F387148

General Info

Members Datasets Scaffolds Average Seq Length
285 186 570 802

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2775507255|2778124731
Length 871
Sequence ACNKGPNNRWQGVGHIFHSQTNGFERTTAEAAINIHRTSGRGITMIARFLWLAGVASASIIASNASAQDAPQPAADNSESAEQATGRGEVIIVTARRRAETAQEVPLAISVIRGDSIEATGNFNVVKLQQLAPTLQVYTTNPRNTSVNIRGLGVPFGLTSDGFEQGVGIYVDDVYNSRVAAATFDFLDVAQVEVLRGPQGTLYGKNTTAGAINITTNQPTFDFEGRAELTVGNLNYKQAKAAISGPLSDTVAARIAVAATSRRGTLYNVTSQRWINEQDNLGIRGQLLFKPNDDFSITLSGDYSKQDPECCGTVFVRVGTTQRPITRQYDELVKAINANPNPAFPGRNYAVPSRNPYDRLTDLDSSLNAGNKIGGVSARIKWDVGPGTLTSVTAWRFWDWKPENDRDFTGLSIVSKSQNPSQQDQYSQEFRYNYESQKIDFVVGLFGFKQRIDTQGTEQQGADASRWSLTGANAGNPSILQGLTASNTQWLKSTSAALFGQLSWKVTDALTIQPGARLNYDKKSGFYQRIVTNGQGQAISCVTTPGNPLPPVLAAQCGVYQPQISAPSDSAWNFTYDFNVNYKIAQDILAYATYAKSFKTLGINQNGLPLNADNTVNFDAGTVKPESVNHYEIGLKTQFWNRRATFNLTAFRTEIKNFQATVNGGQFGTVRGYLANAEKVRSQGIEADFKVVVSDRFTAYANGAYTDAKYKKFTNAPCPPELSGGTLQPANQPADYSNAGVPNTLSPRACDISGDRLPGVSKWAFSYGAEYNIPVTLLDKDGQLYLGVDGNYRSHWNSNASPSIYTEVKGYALTNFRAGFRGEGFDIFGWVRNAFDVNYIENLQVAPGNTGLIAGQPGDPQTWGGTIKFSF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
96 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
136 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
137 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
138 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
152 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
153 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
154 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
155 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
156 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
157 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
162 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
166 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
168 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
169 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
170 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
171 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
172 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
173 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
174 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
175 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
176 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
177 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
178 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
179 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
180 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
181 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
182 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
183 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
184 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
185 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
186 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.28
Metatranscriptomes 0.7
Isolates 7.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.53
Nodule 0
Rhizoplane 1.75
Rhizosphere 56.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3660702 2162886007 Bacteria 11509
2 SwRhRL2b_contig_795598 2162886007 Bacteria 22378
3 JGI24736J21556_1000341 3300001904 Bacteria 8752
4 JGI24741J21665_1000173 3300001915 Bacteria 18592
5 JGI24740J21852_10011398 3300001979 Bacteria 3385
6 JGI24737J22298_10004162 3300001990 Bacteria 5056
7 JGI24738J21930_10002867 3300002075 Bacteria 4417
8 JGI25150J39212_1000020 3300002774 Bacteria 134928
9 JGI25151J46595_10006622 3300003187 Bacteria 5783
10 JGI25153J46596_10000017 3300003215 Bacteria 274325
11 Ga0055537_1001499 3300003773 Bacteria 8984
12 Ga0055536_1000632 3300003781 Bacteria 23942
13 Ga0055536_1002159 3300003781 Bacteria 11209
14 Ga0055530_10000014 3300003791 Bacteria 151346
15 Ga0055530_10000591 3300003791 Bacteria 31446
16 Ga0055530_10000667 3300003791 Bacteria 29254
17 Ga0055540_1005104 3300003792 Bacteria 5659
18 Ga0055531_10001569 3300003794 Bacteria 16727
19 Ga0055531_10002725 3300003794 Bacteria 11624
20 Ga0055531_10004974 3300003794 Bacteria 7890
21 Ga0065165_1001235 3300005262 Bacteria 29240
22 Ga0065704_10000192 3300005289 Bacteria 216848
23 Ga0065704_10000370 3300005289 Bacteria 38135
24 Ga0065704_10001737 3300005289 Bacteria 8281
25 Ga0070658_10000450 3300005327 Bacteria 35639
26 Ga0070670_100012664 3300005331 Bacteria 7220
27 Ga0070666_10006343 3300005335 Bacteria 7275
28 Ga0070668_100000014 3300005347 Bacteria 112374
29 Ga0070668_100011015 3300005347 Bacteria 6731
30 Ga0070668_100030270 3300005347 Bacteria 4115
31 Ga0070669_100000842 3300005353 Bacteria 22273
32 Ga0070667_100000051 3300005367 Bacteria 155117
33 Ga0070667_100000197 3300005367 Bacteria 71585
34 Ga0070667_100003000 3300005367 Bacteria 14503
35 Ga0070663_100000434 3300005455 Bacteria 22038
36 Ga0070686_100000138 3300005544 Bacteria 50075
37 Ga0070665_100000075 3300005548 Bacteria 189496
38 Ga0070665_100001304 3300005548 Bacteria 29776
39 Ga0070665_100006858 3300005548 Bacteria 11580
40 Ga0070665_100034740 3300005548 Bacteria 5071
41 Ga0068855_100010702 3300005563 Bacteria 11067
42 Ga0068855_100034979 3300005563 Bacteria 5987
43 Ga0068857_100023356 3300005577 Bacteria 5443
44 Ga0068856_100043681 3300005614 Bacteria 4409
45 Ga0068856_100068769 3300005614 Bacteria 3501
46 Ga0068863_100000005 3300005841 Bacteria 269757
47 Ga0068863_100000028 3300005841 Bacteria 181662
48 Ga0068858_100003692 3300005842 Bacteria 15164
49 Ga0068860_100000008 3300005843 Bacteria 427367
50 Ga0068860_100000290 3300005843 Bacteria 71562
51 Ga0068860_100021103 3300005843 Bacteria 6308
52 Ga0068862_100000158 3300005844 Bacteria 75829
53 Ga0075368_10009775 3300006042 Bacteria 3458
54 Ga0075363_100000143 3300006048 Bacteria 17595
55 Ga0075362_10000021 3300006177 Bacteria 62684
56 Ga0075362_10007846 3300006177 Bacteria 4061
57 Ga0075362_10012464 3300006177 Bacteria 3379
58 Ga0075367_10034921 3300006178 Bacteria 2907
59 Ga0075369_10000463 3300006186 Bacteria 12438
60 Ga0075369_10007680 3300006186 Bacteria 4120
61 Ga0075366_10000127 3300006195 Bacteria 31623
62 Ga0075370_10000061 3300006353 Bacteria 32363
63 Ga0105240_10017667 3300009093 Bacteria 9605
64 Ga0105240_10072428 3300009093 Bacteria 4259
65 Ga0105241_10004623 3300009174 Bacteria 10178
66 Ga0105249_10000037 3300009553 Bacteria 197428
67 Ga0105249_10064667 3300009553 Bacteria 3364
68 Ga0105148_100273 3300009978 Bacteria 6877
69 Ga0157373_10021224 3300013100 Bacteria 4714
70 Ga0157370_10057150 3300013104 Bacteria 3711
71 Ga0163161_10008530 3300017792 Bacteria 7092
72 Ga0213873_10000009 3300021358 Bacteria 237102
73 Ga0213876_10000004 3300021384 Bacteria 943822
74 Ga0209147_100678 3300025229 Bacteria 17543
75 Ga0207425_1000022 3300025245 Bacteria 355305
76 Ga0209129_1000882 3300025258 Bacteria 18478
77 Ga0209565_1000100 3300025263 Bacteria 130380
78 Ga0209675_1001640 3300025291 Bacteria 12490
79 Ga0209676_1000421 3300025292 Bacteria 74706
80 Ga0209676_1001159 3300025292 Bacteria 28678
81 Ga0209025_1000842 3300025294 Bacteria 48558
82 Ga0209758_1000004 3300025297 Bacteria 1375322
83 Ga0209758_1000817 3300025297 Bacteria 43865
84 Ga0209050_1000001 3300025298 Bacteria 3563507
85 Ga0209050_1000026 3300025298 Bacteria 499134
86 Ga0209050_1000034 3300025298 Bacteria 433906
87 Ga0209050_1000112 3300025298 Bacteria 210320
88 Ga0209050_1003282 3300025298 Bacteria 12151
89 Ga0209050_1017178 3300025298 Bacteria 2903
90 Ga0209257_1000009 3300025304 Bacteria 1205047
91 Ga0209257_1000052 3300025304 Bacteria 430947
92 Ga0209257_1000250 3300025304 Bacteria 124024
93 Ga0209257_1000600 3300025304 Bacteria 59824
94 Ga0209257_1001934 3300025304 Bacteria 22347
95 Ga0209257_1002097 3300025304 Bacteria 20929
96 Ga0207697_10005303 3300025315 Bacteria 6005
97 Ga0207713_1010164 3300025735 Bacteria 5229
98 Ga0207705_10000004 3300025909 Bacteria 705756
99 Ga0207695_10008858 3300025913 Bacteria 12529
100 Ga0207652_10017162 3300025921 Bacteria 5921
101 Ga0207681_10000353 3300025923 Bacteria 32847
102 Ga0207681_10002137 3300025923 Bacteria 12618
103 Ga0207681_10044743 3300025923 Bacteria 2968
104 Ga0207694_10028574 3300025924 Bacteria 4251
105 Ga0207644_10002813 3300025931 Bacteria 11221
106 Ga0207644_10008823 3300025931 Bacteria 6602
107 Ga0207667_10004477 3300025949 Bacteria 17107
108 Ga0207667_10011506 3300025949 Bacteria 10279
109 Ga0207712_10000035 3300025961 Bacteria 201152
110 Ga0207668_10000047 3300025972 Bacteria 101453
111 Ga0207668_10005186 3300025972 Bacteria 7663
112 Ga0207668_10019751 3300025972 Bacteria 4266
113 Ga0207640_10000825 3300025981 Bacteria 17632
114 Ga0207658_10000057 3300025986 Bacteria 124003
115 Ga0207658_10000157 3300025986 Bacteria 71628
116 Ga0207658_10006356 3300025986 Bacteria 8068
117 Ga0207703_10006100 3300026035 Bacteria 9641
118 Ga0207639_10059810 3300026041 Bacteria 2937
119 Ga0207678_10000584 3300026067 Bacteria 33400
120 Ga0207702_10003206 3300026078 Bacteria 15097
121 Ga0207641_10000014 3300026088 Bacteria 336170
122 Ga0207641_10000198 3300026088 Bacteria 81646
123 Ga0207641_10009938 3300026088 Bacteria 7830
124 Ga0207641_10030505 3300026088 Bacteria 4467
125 Ga0207676_10014862 3300026095 Bacteria 5608
126 Ga0207674_10014224 3300026116 Bacteria 8793
127 Ga0207674_10020626 3300026116 Bacteria 7116
128 Ga0207674_10053585 3300026116 Bacteria 4111
129 Ga0207698_10000019 3300026142 Bacteria 145910
130 Ga0209813_10000021 3300027866 Bacteria 75014
131 Ga0209813_10000129 3300027866 Bacteria 27547
132 Ga0209974_10011460 3300027876 Bacteria 2976
133 Ga0268266_10000103 3300028379 Bacteria 179736
134 Ga0268266_10000215 3300028379 Bacteria 100801
135 Ga0268266_10010097 3300028379 Bacteria 8280
136 Ga0268265_10000987 3300028380 Bacteria 25839
137 Ga0268265_10005548 3300028380 Bacteria 8614
138 Ga0268264_10000274 3300028381 Bacteria 89144
139 Ga0268264_10000588 3300028381 Bacteria 44134
140 Ga0268264_10005641 3300028381 Bacteria 10607
141 Ga0268264_10008721 3300028381 Bacteria 8417
142 Ga0268264_10019239 3300028381 Bacteria 5581
143 Ga0307408_100044748 3300031548 Bacteria 3156
144 Ga0307412_10026503 3300031911 Bacteria 3603
145 Ga0307409_100020561 3300031995 Bacteria 4503
146 Ga0307409_100044956 3300031995 Bacteria 3330
147 Ga0307416_100014339 3300032002 Bacteria 5427
148 Ga0307414_10001241 3300032004 Bacteria 13140
149 Ga0307414_10004751 3300032004 Bacteria 7416
150 Ga0395901_0052174 3300038443 Bacteria 4251
151 Ga0237819_01643 3300038705 Bacteria 5505
152 Ga0436365_0192103 3300039437 Bacteria 182879
153 Ga0436362_1073687 3300039453 Bacteria 111211
154 Ga0439465_0000607 3300041413 Bacteria 10860
155 Ga0439431_0000029 3300041997 Bacteria 22226
156 Ga0439445_0000832 3300042004 Bacteria 6516
157 Ga0439432_000209 3300042006 Bacteria 20859
158 Ga0439434_0000160 3300042435 Bacteria 18106
159 Ga0451576_0000393 3300045051 Bacteria 101814
160 Ga0495627_000124 3300046453 Bacteria 93651
161 Ga0495627_000431 3300046453 Bacteria 36399
162 Ga0495638_0000029 3300046460 Bacteria 330201
163 Ga0495638_0000344 3300046460 Bacteria 58565
164 Ga0495650_0000647 3300046471 Bacteria 45905
165 Ga0495583_0001937 3300046506 Bacteria 19128
166 Ga0495606_0000756 3300046507 Bacteria 49730
167 Ga0495610_0000068 3300046512 Bacteria 122949
168 Ga0495632_0000007 3300046519 Bacteria 343246
169 Ga0495632_0000445 3300046519 Bacteria 39318
170 Ga0495632_0001572 3300046519 Bacteria 18841
171 Ga0495637_0000791 3300046520 Bacteria 21154
172 Ga0495643_0000005 3300046522 Bacteria 443135
173 Ga0495648_0000020 3300046524 Bacteria 254330
174 Ga0495663_0000005 3300046525 Bacteria 342265
175 Ga0495622_0027973 3300046557 Bacteria 2631
176 Ga0495633_0000256 3300046558 Bacteria 62904
177 Ga0495633_0000766 3300046558 Bacteria 28930
178 Ga0495668_0000002 3300046616 Bacteria 763179
179 Ga0495625_0001486 3300046660 Bacteria 28280
180 Ga0495625_0032696 3300046660 Bacteria 3855
181 Ga0495671_0000007 3300046692 Bacteria 443069
182 Ga0495671_0000022 3300046692 Bacteria 255591
183 Ga0495677_0012925 3300047445 Bacteria 3040
184 Ga0495673_0000051 3300047469 Bacteria 255511
185 Ga0495681_0000055 3300047470 Bacteria 104502
186 Ga0495681_0000187 3300047470 Bacteria 52995
187 Ga0495681_0009112 3300047470 Bacteria 6146
188 Ga0495686_0014073 3300047472 Bacteria 5523
189 Ga0495686_0014277 3300047472 Bacteria 5472
190 Ga0496106_0002143 3300048909 Bacteria 14742
191 Ga0496108_0001299 3300048911 Bacteria 19625
192 Ga0496110_0014501 3300048913 Bacteria 6548
193 Ga0496111_0026793 3300048914 Bacteria 4072
194 Ga0496115_0000354 3300048918 Bacteria 38566
195 Ga0496116_0024964 3300048919 Bacteria 4405
196 Ga0496118_0049232 3300048921 Bacteria 3247
197 Ga0496121_0002582 3300048924 Bacteria 27397
198 Ga0496121_0049116 3300048924 Bacteria 3582
199 Ga0496122_0000092 3300048925 Bacteria 204463
200 Ga0496122_0006942 3300048925 Bacteria 12766
201 Ga0496122_0007130 3300048925 Bacteria 12537
202 Ga0496122_0024468 3300048925 Bacteria 5283
203 Ga0496123_0000089 3300048926 Bacteria 179941
204 Ga0496123_0002161 3300048926 Bacteria 25100
205 Ga0496123_0005742 3300048926 Bacteria 12355
206 Ga0496123_0028376 3300048926 Bacteria 4145
207 Ga0496123_0031388 3300048926 Bacteria 3867
208 Ga0496124_0014411 3300048927 Bacteria 7644
209 Ga0496125_0009090 3300048928 Bacteria 10279
210 Ga0496125_0015156 3300048928 Bacteria 7469
211 Ga0496126_0002967 3300048929 Bacteria 22043
212 Ga0496126_0029976 3300048929 Bacteria 5163
213 Ga0496126_0031198 3300048929 Bacteria 5039
214 Ga0496126_0097978 3300048929 Bacteria 2569
215 Ga0501335_000227 3300049551 Bacteria 3165
216 Ga0501047_0002789 3300049581 Bacteria 16594
217 Ga0501223_000021 3300049663 Bacteria 66697
218 Ga0501223_000314 3300049663 Bacteria 12043
219 Ga0501224_000011 3300049664 Bacteria 93275
220 Ga0501233_000376 3300049668 Bacteria 7065
221 Ga0501249_001161 3300049679 Bacteria 5548
222 Ga0501225_0000011 3300049705 Bacteria 74084
223 Ga0501225_0000152 3300049705 Bacteria 21223
224 Ga0501044_0000121 3300049823 Bacteria 93902
225 Ga0501226_000024 3300049853 Bacteria 93123
226 nmdc:mga03683_517_c1 3300050489 Bacteria 11047
227 nmdc:mga03683_69_c1 3300050489 Bacteria 38507
228 nmdc:mga0k408_11759_c1 3300050493 Bacteria 4775
229 nmdc:mga0k408_45_c1 3300050493 Bacteria 63055
230 nmdc:mga06z11_77_c1 3300050494 Bacteria 41112
231 nmdc:mga06z11_887_c1 3300050494 Bacteria 10914
232 nmdc:mga04h51_21_c1 3300050495 Bacteria 66720
233 nmdc:mga04h51_281_c1 3300050495 Bacteria 13079
234 nmdc:mga07m45_17_c1 3300050496 Bacteria 140936
235 nmdc:mga07m45_348_c1 3300050496 Bacteria 18873
236 nmdc:mga07m45_39_c1 3300050496 Bacteria 63381
237 nmdc:mga0sz30_216_c2 3300050516 Bacteria 19105
238 nmdc:mga0sz30_73_c1 3300050516 Bacteria 38998
239 Ga0500643_000351 3300053087 Bacteria 36635
240 Ga0500643_002654 3300053087 Bacteria 9025
241 Ga0500643_007554 3300053087 Bacteria 4364
242 Ga0500556_0000037 3300053104 Bacteria 138433
243 Ga0500562_000351 3300053108 Bacteria 11082
244 Ga0500562_000501 3300053108 Bacteria 9535
245 Ga0500594_0003127 3300053118 Bacteria 3619
246 Ga0500595_000516 3300053119 Bacteria 23303
247 Ga0500607_000023 3300053121 Bacteria 97892
248 Ga0500607_000240 3300053121 Bacteria 51266
249 Ga0500618_000383 3300053125 Bacteria 30546
250 Ga0500642_0000002 3300053130 Bacteria 795093
251 Ga0500658_0001066 3300053134 Bacteria 11224
252 Ga0500559_0000291 3300053136 Bacteria 38726
253 Ga0500559_0001524 3300053136 Bacteria 12986
254 Ga0500559_0008882 3300053136 Bacteria 4376
255 Ga0500559_0009179 3300053136 Bacteria 4294
256 Ga0500568_0004798 3300053139 Bacteria 7145
257 Ga0500616_0000042 3300053153 Bacteria 351293
258 Ga0500622_0001171 3300053156 Bacteria 21707
259 Ga0500624_000026 3300053157 Bacteria 109681
260 Ga0500627_0000006 3300053158 Bacteria 165989
261 Ga0500636_0001913 3300053177 Bacteria 11432
262 Ga0500645_000245 3300053730 Bacteria 40642
263 Ga0500645_001040 3300053730 Bacteria 15492
264 Ga0500661_000048 3300055283 Bacteria 18431
265 Ga0587090_000180 3300059510 Bacteria 4453
266 2778124731 2775507255 Bacteria 3945731
267 2512643733 2512564014 Bacteria 4639632
268 2643730056 2643221541 Bacteria 5498788
269 2643821186 2643221560 Bacteria 4801179
270 2643832695 2643221563 Bacteria 4726935
271 2643949910 2643221588 Bacteria 3692460
272 2644045542 2643221606 Bacteria 5588032
273 2644053510 2643221608 Bacteria 4724829
274 2644392832 2643221671 Bacteria 5496681
275 2809064305 2808606401 Bacteria 4586670
276 2809080273 2808606404 Bacteria 4652788
277 2809084637 2808606405 Bacteria 4586632
278 2848297308 2848297114 Bacteria 3608511
279 2879166970 2879163058 Bacteria 4223965
280 2880522126 2880518877 Bacteria 5012590
281 2885431492 2885429604 Bacteria 3642894
282 2895882858 2895880812 Bacteria 11255272
283 2896184462 2896184354 Bacteria 3258548
284 2919141204 2919138771 Bacteria 5281312
285 2919712224 2919709256 Bacteria 4318106
286 SwRhRL2b_contig_3660702
287 SwRhRL2b_contig_795598
288 JGI24736J21556_1000341
289 JGI24741J21665_1000173
290 JGI24740J21852_10011398
291 JGI24737J22298_10004162
292 JGI24738J21930_10002867
293 JGI25150J39212_1000020
294 JGI25151J46595_10006622
295 JGI25153J46596_10000017
296 Ga0055537_1001499
297 Ga0055536_1000632
298 Ga0055536_1002159
299 Ga0055530_10000014
300 Ga0055530_10000591
301 Ga0055530_10000667
302 Ga0055540_1005104
303 Ga0055531_10001569
304 Ga0055531_10002725
305 Ga0055531_10004974
306 Ga0065165_1001235
307 Ga0065704_10000192
308 Ga0065704_10000370
309 Ga0065704_10001737
310 Ga0070658_10000450
311 Ga0070670_100012664
312 Ga0070666_10006343
313 Ga0070668_100000014
314 Ga0070668_100011015
315 Ga0070668_100030270
316 Ga0070669_100000842
317 Ga0070667_100000051
318 Ga0070667_100000197
319 Ga0070667_100003000
320 Ga0070663_100000434
321 Ga0070686_100000138
322 Ga0070665_100000075
323 Ga0070665_100001304
324 Ga0070665_100006858
325 Ga0070665_100034740
326 Ga0068855_100010702
327 Ga0068855_100034979
328 Ga0068857_100023356
329 Ga0068856_100043681
330 Ga0068856_100068769
331 Ga0068863_100000005
332 Ga0068863_100000028
333 Ga0068858_100003692
334 Ga0068860_100000008
335 Ga0068860_100000290
336 Ga0068860_100021103
337 Ga0068862_100000158
338 Ga0075368_10009775
339 Ga0075363_100000143
340 Ga0075362_10000021
341 Ga0075362_10007846
342 Ga0075362_10012464
343 Ga0075367_10034921
344 Ga0075369_10000463
345 Ga0075369_10007680
346 Ga0075366_10000127
347 Ga0075370_10000061
348 Ga0105240_10017667
349 Ga0105240_10072428
350 Ga0105241_10004623
351 Ga0105249_10000037
352 Ga0105249_10064667
353 Ga0105148_100273
354 Ga0157373_10021224
355 Ga0157370_10057150
356 Ga0163161_10008530
357 Ga0213873_10000009
358 Ga0213876_10000004
359 Ga0209147_100678
360 Ga0207425_1000022
361 Ga0209129_1000882
362 Ga0209565_1000100
363 Ga0209675_1001640
364 Ga0209676_1000421
365 Ga0209676_1001159
366 Ga0209025_1000842
367 Ga0209758_1000004
368 Ga0209758_1000817
369 Ga0209050_1000001
370 Ga0209050_1000026
371 Ga0209050_1000034
372 Ga0209050_1000112
373 Ga0209050_1003282
374 Ga0209050_1017178
375 Ga0209257_1000009
376 Ga0209257_1000052
377 Ga0209257_1000250
378 Ga0209257_1000600
379 Ga0209257_1001934
380 Ga0209257_1002097
381 Ga0207697_10005303
382 Ga0207713_1010164
383 Ga0207705_10000004
384 Ga0207695_10008858
385 Ga0207652_10017162
386 Ga0207681_10000353
387 Ga0207681_10002137
388 Ga0207681_10044743
389 Ga0207694_10028574
390 Ga0207644_10002813
391 Ga0207644_10008823
392 Ga0207667_10004477
393 Ga0207667_10011506
394 Ga0207712_10000035
395 Ga0207668_10000047
396 Ga0207668_10005186
397 Ga0207668_10019751
398 Ga0207640_10000825
399 Ga0207658_10000057
400 Ga0207658_10000157
401 Ga0207658_10006356
402 Ga0207703_10006100
403 Ga0207639_10059810
404 Ga0207678_10000584
405 Ga0207702_10003206
406 Ga0207641_10000014
407 Ga0207641_10000198
408 Ga0207641_10009938
409 Ga0207641_10030505
410 Ga0207676_10014862
411 Ga0207674_10014224
412 Ga0207674_10020626
413 Ga0207674_10053585
414 Ga0207698_10000019
415 Ga0209813_10000021
416 Ga0209813_10000129
417 Ga0209974_10011460
418 Ga0268266_10000103
419 Ga0268266_10000215
420 Ga0268266_10010097
421 Ga0268265_10000987
422 Ga0268265_10005548
423 Ga0268264_10000274
424 Ga0268264_10000588
425 Ga0268264_10005641
426 Ga0268264_10008721
427 Ga0268264_10019239
428 Ga0307408_100044748
429 Ga0307412_10026503
430 Ga0307409_100020561
431 Ga0307409_100044956
432 Ga0307416_100014339
433 Ga0307414_10001241
434 Ga0307414_10004751
435 Ga0395901_0052174
436 Ga0237819_01643
437 Ga0436365_0192103
438 Ga0436362_1073687
439 Ga0439465_0000607
440 Ga0439431_0000029
441 Ga0439445_0000832
442 Ga0439432_000209
443 Ga0439434_0000160
444 Ga0451576_0000393
445 Ga0495627_000124
446 Ga0495627_000431
447 Ga0495638_0000029
448 Ga0495638_0000344
449 Ga0495650_0000647
450 Ga0495583_0001937
451 Ga0495606_0000756
452 Ga0495610_0000068
453 Ga0495632_0000007
454 Ga0495632_0000445
455 Ga0495632_0001572
456 Ga0495637_0000791
457 Ga0495643_0000005
458 Ga0495648_0000020
459 Ga0495663_0000005
460 Ga0495622_0027973
461 Ga0495633_0000256
462 Ga0495633_0000766
463 Ga0495668_0000002
464 Ga0495625_0001486
465 Ga0495625_0032696
466 Ga0495671_0000007
467 Ga0495671_0000022
468 Ga0495677_0012925
469 Ga0495673_0000051
470 Ga0495681_0000055
471 Ga0495681_0000187
472 Ga0495681_0009112
473 Ga0495686_0014073
474 Ga0495686_0014277
475 Ga0496106_0002143
476 Ga0496108_0001299
477 Ga0496110_0014501
478 Ga0496111_0026793
479 Ga0496115_0000354
480 Ga0496116_0024964
481 Ga0496118_0049232
482 Ga0496121_0002582
483 Ga0496121_0049116
484 Ga0496122_0000092
485 Ga0496122_0006942
486 Ga0496122_0007130
487 Ga0496122_0024468
488 Ga0496123_0000089
489 Ga0496123_0002161
490 Ga0496123_0005742
491 Ga0496123_0028376
492 Ga0496123_0031388
493 Ga0496124_0014411
494 Ga0496125_0009090
495 Ga0496125_0015156
496 Ga0496126_0002967
497 Ga0496126_0029976
498 Ga0496126_0031198
499 Ga0496126_0097978
500 Ga0501335_000227
501 Ga0501047_0002789
502 Ga0501223_000021
503 Ga0501223_000314
504 Ga0501224_000011
505 Ga0501233_000376
506 Ga0501249_001161
507 Ga0501225_0000011
508 Ga0501225_0000152
509 Ga0501044_0000121
510 Ga0501226_000024
511 nmdc:mga03683_517_c1
512 nmdc:mga03683_69_c1
513 nmdc:mga0k408_11759_c1
514 nmdc:mga0k408_45_c1
515 nmdc:mga06z11_77_c1
516 nmdc:mga06z11_887_c1
517 nmdc:mga04h51_21_c1
518 nmdc:mga04h51_281_c1
519 nmdc:mga07m45_17_c1
520 nmdc:mga07m45_348_c1
521 nmdc:mga07m45_39_c1
522 nmdc:mga0sz30_216_c2
523 nmdc:mga0sz30_73_c1
524 Ga0500643_000351
525 Ga0500643_002654
526 Ga0500643_007554
527 Ga0500556_0000037
528 Ga0500562_000351
529 Ga0500562_000501
530 Ga0500594_0003127
531 Ga0500595_000516
532 Ga0500607_000023
533 Ga0500607_000240
534 Ga0500618_000383
535 Ga0500642_0000002
536 Ga0500658_0001066
537 Ga0500559_0000291
538 Ga0500559_0001524
539 Ga0500559_0008882
540 Ga0500559_0009179
541 Ga0500568_0004798
542 Ga0500616_0000042
543 Ga0500622_0001171
544 Ga0500624_000026
545 Ga0500627_0000006
546 Ga0500636_0001913
547 Ga0500645_000245
548 Ga0500645_001040
549 Ga0500661_000048
550 Ga0587090_000180
551 2778124731
552 2512643733
553 2643730056
554 2643821186
555 2643832695
556 2643949910
557 2644045542
558 2644053510
559 2644392832
560 2809064305
561 2809080273
562 2809084637
563 2848297308
564 2879166970
565 2880522126
566 2885431492
567 2895882858
568 2896184462
569 2919141204
570 2919712224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07715

Plug

TonB-dependent Receptor Plug Domain

101

211

0.96

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

312

834

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
4epa-assembly1.cif.gz_A the crystal structure of the ferric yersiniabactin uptake receptor fyua from yersinia pestis 0.9079 77 822
4epa-assembly1.cif.gz_A the crystal structure of the ferric yersiniabactin uptake receptor fyua from yersinia pestis 0.88 77 822
1nqe-assembly1.cif.gz_A outer membrane cobalamin transporter (btub) from e. coli 0.8182 77 822
3m8b-assembly1.cif.gz_A crystal structure of spin-labeled btub v10r1 in the apo state 0.818 77 822
1nqf-assembly1.cif.gz_A outer membrane cobalamin transporter (btub) from e. coli, methionine substiution construct for se-met sad phasing 0.8159 77 822
ID Description Score Start End Superfamily
4epaA00 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.9009 77 822 2.40.170.20
4epaA00 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8727 77 822 2.40.170.20
3rgnA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7965 184 822 2.40.170.20
3rgnA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7947 184 822 2.40.170.20
1xkwA01 Mainly Beta;Beta Complex;Ferric Hydroxamate Uptake Protein; Chain A, domain 1;TonB-dependent receptor, plug domain 0.7905 76 184 2.170.130.10
ID Description Score Start End GO Terms
AF-A0A5B8CIA5-F1-model_v4 TonB-dependent receptor 0.9216 527 818 GO:0006826
GO:0009279
AF-A0A381GPP8-F1-model_v4 deleted 0.908 176 822
AF-T0FZC8-F1-model_v4 TonB-denpendent receptor 0.9074 27 822 GO:0006826
GO:0009279
AF-T0FZC8-F1-model_v4 TonB-denpendent receptor 0.9062 27 822 GO:0006826
GO:0009279
AF-A0A0F3IK49-F1-model_v4 TonB-dependent receptor-like beta-barrel domain-containing protein 0.9054 527 820 GO:0006826
GO:0009279

Map