219 | 3300050508 | nmdc:mga09592_28758_c1 | nmdc:mga09592_28758_c1_1475_2185 | 235 |
| 220 | 3300050511 | nmdc:mga08y16_58540_c1 | nmdc:mga08y16_58540_c1_2603_3313 | 235 |
| 221 | 3300050511 | nmdc:mga08y16_8994_c1 | nmdc:mga08y16_8994_c1_2525_3235 | 235 |
| 222 | 3300050512 | nmdc:mga0n895_163951_c1 | nmdc:mga0n895_163951_c1_456_1166 | 235 |
| 223 | 3300050515 | nmdc:mga0a205_4739_c1 | nmdc:mga0a205_4739_c1_4484_5194 | 235 |
| 224 | 3300009094 | Ga0111539_10660070 | Ga0111539_106600702 | 236 |
| 225 | 3300031548 | Ga0307408_100289933 | Ga0307408_1002899332 | 236 |
| 226 | 3300031901 | Ga0307406_10024944 | Ga0307406_100249443 | 236 |
| 227 | 3300031911 | Ga0307412_10055768 | Ga0307412_100557682 | 236 |
| 228 | 3300031995 | Ga0307409_100016405 | Ga0307409_1000164052 | 236 |
| 229 | 3300032002 | Ga0307416_100001361 | Ga0307416_10000136112 | 236 |
| 230 | 3300032004 | Ga0307414_10670643 | Ga0307414_106706432 | 236 |
| 231 | 3300032126 | Ga0307415_100005514 | Ga0307415_1000055142 | 236 |
| 232 | 3300041406 | Ga0439439_0031866 | Ga0439439_0031866_163_876 | 236 |
| 233 | 3300042461 | Ga0439460_0060903 | Ga0439460_0060903_351_1070 | 236 |
| 234 | 3300049572 | Ga0501036_0481631 | Ga0501036_0481631_30_749 | 236 |
| 235 | 3300005295 | Ga0065707_10227950 | Ga0065707_102279502 | 237 |
| 236 | 3300005327 | Ga0070658_10615866 | Ga0070658_106158661 | 237 |
| 237 | 3300025940 | Ga0207691_10570871 | Ga0207691_105708712 | 237 |
| 238 | 3300026035 | Ga0207703_10387565 | Ga0207703_103875652 | 237 |
| 239 | 3300006844 | Ga0075428_100004507 | Ga0075428_10000450710 | 238 |
| 240 | 3300006846 | Ga0075430_100012838 | Ga0075430_1000128383 | 238 |
| 241 | 3300006847 | Ga0075431_100000501 | Ga0075431_1000005015 | 238 |
| 242 | 3300006880 | Ga0075429_100075010 | Ga0075429_1000750103 | 238 |
| 243 | 3300050508 | nmdc:mga09592_1151_c1 | nmdc:mga09592_1151_c1_7466_8185 | 238 |
| 244 | 3300050509 | nmdc:mga0qj67_8763_c1 | nmdc:mga0qj67_8763_c1_3446_4165 | 238 |
| 245 | 3300050510 | nmdc:mga06r32_77173_c1 | nmdc:mga06r32_77173_c1_1917_2636 | 238 |
| 246 | 3300059421 | Ga0590071_000331 | Ga0590071_000331_5580_6305 | 238 |
| 247 | 3300059423 | Ga0590074_030340 | Ga0590074_030340_73_798 | 238 |
| 248 | 3300059426 | Ga0590077_000492 | Ga0590077_000492_4408_5133 | 238 |
| 249 | 3300006358 | Ga0068871_100093812 | Ga0068871_1000938124 | 240 |
| 250 | 3300009177 | Ga0105248_10026197 | Ga0105248_100261972 | 240 |
| 251 | 3300014969 | Ga0157376_10717993 | Ga0157376_107179932 | 240 |
| 252 | 3300042439 | Ga0439464_0087339 | Ga0439464_0087339_113_877 | 241 |
| 253 | 3300005290 | Ga0065712_10084703 | Ga0065712_100847032 | 242 |
| 254 | 3300005336 | Ga0070680_100106740 | Ga0070680_1001067402 | 242 |
| 255 | 3300005339 | Ga0070660_100229816 | Ga0070660_1002298162 | 242 |
| 256 | 3300005366 | Ga0070659_100023014 | Ga0070659_1000230142 | 242 |
| 257 | 3300005439 | Ga0070711_100187494 | Ga0070711_1001874942 | 242 |
| 258 | 3300005457 | Ga0070662_100500351 | Ga0070662_1005003512 | 242 |
| 259 | 3300005458 | Ga0070681_10015746 | Ga0070681_100157462 | 242 |
| 260 | 3300005841 | Ga0068863_100530056 | Ga0068863_1005300562 | 242 |
| 261 | 3300006237 | Ga0097621_100550328 | Ga0097621_1005503282 | 242 |
| 262 | 3300006358 | Ga0068871_100500318 | Ga0068871_1005003181 | 242 |
| 263 | 3300006871 | Ga0075434_100258435 | Ga0075434_1002584352 | 242 |
| 264 | 3300010159 | Ga0099796_10112411 | Ga0099796_101124111 | 242 |
| 265 | 3300014969 | Ga0157376_10060384 | Ga0157376_100603845 | 242 |
| 266 | 3300025912 | Ga0207707_10018192 | Ga0207707_100181927 | 242 |
| 267 | 3300025919 | Ga0207657_10456755 | Ga0207657_104567552 | 242 |
| 268 | 3300025921 | Ga0207652_10107726 | Ga0207652_101077262 | 242 |
| 269 | 3300025932 | Ga0207690_10017268 | Ga0207690_100172686 | 242 |
| 270 | 3300035086 | Ga0373934_0010883 | Ga0373934_0010883_151_879 | 242 |
| 271 | 3300035170 | Ga0373943_0053043 | Ga0373943_0053043_713_1441 | 242 |
| 272 | 3300035725 | Ga0373947_0040231 | Ga0373947_0040231_1814_2542 | 242 |
| 273 | 3300046454 | Ga0495592_0189473 | Ga0495592_0189473_491_1219 | 242 |
| 274 | 3300048088 | Ga0495602_0124943 | Ga0495602_0124943_637_1365 | 242 |
| 275 | 3300048915 | Ga0496112_0095743 | Ga0496112_0095743_962_1690 | 242 |
| 276 | 3300048915 | Ga0496112_0224928 | Ga0496112_0224928_870_1598 | 242 |
| 277 | 3300050512 | nmdc:mga0n895_132989_c1 | nmdc:mga0n895_132989_c1_1294_2022 | 242 |
| 278 | 3300053077 | Ga0495601_0227284 | Ga0495601_0227284_262_990 | 242 |
| 279 | 3300053085 | Ga0495619_0122479 | Ga0495619_0122479_537_1265 | 242 |
| 280 | 3300005293 | Ga0065715_10143052 | Ga0065715_101430521 | 243 |
| 281 | 3300005544 | Ga0070686_100469333 | Ga0070686_1004693331 | 243 |
| 282 | 3300005549 | Ga0070704_100477602 | Ga0070704_1004776022 | 243 |
| 283 | 3300025933 | Ga0207706_10515365 | Ga0207706_105153652 | 243 |
| 284 | 3300002459 | JGI24751J29686_10001309 | JGI24751J29686_100013092 | 244 |
| 285 | 3300005340 | Ga0070689_100695777 | Ga0070689_1006957771 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fee-assembly1.cif.gz_H | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.8788 | 12 | 233 |
| 7z19-assembly1.cif.gz_I | e. coli c-p lyase bound to a single phnk abc domain | 0.8741 | 12 | 234 |
| 2awo-assembly2.cif.gz_C | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.8625 | 13 | 234 |
| 2yyz-assembly1.cif.gz_A | crystal structure of sugar abc transporter, atp-binding protein | 0.8595 | 13 | 231 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.8519 | 14 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAI1_7_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8726 | 9 | 233 | 3.40.50.300 |
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8693 | 14 | 234 | 3.40.50.300 |
| af_P9WQL5_26_341_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8671 | 12 | 233 | 3.40.50.300 |
| af_P37624_268_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8666 | 8 | 232 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8578 | 39 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8DKR1-F1-model_v4 | ABC transporter domain-containing protein | 0.9543 | 5 | 243 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A2V8DKR1-F1-model_v4 | ABC transporter domain-containing protein | 0.9313 | 5 | 243 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A858U367-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9201 | 126 | 228 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A349U1R7-F1-model_v4 | ABC transporter domain-containing protein | 0.8892 | 14 | 236 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A354XJ33-F1-model_v4 | ABC transporter ATP-binding protein | 0.889 | 34 | 214 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar