F387257
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 286 | 184 | 275 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10318426|Ga0070709_103184261 |
| Length | 216 |
| Sequence | MRDASNTSARPHRTLLRAGIVVLCLAAASALGGCAASGPATNASAFAMATEAAGPTITFESIDGPPPQVFDRMVSVLDSETKLRSLAIVSRDAPAAYRVRSYLSAQVVHGRTVIAWVWDVYDRDQNRALRLTGEEPAGKGGRDATRDPWAAADDLVLRKIAQAGLSGLSGMVNGGPADAPQPAPVPGGKRGPAVANNDLPDGAGGSNTAALGYTDH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 4 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 5 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 6 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 7 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 8 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 9 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 10 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 11 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 41 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 78 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 79 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 80 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 81 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 82 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 83 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 84 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 85 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 86 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 87 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 88 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 89 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 90 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 91 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 92 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 93 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 94 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 95 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 96 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 97 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 99 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 103 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 106 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 107 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 108 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 109 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 110 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 111 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 112 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 162 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 163 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 166 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 167 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 168 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 172 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 175 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 178 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 179 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 180 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 181 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 182 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 183 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 184 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.45 |
| Metatranscriptomes | 0.7 |
| Isolates | 3.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.34 |
| Nodule | 2.8 |
| Rhizoplane | 3.5 |
| Rhizosphere | 82.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25160J50197_1002032 | 3300003354 | Bacteria | 9646 |
| 2 | Ga0070680_100034795 | 3300005336 | Bacteria | 4063 |
| 3 | Ga0070680_100058484 | 3300005336 | Bacteria | 3152 |
| 4 | Ga0070680_100509784 | 3300005336 | Bacteria | 1030 |
| 5 | Ga0070660_100220545 | 3300005339 | Bacteria | 1541 |
| 6 | Ga0070659_100221237 | 3300005366 | Bacteria | 1563 |
| 7 | Ga0070667_100583476 | 3300005367 | Bacteria | 1029 |
| 8 | Ga0070709_10118644 | 3300005434 | Bacteria | 1789 |
| 9 | Ga0070709_10318426 | 3300005434 | Bacteria | 1141 |
| 10 | Ga0070714_100166833 | 3300005435 | Bacteria | 1996 |
| 11 | Ga0070713_100010153 | 3300005436 | Bacteria | 6791 |
| 12 | Ga0070713_100026661 | 3300005436 | Bacteria | 4540 |
| 13 | Ga0070713_100085258 | 3300005436 | Bacteria | 2705 |
| 14 | Ga0070710_10087335 | 3300005437 | Bacteria | 1833 |
| 15 | Ga0070710_10559213 | 3300005437 | Bacteria | 791 |
| 16 | Ga0070663_100381809 | 3300005455 | Bacteria | 1148 |
| 17 | Ga0070681_10048039 | 3300005458 | Bacteria | 4265 |
| 18 | Ga0070681_10191940 | 3300005458 | Bacteria | 1962 |
| 19 | Ga0070681_10388327 | 3300005458 | Bacteria | 1307 |
| 20 | Ga0070685_10423632 | 3300005466 | Bacteria | 927 |
| 21 | Ga0070679_100124438 | 3300005530 | Bacteria | 2561 |
| 22 | Ga0070679_100315221 | 3300005530 | Bacteria | 1514 |
| 23 | Ga0070684_100025110 | 3300005535 | Bacteria | 5004 |
| 24 | Ga0070684_100553491 | 3300005535 | Bacteria | 1068 |
| 25 | Ga0070684_101066741 | 3300005535 | Bacteria | 759 |
| 26 | Ga0068853_100009938 | 3300005539 | Bacteria | 7683 |
| 27 | Ga0070693_100184150 | 3300005547 | Bacteria | 1346 |
| 28 | Ga0070665_100608784 | 3300005548 | Bacteria | 1105 |
| 29 | Ga0068855_100084583 | 3300005563 | Bacteria | 3672 |
| 30 | Ga0068855_100863738 | 3300005563 | Bacteria | 958 |
| 31 | Ga0070664_100459613 | 3300005564 | Bacteria | 1169 |
| 32 | Ga0070664_100629645 | 3300005564 | Bacteria | 996 |
| 33 | Ga0068857_100111340 | 3300005577 | Bacteria | 2461 |
| 34 | Ga0068856_100012522 | 3300005614 | Bacteria | 8211 |
| 35 | Ga0068856_101327994 | 3300005614 | Bacteria | 734 |
| 36 | Ga0068852_100048293 | 3300005616 | Bacteria | 3636 |
| 37 | Ga0068851_10039654 | 3300005834 | Bacteria | 2366 |
| 38 | Ga0068863_100318214 | 3300005841 | Bacteria | 1511 |
| 39 | Ga0070717_10124033 | 3300006028 | Bacteria | 2216 |
| 40 | Ga0075364_10066914 | 3300006051 | Bacteria | 2361 |
| 41 | Ga0075362_10223486 | 3300006177 | Bacteria | 921 |
| 42 | Ga0075436_100298531 | 3300006914 | Bacteria | 1154 |
| 43 | Ga0099794_10092613 | 3300007265 | Bacteria | 1501 |
| 44 | Ga0099794_10209930 | 3300007265 | Bacteria | 998 |
| 45 | Ga0099795_10015450 | 3300007788 | Bacteria | 2392 |
| 46 | Ga0099795_10072691 | 3300007788 | Bacteria | 1301 |
| 47 | Ga0105240_10069319 | 3300009093 | Bacteria | 4365 |
| 48 | Ga0105240_10073756 | 3300009093 | Bacteria | 4214 |
| 49 | Ga0105240_10238202 | 3300009093 | Bacteria | 2111 |
| 50 | Ga0105248_10342284 | 3300009177 | Bacteria | 1684 |
| 51 | Ga0105237_10153816 | 3300009545 | Bacteria | 2296 |
| 52 | Ga0105237_10233844 | 3300009545 | Bacteria | 1839 |
| 53 | Ga0105237_10672955 | 3300009545 | Bacteria | 1042 |
| 54 | Ga0105238_10047323 | 3300009551 | Bacteria | 4338 |
| 55 | Ga0099796_10249534 | 3300010159 | Bacteria | 736 |
| 56 | Ga0105239_10196154 | 3300010375 | Bacteria | 2261 |
| 57 | Ga0105239_10763838 | 3300010375 | Bacteria | 1107 |
| 58 | Ga0157370_10040561 | 3300013104 | Bacteria | 4495 |
| 59 | Ga0157369_10009599 | 3300013105 | Bacteria | 11066 |
| 60 | Ga0157369_10038736 | 3300013105 | Bacteria | 5212 |
| 61 | Ga0157369_10589102 | 3300013105 | Bacteria | 1148 |
| 62 | Ga0157369_10969873 | 3300013105 | Bacteria | 871 |
| 63 | Ga0157369_11163921 | 3300013105 | Bacteria | 787 |
| 64 | Ga0157374_10090216 | 3300013296 | Bacteria | 2922 |
| 65 | Ga0157372_10185235 | 3300013307 | Bacteria | 2411 |
| 66 | Ga0157372_10214867 | 3300013307 | Bacteria | 2229 |
| 67 | Ga0157372_10653993 | 3300013307 | Bacteria | 1224 |
| 68 | Ga0206353_11560999 | 3300020082 | Bacteria | 857 |
| 69 | Ga0209148_1003513 | 3300025254 | Bacteria | 4285 |
| 70 | Ga0209233_1000632 | 3300025261 | Bacteria | 17550 |
| 71 | Ga0209455_1003858 | 3300025272 | Bacteria | 5122 |
| 72 | Ga0209758_1025363 | 3300025297 | Bacteria | 2604 |
| 73 | Ga0207426_1002035 | 3300025302 | Bacteria | 14130 |
| 74 | Ga0207699_10014962 | 3300025906 | Bacteria | 4018 |
| 75 | Ga0207699_10372160 | 3300025906 | Bacteria | 1012 |
| 76 | Ga0207707_10018870 | 3300025912 | Bacteria | 6015 |
| 77 | Ga0207707_10306254 | 3300025912 | Bacteria | 1373 |
| 78 | Ga0207695_10042621 | 3300025913 | Bacteria | 4844 |
| 79 | Ga0207671_10075759 | 3300025914 | Bacteria | 2517 |
| 80 | Ga0207663_10096118 | 3300025916 | Bacteria | 1978 |
| 81 | Ga0207660_10117120 | 3300025917 | Bacteria | 2013 |
| 82 | Ga0207649_10026494 | 3300025920 | Bacteria | 3392 |
| 83 | Ga0207649_10239875 | 3300025920 | Bacteria | 1301 |
| 84 | Ga0207652_10026205 | 3300025921 | Bacteria | 4854 |
| 85 | Ga0207700_10012174 | 3300025928 | Bacteria | 5533 |
| 86 | Ga0207700_10030323 | 3300025928 | Bacteria | 3828 |
| 87 | Ga0207664_10967106 | 3300025929 | Bacteria | 763 |
| 88 | Ga0207665_10170931 | 3300025939 | Bacteria | 1570 |
| 89 | Ga0207679_10269082 | 3300025945 | Bacteria | 1457 |
| 90 | Ga0207667_10055331 | 3300025949 | Bacteria | 4171 |
| 91 | Ga0207667_10094193 | 3300025949 | Bacteria | 3092 |
| 92 | Ga0207667_10346703 | 3300025949 | Bacteria | 1515 |
| 93 | Ga0207658_10507612 | 3300025986 | Bacteria | 1075 |
| 94 | Ga0207678_10105721 | 3300026067 | Bacteria | 2401 |
| 95 | Ga0207702_10019322 | 3300026078 | Bacteria | 5638 |
| 96 | Ga0207702_10783936 | 3300026078 | Bacteria | 942 |
| 97 | Ga0207698_10094668 | 3300026142 | Bacteria | 2456 |
| 98 | Ga0209179_1043938 | 3300027512 | Bacteria | 946 |
| 99 | Ga0209588_1007959 | 3300027671 | Bacteria | 3134 |
| 100 | Ga0265340_10032597 | 3300031247 | Bacteria | 2600 |
| 101 | Ga0265339_10025233 | 3300031249 | Bacteria | 3413 |
| 102 | Ga0307412_10462671 | 3300031911 | Bacteria | 1048 |
| 103 | Ga0307414_10407933 | 3300032004 | Bacteria | 1182 |
| 104 | Ga0307510_10091320 | 3300033180 | Bacteria | 2888 |
| 105 | Ga0373926_0067383 | 3300035083 | Bacteria | 1311 |
| 106 | Ga0373934_0007485 | 3300035086 | Bacteria | 4054 |
| 107 | Ga0373934_0146194 | 3300035086 | Bacteria | 967 |
| 108 | Ga0373923_0002374 | 3300035111 | Bacteria | 5779 |
| 109 | Ga0373923_0025251 | 3300035111 | Bacteria | 2353 |
| 110 | Ga0373923_0115731 | 3300035111 | Bacteria | 1194 |
| 111 | Ga0373936_0062657 | 3300035113 | Bacteria | 1521 |
| 112 | Ga0373945_0037602 | 3300035116 | Bacteria | 1738 |
| 113 | Ga0373954_0010854 | 3300035118 | Bacteria | 4027 |
| 114 | Ga0373954_0202021 | 3300035118 | Bacteria | 977 |
| 115 | Ga0373956_0006883 | 3300035119 | Bacteria | 4567 |
| 116 | Ga0373943_0070362 | 3300035170 | Bacteria | 1770 |
| 117 | Ga0373943_0086235 | 3300035170 | Bacteria | 1618 |
| 118 | Ga0373946_0019830 | 3300035171 | Bacteria | 2594 |
| 119 | Ga0373946_0022624 | 3300035171 | Bacteria | 2448 |
| 120 | Ga0373955_0000678 | 3300035172 | Bacteria | 14552 |
| 121 | Ga0373955_0018338 | 3300035172 | Bacteria | 3479 |
| 122 | Ga0373924_0006921 | 3300035410 | Bacteria | 4080 |
| 123 | Ga0373924_0145146 | 3300035410 | Bacteria | 1036 |
| 124 | Ga0373935_0072433 | 3300035692 | Bacteria | 2224 |
| 125 | Ga0373927_0001392 | 3300035695 | Bacteria | 18221 |
| 126 | Ga0373927_0002614 | 3300035695 | Bacteria | 13125 |
| 127 | Ga0373927_0011289 | 3300035695 | Bacteria | 5945 |
| 128 | Ga0373933_0250641 | 3300035724 | Bacteria | 1140 |
| 129 | Ga0373947_0002951 | 3300035725 | Bacteria | 10153 |
| 130 | Ga0373947_0006776 | 3300035725 | Bacteria | 6644 |
| 131 | Ga0373947_0044912 | 3300035725 | Bacteria | 2643 |
| 132 | Ga0373937_0008389 | 3300036401 | Bacteria | 8977 |
| 133 | Ga0373937_0053010 | 3300036401 | Bacteria | 3720 |
| 134 | Ga0372808_022896 | 3300036459 | Bacteria | 897 |
| 135 | Ga0373925_0004635 | 3300037068 | Bacteria | 10377 |
| 136 | Ga0373925_0010628 | 3300037068 | Bacteria | 6675 |
| 137 | Ga0373925_0126956 | 3300037068 | Bacteria | 1985 |
| 138 | Ga0395899_0071740 | 3300037312 | Bacteria | 2535 |
| 139 | Ga0395899_0341103 | 3300037312 | Bacteria | 1004 |
| 140 | Ga0395900_0001526 | 3300037418 | Bacteria | 27536 |
| 141 | Ga0395900_0009206 | 3300037418 | Bacteria | 10122 |
| 142 | Ga0395900_0431320 | 3300037418 | Bacteria | 1277 |
| 143 | Ga0395898_0005460 | 3300037466 | Bacteria | 13735 |
| 144 | Ga0395898_0062207 | 3300037466 | Bacteria | 3625 |
| 145 | Ga0436364_0318435 | 3300037853 | Bacteria | 5212 |
| 146 | Ga0436364_1424390 | 3300037853 | Bacteria | 759 |
| 147 | Ga0395901_0015205 | 3300038443 | Bacteria | 7830 |
| 148 | Ga0395901_0232328 | 3300038443 | Bacteria | 1925 |
| 149 | Ga0436365_1746327 | 3300039437 | Bacteria | 768 |
| 150 | Ga0436363_1011758 | 3300039450 | Bacteria | 905 |
| 151 | Ga0466966_0290263 | 3300044684 | Bacteria | 983 |
| 152 | Ga0466968_0104605 | 3300044735 | Bacteria | 1267 |
| 153 | Ga0466957_0407354 | 3300044842 | Bacteria | 931 |
| 154 | Ga0466959_0105874 | 3300045049 | Bacteria | 2011 |
| 155 | Ga0466959_0265885 | 3300045049 | Bacteria | 1180 |
| 156 | Ga0466967_0061875 | 3300045976 | Bacteria | 3322 |
| 157 | Ga0495592_0214181 | 3300046454 | Bacteria | 1292 |
| 158 | Ga0495603_0001860 | 3300046455 | Bacteria | 12433 |
| 159 | Ga0495603_0004304 | 3300046455 | Bacteria | 8487 |
| 160 | Ga0495629_0000333 | 3300046459 | Bacteria | 40364 |
| 161 | Ga0495629_0003378 | 3300046459 | Bacteria | 12064 |
| 162 | Ga0495641_0002407 | 3300046461 | Bacteria | 14806 |
| 163 | Ga0495653_0000367 | 3300046463 | Bacteria | 36475 |
| 164 | Ga0495653_0381976 | 3300046463 | Bacteria | 899 |
| 165 | Ga0495580_0001991 | 3300046472 | Bacteria | 17967 |
| 166 | Ga0495580_0076747 | 3300046472 | Bacteria | 2330 |
| 167 | Ga0495582_0000581 | 3300046473 | Bacteria | 20224 |
| 168 | Ga0495582_0077679 | 3300046473 | Bacteria | 1841 |
| 169 | Ga0495639_0000231 | 3300046475 | Bacteria | 27804 |
| 170 | Ga0495639_0004148 | 3300046475 | Bacteria | 6211 |
| 171 | Ga0495662_0016401 | 3300046476 | Bacteria | 3588 |
| 172 | Ga0495664_0003595 | 3300046477 | Bacteria | 8454 |
| 173 | Ga0495664_0003992 | 3300046477 | Bacteria | 8062 |
| 174 | Ga0495664_0047852 | 3300046477 | Bacteria | 2538 |
| 175 | Ga0495594_0001601 | 3300046499 | Bacteria | 11777 |
| 176 | Ga0495594_0138792 | 3300046499 | Bacteria | 1378 |
| 177 | Ga0495606_0005525 | 3300046507 | Bacteria | 12066 |
| 178 | Ga0495606_0259577 | 3300046507 | Bacteria | 960 |
| 179 | Ga0495608_0008277 | 3300046511 | Bacteria | 7299 |
| 180 | Ga0495618_0167634 | 3300046514 | Bacteria | 1398 |
| 181 | Ga0495618_0233262 | 3300046514 | Bacteria | 1158 |
| 182 | Ga0495628_0010205 | 3300046516 | Bacteria | 7991 |
| 183 | Ga0495628_0086661 | 3300046516 | Bacteria | 2428 |
| 184 | Ga0495630_0255621 | 3300046517 | Bacteria | 1338 |
| 185 | Ga0495630_0275835 | 3300046517 | Bacteria | 1284 |
| 186 | Ga0495648_0000621 | 3300046524 | Bacteria | 37988 |
| 187 | Ga0495648_0252615 | 3300046524 | Bacteria | 850 |
| 188 | Ga0495666_0069298 | 3300046526 | Bacteria | 1678 |
| 189 | Ga0495652_0009044 | 3300046529 | Bacteria | 9062 |
| 190 | Ga0495652_0015210 | 3300046529 | Bacteria | 6890 |
| 191 | Ga0495652_0070356 | 3300046529 | Bacteria | 2925 |
| 192 | Ga0495665_0003505 | 3300046531 | Bacteria | 8515 |
| 193 | Ga0495665_0040330 | 3300046531 | Bacteria | 2486 |
| 194 | Ga0495640_0003357 | 3300046533 | Bacteria | 12887 |
| 195 | Ga0495640_0023189 | 3300046533 | Bacteria | 4529 |
| 196 | Ga0495640_0023956 | 3300046533 | Bacteria | 4441 |
| 197 | Ga0495586_0084073 | 3300046535 | Bacteria | 1752 |
| 198 | Ga0495587_0007028 | 3300046536 | Bacteria | 7307 |
| 199 | Ga0495587_0189937 | 3300046536 | Bacteria | 1163 |
| 200 | Ga0495645_0138848 | 3300046543 | Bacteria | 1697 |
| 201 | Ga0495622_0062911 | 3300046557 | Bacteria | 1717 |
| 202 | Ga0495667_0003583 | 3300046559 | Bacteria | 10445 |
| 203 | Ga0495667_0108896 | 3300046559 | Bacteria | 1790 |
| 204 | Ga0495667_0179888 | 3300046559 | Bacteria | 1357 |
| 205 | Ga0495634_0000633 | 3300046642 | Bacteria | 34239 |
| 206 | Ga0495634_0007068 | 3300046642 | Bacteria | 8470 |
| 207 | Ga0495634_0058715 | 3300046642 | Bacteria | 2563 |
| 208 | Ga0495635_0001089 | 3300046663 | Bacteria | 18033 |
| 209 | Ga0495635_0003610 | 3300046663 | Bacteria | 10716 |
| 210 | Ga0495588_0080698 | 3300046674 | Bacteria | 1698 |
| 211 | Ga0495657_0003520 | 3300046675 | Bacteria | 12766 |
| 212 | Ga0495599_0001176 | 3300046678 | Bacteria | 14830 |
| 213 | Ga0495599_0051516 | 3300046678 | Bacteria | 2579 |
| 214 | Ga0495623_0008590 | 3300046679 | Bacteria | 6631 |
| 215 | Ga0495646_0025940 | 3300046680 | Bacteria | 3681 |
| 216 | Ga0495646_0061774 | 3300046680 | Bacteria | 2230 |
| 217 | Ga0495647_0001403 | 3300046681 | Bacteria | 7428 |
| 218 | Ga0495658_0000725 | 3300046683 | Bacteria | 17802 |
| 219 | Ga0495658_0058059 | 3300046683 | Bacteria | 2212 |
| 220 | Ga0495613_0019437 | 3300046689 | Bacteria | 5062 |
| 221 | Ga0495613_0023674 | 3300046689 | Bacteria | 4577 |
| 222 | Ga0495613_0264550 | 3300046689 | Bacteria | 1197 |
| 223 | Ga0495624_0052860 | 3300046690 | Bacteria | 2566 |
| 224 | Ga0495581_0004200 | 3300047315 | Bacteria | 8302 |
| 225 | Ga0495581_0039254 | 3300047315 | Bacteria | 2741 |
| 226 | Ga0495604_0246324 | 3300047317 | Bacteria | 1220 |
| 227 | Ga0495604_0435642 | 3300047317 | Bacteria | 858 |
| 228 | Ga0495674_0004552 | 3300047319 | Bacteria | 13338 |
| 229 | Ga0495674_0020314 | 3300047319 | Bacteria | 6152 |
| 230 | Ga0495674_0166200 | 3300047319 | Bacteria | 1843 |
| 231 | Ga0495676_0133423 | 3300047321 | Bacteria | 1789 |
| 232 | Ga0495676_0210916 | 3300047321 | Bacteria | 1344 |
| 233 | Ga0495680_0053389 | 3300047322 | Bacteria | 3145 |
| 234 | Ga0495680_0117914 | 3300047322 | Bacteria | 1962 |
| 235 | Ga0495675_0004613 | 3300047444 | Bacteria | 8364 |
| 236 | Ga0495684_0001903 | 3300047471 | Bacteria | 16747 |
| 237 | Ga0495684_0004994 | 3300047471 | Bacteria | 10354 |
| 238 | Ga0495593_0000679 | 3300047673 | Bacteria | 19632 |
| 239 | Ga0495593_0033482 | 3300047673 | Bacteria | 2798 |
| 240 | Ga0495602_0043781 | 3300048088 | Bacteria | 4065 |
| 241 | Ga0496101_0556140 | 3300048904 | Bacteria | 907 |
| 242 | Ga0496105_0409516 | 3300048908 | Bacteria | 1075 |
| 243 | Ga0496109_0164815 | 3300048912 | Bacteria | 2077 |
| 244 | Ga0496110_0133872 | 3300048913 | Bacteria | 2239 |
| 245 | Ga0496111_0020877 | 3300048914 | Bacteria | 4566 |
| 246 | Ga0496111_0170129 | 3300048914 | Bacteria | 1619 |
| 247 | Ga0496112_0141556 | 3300048915 | Bacteria | 2374 |
| 248 | Ga0496113_0237010 | 3300048916 | Bacteria | 1455 |
| 249 | Ga0496115_0082536 | 3300048918 | Bacteria | 2619 |
| 250 | Ga0496115_0306469 | 3300048918 | Bacteria | 1301 |
| 251 | Ga0496121_0022410 | 3300048924 | Bacteria | 6132 |
| 252 | Ga0496126_0110598 | 3300048929 | Bacteria | 2393 |
| 253 | Ga0496126_0228016 | 3300048929 | Bacteria | 1562 |
| 254 | Ga0501047_0004564 | 3300049581 | Bacteria | 13023 |
| 255 | Ga0501070_0059542 | 3300049586 | Bacteria | 3166 |
| 256 | Ga0501074_0211567 | 3300049590 | Bacteria | 1381 |
| 257 | nmdc:mga00v17_175079_c1 | 3300050491 | Bacteria | 1384 |
| 258 | Ga0495601_0010529 | 3300053077 | Bacteria | 5507 |
| 259 | Ga0495601_0018550 | 3300053077 | Bacteria | 4237 |
| 260 | Ga0495612_0049010 | 3300053078 | Bacteria | 1732 |
| 261 | Ga0495612_0067159 | 3300053078 | Bacteria | 1491 |
| 262 | Ga0500635_0013636 | 3300053080 | Bacteria | 2365 |
| 263 | Ga0500635_0017146 | 3300053080 | Bacteria | 2165 |
| 264 | Ga0495595_0028638 | 3300053084 | Bacteria | 2488 |
| 265 | Ga0495619_0000630 | 3300053085 | Bacteria | 23277 |
| 266 | Ga0500572_000169 | 3300053111 | Bacteria | 22870 |
| 267 | Ga0500642_0308803 | 3300053130 | Bacteria | 712 |
| 268 | Ga0500559_0002947 | 3300053136 | Bacteria | 8558 |
| 269 | Ga0500603_002810 | 3300053150 | Bacteria | 3775 |
| 270 | Ga0500603_089440 | 3300053150 | Bacteria | 902 |
| 271 | Ga0500639_016047 | 3300053163 | Bacteria | 3947 |
| 272 | Ga0500636_0082512 | 3300053177 | Bacteria | 1850 |
| 273 | Ga0500637_0016738 | 3300053178 | Bacteria | 3913 |
| 274 | Ga0500637_0028943 | 3300053178 | Bacteria | 3069 |
| 275 | Ga0500596_003401 | 3300053735 | Bacteria | 3030 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025254 | Ga0209148_1003513 | Ga0209148_10035131 | 138 |
| 2 | 3300025272 | Ga0209455_1003858 | Ga0209455_10038583 | 138 |
| 3 | 3300035083 | Ga0373926_0067383 | Ga0373926_0067383_520_1158 | 141 |
| 4 | 3300035111 | Ga0373923_0115731 | Ga0373923_0115731_522_1160 | 141 |
| 5 | 3300035170 | Ga0373943_0070362 | Ga0373943_0070362_1006_1644 | 141 |
| 6 | 3300035171 | Ga0373946_0022624 | Ga0373946_0022624_1627_2265 | 141 |
| 7 | 3300035172 | Ga0373955_0018338 | Ga0373955_0018338_2653_3291 | 141 |
| 8 | 3300035692 | Ga0373935_0072433 | Ga0373935_0072433_761_1399 | 141 |
| 9 | 3300035695 | Ga0373927_0001392 | Ga0373927_0001392_8788_9426 | 141 |
| 10 | 3300035725 | Ga0373947_0002951 | Ga0373947_0002951_8990_9628 | 141 |
| 11 | 3300036401 | Ga0373937_0053010 | Ga0373937_0053010_2504_3142 | 141 |
| 12 | 3300037068 | Ga0373925_0004635 | Ga0373925_0004635_8420_9058 | 141 |
| 13 | 3300046455 | Ga0495603_0001860 | Ga0495603_0001860_6727_7365 | 141 |
| 14 | 3300046459 | Ga0495629_0000333 | Ga0495629_0000333_12682_13320 | 141 |
| 15 | 3300046461 | Ga0495641_0002407 | Ga0495641_0002407_3434_4072 | 141 |
| 16 | 3300046463 | Ga0495653_0381976 | Ga0495653_0381976_88_726 | 141 |
| 17 | 3300046472 | Ga0495580_0001991 | Ga0495580_0001991_14910_15548 | 141 |
| 18 | 3300046473 | Ga0495582_0000581 | Ga0495582_0000581_6828_7466 | 141 |
| 19 | 3300046475 | Ga0495639_0000231 | Ga0495639_0000231_4244_4882 | 141 |
| 20 | 3300046476 | Ga0495662_0016401 | Ga0495662_0016401_1528_2166 | 141 |
| 21 | 3300046477 | Ga0495664_0003595 | Ga0495664_0003595_7508_8146 | 141 |
| 22 | 3300046499 | Ga0495594_0001601 | Ga0495594_0001601_2361_2999 | 141 |
| 23 | 3300046516 | Ga0495628_0010205 | Ga0495628_0010205_834_1472 | 141 |
| 24 | 3300046517 | Ga0495630_0275835 | Ga0495630_0275835_144_782 | 141 |
| 25 | 3300046526 | Ga0495666_0069298 | Ga0495666_0069298_377_1015 | 141 |
| 26 | 3300046529 | Ga0495652_0015210 | Ga0495652_0015210_5737_6375 | 141 |
| 27 | 3300046531 | Ga0495665_0003505 | Ga0495665_0003505_6452_7090 | 141 |
| 28 | 3300046533 | Ga0495640_0023189 | Ga0495640_0023189_2202_2840 | 141 |
| 29 | 3300046535 | Ga0495586_0084073 | Ga0495586_0084073_54_692 | 141 |
| 30 | 3300046536 | Ga0495587_0189937 | Ga0495587_0189937_436_1074 | 141 |
| 31 | 3300046557 | Ga0495622_0062911 | Ga0495622_0062911_366_1004 | 141 |
| 32 | 3300046559 | Ga0495667_0179888 | Ga0495667_0179888_403_1041 | 141 |
| 33 | 3300046642 | Ga0495634_0000633 | Ga0495634_0000633_10057_10695 | 141 |
| 34 | 3300046663 | Ga0495635_0001089 | Ga0495635_0001089_1295_1933 | 141 |
| 35 | 3300046681 | Ga0495647_0001403 | Ga0495647_0001403_5479_6117 | 141 |
| 36 | 3300046683 | Ga0495658_0000725 | Ga0495658_0000725_623_1261 | 141 |
| 37 | 3300047315 | Ga0495581_0004200 | Ga0495581_0004200_6324_6962 | 141 |
| 38 | 3300047319 | Ga0495674_0004552 | Ga0495674_0004552_902_1540 | 141 |
| 39 | 3300047321 | Ga0495676_0133423 | Ga0495676_0133423_520_1158 | 141 |
| 40 | 3300047322 | Ga0495680_0117914 | Ga0495680_0117914_1111_1749 | 141 |
| 41 | 3300047673 | Ga0495593_0000679 | Ga0495593_0000679_6210_6848 | 141 |
| 42 | 3300027512 | Ga0209179_1043938 | Ga0209179_10439381 | 147 |
| 43 | 3300048924 | Ga0496121_0022410 | Ga0496121_0022410_2056_2628 | 147 |
| 44 | 3300048929 | Ga0496126_0228016 | Ga0496126_0228016_458_1030 | 147 |
| 45 | 3300007788 | Ga0099795_10015450 | Ga0099795_100154502 | 148 |
| 46 | 3300031911 | Ga0307412_10462671 | Ga0307412_104626711 | 150 |
| 47 | 3300005530 | Ga0070679_100315221 | Ga0070679_1003152212 | 151 |
| 48 | 3300007788 | Ga0099795_10072691 | Ga0099795_100726912 | 152 |
| 49 | 3300005466 | Ga0070685_10423632 | Ga0070685_104236321 | 154 |
| 50 | 3300046514 | Ga0495618_0233262 | Ga0495618_0233262_55_690 | 154 |
| 51 | 3300013105 | Ga0157369_10969873 | Ga0157369_109698731 | 155 |
| 52 | 3300046524 | Ga0495648_0000621 | Ga0495648_0000621_13878_14459 | 155 |
| 53 | 3300047317 | Ga0495604_0435642 | Ga0495604_0435642_51_671 | 155 |
| 54 | 3300005834 | Ga0068851_10039654 | Ga0068851_100396542 | 158 |
| 55 | 3300009545 | Ga0105237_10153816 | Ga0105237_101538162 | 158 |
| 56 | 3300009551 | Ga0105238_10047323 | Ga0105238_100473235 | 158 |
| 57 | 3300010375 | Ga0105239_10196154 | Ga0105239_101961542 | 158 |
| 58 | 3300013105 | Ga0157369_10589102 | Ga0157369_105891021 | 158 |
| 59 | 3300013296 | Ga0157374_10090216 | Ga0157374_100902162 | 158 |
| 60 | 3300025929 | Ga0207664_10967106 | Ga0207664_109671061 | 158 |
| 61 | 3300025949 | Ga0207667_10055331 | Ga0207667_100553312 | 158 |
| 62 | 3300035086 | Ga0373934_0146194 | Ga0373934_0146194_128_778 | 158 |
| 63 | 3300035724 | Ga0373933_0250641 | Ga0373933_0250641_97_747 | 158 |
| 64 | 3300048918 | Ga0496115_0306469 | Ga0496115_0306469_277_906 | 158 |
| 65 | 3300053150 | Ga0500603_089440 | Ga0500603_089440_162_806 | 158 |
| 66 | 3300053177 | Ga0500636_0082512 | Ga0500636_0082512_617_1261 | 158 |
| 67 | 3300005336 | Ga0070680_100058484 | Ga0070680_1000584843 | 159 |
| 68 | 3300005367 | Ga0070667_100583476 | Ga0070667_1005834761 | 159 |
| 69 | 3300005458 | Ga0070681_10191940 | Ga0070681_101919402 | 159 |
| 70 | 3300005530 | Ga0070679_100124438 | Ga0070679_1001244383 | 159 |
| 71 | 3300005535 | Ga0070684_100025110 | Ga0070684_1000251103 | 159 |
| 72 | 3300005547 | Ga0070693_100184150 | Ga0070693_1001841502 | 159 |
| 73 | 3300005563 | Ga0068855_100084583 | Ga0068855_1000845833 | 159 |
| 74 | 3300005577 | Ga0068857_100111340 | Ga0068857_1001113403 | 159 |
| 75 | 3300005841 | Ga0068863_100318214 | Ga0068863_1003182142 | 159 |
| 76 | 3300009545 | Ga0105237_10233844 | Ga0105237_102338442 | 159 |
| 77 | 3300013105 | Ga0157369_10038736 | Ga0157369_100387364 | 159 |
| 78 | 3300025912 | Ga0207707_10018870 | Ga0207707_100188705 | 159 |
| 79 | 3300025914 | Ga0207671_10075759 | Ga0207671_100757593 | 159 |
| 80 | 3300025920 | Ga0207649_10239875 | Ga0207649_102398752 | 159 |
| 81 | 3300025949 | Ga0207667_10094193 | Ga0207667_100941933 | 159 |
| 82 | 3300025986 | Ga0207658_10507612 | Ga0207658_105076121 | 159 |
| 83 | 3300037418 | Ga0395900_0431320 | Ga0395900_0431320_305_919 | 159 |
| 84 | 3300005535 | Ga0070684_100553491 | Ga0070684_1005534911 | 160 |
| 85 | 3300005548 | Ga0070665_100608784 | Ga0070665_1006087841 | 160 |
| 86 | 3300035111 | Ga0373923_0025251 | Ga0373923_0025251_1656_2306 | 160 |
| 87 | 3300035116 | Ga0373945_0037602 | Ga0373945_0037602_321_971 | 160 |
| 88 | 3300035118 | Ga0373954_0202021 | Ga0373954_0202021_293_943 | 160 |
| 89 | 3300035170 | Ga0373943_0086235 | Ga0373943_0086235_557_1207 | 160 |
| 90 | 3300035171 | Ga0373946_0019830 | Ga0373946_0019830_1701_2351 | 160 |
| 91 | 3300035410 | Ga0373924_0145146 | Ga0373924_0145146_93_743 | 160 |
| 92 | 3300035695 | Ga0373927_0011289 | Ga0373927_0011289_1488_2138 | 160 |
| 93 | 3300035725 | Ga0373947_0006776 | Ga0373947_0006776_3882_4532 | 160 |
| 94 | 3300037068 | Ga0373925_0010628 | Ga0373925_0010628_120_770 | 160 |
| 95 | 3300046454 | Ga0495592_0214181 | Ga0495592_0214181_276_926 | 160 |
| 96 | 3300046472 | Ga0495580_0076747 | Ga0495580_0076747_936_1586 | 160 |
| 97 | 3300046473 | Ga0495582_0077679 | Ga0495582_0077679_425_1075 | 160 |
| 98 | 3300046475 | Ga0495639_0004148 | Ga0495639_0004148_2063_2713 | 160 |
| 99 | 3300046477 | Ga0495664_0047852 | Ga0495664_0047852_476_1126 | 160 |
| 100 | 3300046499 | Ga0495594_0138792 | Ga0495594_0138792_144_794 | 160 |
| 101 | 3300046516 | Ga0495628_0086661 | Ga0495628_0086661_430_1080 | 160 |
| 102 | 3300046517 | Ga0495630_0255621 | Ga0495630_0255621_290_940 | 160 |
| 103 | 3300046529 | Ga0495652_0070356 | Ga0495652_0070356_636_1286 | 160 |
| 104 | 3300046531 | Ga0495665_0040330 | Ga0495665_0040330_866_1516 | 160 |
| 105 | 3300046533 | Ga0495640_0023956 | Ga0495640_0023956_2267_2917 | 160 |
| 106 | 3300046559 | Ga0495667_0108896 | Ga0495667_0108896_1096_1746 | 160 |
| 107 | 3300046642 | Ga0495634_0058715 | Ga0495634_0058715_1847_2497 | 160 |
| 108 | 3300046674 | Ga0495588_0080698 | Ga0495588_0080698_97_747 | 160 |
| 109 | 3300046680 | Ga0495646_0061774 | Ga0495646_0061774_48_698 | 160 |
| 110 | 3300046683 | Ga0495658_0058059 | Ga0495658_0058059_1141_1791 | 160 |
| 111 | 3300046689 | Ga0495613_0264550 | Ga0495613_0264550_41_691 | 160 |
| 112 | 3300046690 | Ga0495624_0052860 | Ga0495624_0052860_771_1421 | 160 |
| 113 | 3300047315 | Ga0495581_0039254 | Ga0495581_0039254_1616_2266 | 160 |
| 114 | 3300047317 | Ga0495604_0246324 | Ga0495604_0246324_137_787 | 160 |
| 115 | 3300047319 | Ga0495674_0166200 | Ga0495674_0166200_1059_1709 | 160 |
| 116 | 3300047321 | Ga0495676_0210916 | Ga0495676_0210916_402_1052 | 160 |
| 117 | 3300047471 | Ga0495684_0004994 | Ga0495684_0004994_407_1057 | 160 |
| 118 | 3300047673 | Ga0495593_0033482 | Ga0495593_0033482_1149_1799 | 160 |
| 119 | 3300053078 | Ga0495612_0049010 | Ga0495612_0049010_240_890 | 160 |
| 120 | 3300032004 | Ga0307414_10407933 | Ga0307414_104079332 | 161 |
| 121 | 3300048908 | Ga0496105_0409516 | Ga0496105_0409516_383_940 | 161 |
| 122 | 3300048912 | Ga0496109_0164815 | Ga0496109_0164815_1022_1579 | 161 |
| 123 | 3300048913 | Ga0496110_0133872 | Ga0496110_0133872_1322_1879 | 161 |
| 124 | 3300048914 | Ga0496111_0020877 | Ga0496111_0020877_2709_3266 | 161 |
| 125 | 3300048915 | Ga0496112_0141556 | Ga0496112_0141556_362_919 | 161 |
| 126 | 3300005455 | Ga0070663_100381809 | Ga0070663_1003818092 | 162 |
| 127 | 3300005458 | Ga0070681_10388327 | Ga0070681_103883272 | 162 |
| 128 | 3300005535 | Ga0070684_101066741 | Ga0070684_1010667411 | 162 |
| 129 | 3300005539 | Ga0068853_100009938 | Ga0068853_1000099386 | 162 |
| 130 | 3300005564 | Ga0070664_100459613 | Ga0070664_1004596132 | 162 |
| 131 | 3300025920 | Ga0207649_10026494 | Ga0207649_100264943 | 162 |
| 132 | 3300025945 | Ga0207679_10269082 | Ga0207679_102690822 | 162 |
| 133 | 3300026067 | Ga0207678_10105721 | Ga0207678_101057213 | 162 |
| 134 | 3300026142 | Ga0207698_10094668 | Ga0207698_100946682 | 162 |
| 135 | 3300045976 | Ga0466967_0061875 | Ga0466967_0061875_1501_2067 | 162 |
| 136 | 3300045049 | Ga0466959_0265885 | Ga0466959_0265885_620_1159 | 163 |
| 137 | 3300039450 | Ga0436363_1011758 | Ga0436363_1011758_43_621 | 164 |
| 138 | 3300045049 | Ga0466959_0105874 | Ga0466959_0105874_166_810 | 164 |
| 139 | 3300013307 | Ga0157372_10653993 | Ga0157372_106539932 | 165 |
| 140 | 3300026078 | Ga0207702_10019322 | Ga0207702_100193222 | 165 |
| 141 | 3300046477 | Ga0495664_0003992 | Ga0495664_0003992_4226_4882 | 165 |
| 142 | 3300046678 | Ga0495599_0051516 | Ga0495599_0051516_1740_2396 | 165 |
| 143 | 3300053077 | Ga0495601_0018550 | Ga0495601_0018550_3405_4061 | 165 |
| 144 | 3300053078 | Ga0495612_0067159 | Ga0495612_0067159_147_803 | 165 |
| 145 | 3300037853 | Ga0436364_0318435 | Ga0436364_0318435_2770_3402 | 166 |
| 146 | 3300039437 | Ga0436365_1746327 | Ga0436365_1746327_17_649 | 166 |
| 147 | 3300025297 | Ga0209758_1025363 | Ga0209758_10253633 | 167 |
| 148 | 3300046689 | Ga0495613_0023674 | Ga0495613_0023674_1644_2279 | 167 |
| 149 | 3300048916 | Ga0496113_0237010 | Ga0496113_0237010_71_694 | 167 |
| 150 | 3300048929 | Ga0496126_0110598 | Ga0496126_0110598_388_1026 | 167 |
| 151 | 3300010159 | Ga0099796_10249534 | Ga0099796_102495341 | 168 |
| 152 | 3300025261 | Ga0209233_1000632 | Ga0209233_100063211 | 168 |
| 153 | 3300044735 | Ga0466968_0104605 | Ga0466968_0104605_83_712 | 168 |
| 154 | 3300053111 | Ga0500572_000169 | Ga0500572_000169_4660_5331 | 168 |
| 155 | 3300053136 | Ga0500559_0002947 | Ga0500559_0002947_1566_2237 | 168 |
| 156 | 3300053163 | Ga0500639_016047 | Ga0500639_016047_2730_3401 | 168 |
| 157 | 3300053735 | Ga0500596_003401 | Ga0500596_003401_528_1199 | 168 |
| 158 | 3300005336 | Ga0070680_100034795 | Ga0070680_1000347953 | 169 |
| 159 | 3300005458 | Ga0070681_10048039 | Ga0070681_100480393 | 169 |
| 160 | 3300005564 | Ga0070664_100629645 | Ga0070664_1006296452 | 169 |
| 161 | 3300005614 | Ga0068856_100012522 | Ga0068856_10001252210 | 169 |
| 162 | 3300005614 | Ga0068856_101327994 | Ga0068856_1013279941 | 169 |
| 163 | 3300006914 | Ga0075436_100298531 | Ga0075436_1002985312 | 169 |
| 164 | 3300013105 | Ga0157369_11163921 | Ga0157369_111639211 | 169 |
| 165 | 3300013307 | Ga0157372_10185235 | Ga0157372_101852352 | 169 |
| 166 | 3300025912 | Ga0207707_10306254 | Ga0207707_103062541 | 169 |
| 167 | 3300025917 | Ga0207660_10117120 | Ga0207660_101171202 | 169 |
| 168 | 3300025939 | Ga0207665_10170931 | Ga0207665_101709312 | 169 |
| 169 | 3300026078 | Ga0207702_10783936 | Ga0207702_107839361 | 169 |
| 170 | 3300048904 | Ga0496101_0556140 | Ga0496101_0556140_146_748 | 169 |
| 171 | 3300005336 | Ga0070680_100509784 | Ga0070680_1005097842 | 170 |
| 172 | 3300005437 | Ga0070710_10559213 | Ga0070710_105592131 | 170 |
| 173 | 3300025921 | Ga0207652_10026205 | Ga0207652_100262053 | 170 |
| 174 | iso_pu_bacteria | 2885383462 | 2885391217 | 170 |
| 175 | 3300005434 | Ga0070709_10118644 | Ga0070709_101186442 | 171 |
| 176 | 3300005436 | Ga0070713_100085258 | Ga0070713_1000852582 | 171 |
| 177 | 3300025906 | Ga0207699_10014962 | Ga0207699_100149622 | 171 |
| 178 | 3300025916 | Ga0207663_10096118 | Ga0207663_100961181 | 171 |
| 179 | 3300048918 | Ga0496115_0082536 | Ga0496115_0082536_720_1352 | 171 |
| 180 | 3300049581 | Ga0501047_0004564 | Ga0501047_0004564_10833_11477 | 171 |
| 181 | 3300049586 | Ga0501070_0059542 | Ga0501070_0059542_2485_3129 | 171 |
| 182 | 3300049590 | Ga0501074_0211567 | Ga0501074_0211567_37_681 | 171 |
| 183 | 3300053080 | Ga0500635_0017146 | Ga0500635_0017146_1296_1913 | 171 |
| 184 | 3300053178 | Ga0500637_0028943 | Ga0500637_0028943_1529_2146 | 171 |
| 185 | iso_pu_bacteria | 2513237098 | 2513673539 | 171 |
| 186 | iso_pu_bacteria | 2903768456 | 2903777230 | 171 |
| 187 | 3300009093 | Ga0105240_10238202 | Ga0105240_102382022 | 172 |
| 188 | 3300020082 | Ga0206353_11560999 | Ga0206353_115609991 | 172 |
| 189 | 3300033180 | Ga0307510_10091320 | Ga0307510_100913202 | 172 |
| 190 | 3300035086 | Ga0373934_0007485 | Ga0373934_0007485_237_869 | 172 |
| 191 | 3300035111 | Ga0373923_0002374 | Ga0373923_0002374_338_970 | 172 |
| 192 | 3300035113 | Ga0373936_0062657 | Ga0373936_0062657_311_943 | 172 |
| 193 | 3300035118 | Ga0373954_0010854 | Ga0373954_0010854_2048_2680 | 172 |
| 194 | 3300035119 | Ga0373956_0006883 | Ga0373956_0006883_638_1270 | 172 |
| 195 | 3300035172 | Ga0373955_0000678 | Ga0373955_0000678_2047_2679 | 172 |
| 196 | 3300035410 | Ga0373924_0006921 | Ga0373924_0006921_2529_3161 | 172 |
| 197 | 3300036401 | Ga0373937_0008389 | Ga0373937_0008389_3512_4144 | 172 |
| 198 | 3300037068 | Ga0373925_0126956 | Ga0373925_0126956_806_1453 | 172 |
| 199 | 3300044684 | Ga0466966_0290263 | Ga0466966_0290263_239_844 | 172 |
| 200 | 3300046455 | Ga0495603_0004304 | Ga0495603_0004304_1755_2387 | 172 |
| 201 | 3300046459 | Ga0495629_0003378 | Ga0495629_0003378_1349_1981 | 172 |
| 202 | 3300046463 | Ga0495653_0000367 | Ga0495653_0000367_2086_2718 | 172 |
| 203 | 3300046511 | Ga0495608_0008277 | Ga0495608_0008277_1158_1790 | 172 |
| 204 | 3300046514 | Ga0495618_0167634 | Ga0495618_0167634_287_919 | 172 |
| 205 | 3300046529 | Ga0495652_0009044 | Ga0495652_0009044_7265_7897 | 172 |
| 206 | 3300046533 | Ga0495640_0003357 | Ga0495640_0003357_1469_2101 | 172 |
| 207 | 3300046536 | Ga0495587_0007028 | Ga0495587_0007028_1166_1798 | 172 |
| 208 | 3300046543 | Ga0495645_0138848 | Ga0495645_0138848_407_1039 | 172 |
| 209 | 3300046559 | Ga0495667_0003583 | Ga0495667_0003583_5510_6142 | 172 |
| 210 | 3300046642 | Ga0495634_0007068 | Ga0495634_0007068_1942_2574 | 172 |
| 211 | 3300046663 | Ga0495635_0003610 | Ga0495635_0003610_5251_5883 | 172 |
| 212 | 3300046675 | Ga0495657_0003520 | Ga0495657_0003520_6625_7257 | 172 |
| 213 | 3300046678 | Ga0495599_0001176 | Ga0495599_0001176_3431_4063 | 172 |
| 214 | 3300046679 | Ga0495623_0008590 | Ga0495623_0008590_4834_5466 | 172 |
| 215 | 3300046680 | Ga0495646_0025940 | Ga0495646_0025940_1514_2146 | 172 |
| 216 | 3300046689 | Ga0495613_0019437 | Ga0495613_0019437_3563_4195 | 172 |
| 217 | 3300047319 | Ga0495674_0020314 | Ga0495674_0020314_5331_5963 | 172 |
| 218 | 3300047322 | Ga0495680_0053389 | Ga0495680_0053389_1166_1798 | 172 |
| 219 | 3300047444 | Ga0495675_0004613 | Ga0495675_0004613_596_1228 | 172 |
| 220 | 3300047471 | Ga0495684_0001903 | Ga0495684_0001903_4834_5466 | 172 |
| 221 | 3300048088 | Ga0495602_0043781 | Ga0495602_0043781_1348_1980 | 172 |
| 222 | 3300053077 | Ga0495601_0010529 | Ga0495601_0010529_220_852 | 172 |
| 223 | 3300053080 | Ga0500635_0013636 | Ga0500635_0013636_1072_1704 | 172 |
| 224 | 3300053084 | Ga0495595_0028638 | Ga0495595_0028638_499_1131 | 172 |
| 225 | 3300053085 | Ga0495619_0000630 | Ga0495619_0000630_11280_11912 | 172 |
| 226 | 3300053150 | Ga0500603_002810 | Ga0500603_002810_1226_1858 | 172 |
| 227 | 3300053178 | Ga0500637_0016738 | Ga0500637_0016738_2422_3054 | 172 |
| 228 | iso_pu_bacteria | 2904690495 | 2904693032 | 172 |
| 229 | iso_pu_bacteria | 2908756301 | 2908757908 | 172 |
| 230 | 3300005339 | Ga0070660_100220545 | Ga0070660_1002205452 | 173 |
| 231 | 3300005366 | Ga0070659_100221237 | Ga0070659_1002212372 | 173 |
| 232 | 3300005436 | Ga0070713_100026661 | Ga0070713_1000266612 | 173 |
| 233 | 3300005616 | Ga0068852_100048293 | Ga0068852_1000482933 | 173 |
| 234 | 3300025928 | Ga0207700_10012174 | Ga0207700_100121746 | 173 |
| 235 | 3300025949 | Ga0207667_10346703 | Ga0207667_103467031 | 173 |
| 236 | 3300035695 | Ga0373927_0002614 | Ga0373927_0002614_10457_11089 | 173 |
| 237 | 3300035725 | Ga0373947_0044912 | Ga0373947_0044912_1026_1658 | 173 |
| 238 | 3300037312 | Ga0395899_0341103 | Ga0395899_0341103_273_866 | 173 |
| 239 | 3300037418 | Ga0395900_0001526 | Ga0395900_0001526_15979_16572 | 173 |
| 240 | 3300037466 | Ga0395898_0062207 | Ga0395898_0062207_2955_3548 | 173 |
| 241 | 3300038443 | Ga0395901_0015205 | Ga0395901_0015205_136_729 | 173 |
| 242 | 3300005435 | Ga0070714_100166833 | Ga0070714_1001668332 | 174 |
| 243 | 3300005436 | Ga0070713_100010153 | Ga0070713_1000101536 | 174 |
| 244 | 3300006028 | Ga0070717_10124033 | Ga0070717_101240332 | 174 |
| 245 | 3300007265 | Ga0099794_10209930 | Ga0099794_102099302 | 174 |
| 246 | 3300025928 | Ga0207700_10030323 | Ga0207700_100303232 | 174 |
| 247 | 3300027671 | Ga0209588_1007959 | Ga0209588_10079592 | 174 |
| 248 | 3300007265 | Ga0099794_10092613 | Ga0099794_100926132 | 175 |
| 249 | 3300009093 | Ga0105240_10069319 | Ga0105240_100693192 | 175 |
| 250 | 3300046507 | Ga0495606_0005525 | Ga0495606_0005525_5643_6269 | 175 |
| 251 | 3300031247 | Ga0265340_10032597 | Ga0265340_100325973 | 176 |
| 252 | 3300031249 | Ga0265339_10025233 | Ga0265339_100252331 | 176 |
| 253 | iso_pu_bacteria | 2508501128 | 2509146582 | 176 |
| 254 | 3300037853 | Ga0436364_1424390 | Ga0436364_1424390_88_726 | 177 |
| 255 | 3300005563 | Ga0068855_100863738 | Ga0068855_1008637381 | 178 |
| 256 | 3300009093 | Ga0105240_10073756 | Ga0105240_100737563 | 178 |
| 257 | 3300013104 | Ga0157370_10040561 | Ga0157370_100405613 | 178 |
| 258 | 3300013105 | Ga0157369_10009599 | Ga0157369_100095996 | 178 |
| 259 | 3300013307 | Ga0157372_10214867 | Ga0157372_102148672 | 178 |
| 260 | 3300025913 | Ga0207695_10042621 | Ga0207695_100426213 | 178 |
| 261 | 3300037312 | Ga0395899_0071740 | Ga0395899_0071740_331_984 | 178 |
| 262 | 3300037418 | Ga0395900_0009206 | Ga0395900_0009206_7041_7694 | 178 |
| 263 | 3300037466 | Ga0395898_0005460 | Ga0395898_0005460_10952_11605 | 178 |
| 264 | 3300038443 | Ga0395901_0232328 | Ga0395901_0232328_112_765 | 178 |
| 265 | 3300005434 | Ga0070709_10318426 | Ga0070709_103184261 | 179 |
| 266 | 3300005437 | Ga0070710_10087335 | Ga0070710_100873352 | 179 |
| 267 | 3300006177 | Ga0075362_10223486 | Ga0075362_102234861 | 179 |
| 268 | 3300025906 | Ga0207699_10372160 | Ga0207699_103721602 | 179 |
| 269 | 3300036459 | Ga0372808_022896 | Ga0372808_022896_43_666 | 179 |
| 270 | 3300044842 | Ga0466957_0407354 | Ga0466957_0407354_16_654 | 179 |
| 271 | iso_pu_bacteria | 2513237102 | 2513699483 | 179 |
| 272 | iso_pu_bacteria | 2824679649 | 2824684328 | 180 |
| 273 | iso_pu_bacteria | 2922393267 | 2922396480 | 180 |
| 274 | iso_pu_bacteria | 2935959822 | 2935965662 | 180 |
| 275 | iso_pu_bacteria | 3005718088 | 3005724171 | 180 |
| 276 | 3300048914 | Ga0496111_0170129 | Ga0496111_0170129_137_778 | 182 |
| 277 | 3300009177 | Ga0105248_10342284 | Ga0105248_103422842 | 183 |
| 278 | 3300009545 | Ga0105237_10672955 | Ga0105237_106729552 | 183 |
| 279 | 3300046507 | Ga0495606_0259577 | Ga0495606_0259577_320_934 | 183 |
| 280 | 3300046524 | Ga0495648_0252615 | Ga0495648_0252615_220_834 | 183 |
| 281 | 3300053130 | Ga0500642_0308803 | Ga0500642_0308803_56_670 | 183 |
| 282 | 3300003354 | JGI25160J50197_1002032 | JGI25160J50197_10020329 | 184 |
| 283 | 3300006051 | Ga0075364_10066914 | Ga0075364_100669141 | 184 |
| 284 | 3300010375 | Ga0105239_10763838 | Ga0105239_107638381 | 184 |
| 285 | 3300025302 | Ga0207426_1002035 | Ga0207426_10020356 | 184 |
| 286 | 3300050491 | nmdc:mga00v17_175079_c1 | nmdc:mga00v17_175079_c1_603_1220 | 184 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i7n-assembly1.cif.gz_A-2 | maoc-like dehydratase | 0.829 | 74 | 111 |
| 6dsp-assembly2.cif.gz_B | lsrb from clostridium saccharobutylicum in complex with ai-2 | 0.8234 | 31 | 66 |
| 5dkv-assembly4.cif.gz_D | crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d-tagatopyranose | 0.8215 | 30 | 65 |
| 5xsd-assembly1.cif.gz_A | xylfii-lytsn complex mutant - d103a | 0.8208 | 30 | 65 |
| 8abp-assembly1.cif.gz_A | sugar-binding and crystallographic studies of an arabinose-binding protein mutant (met108leu) which exhibits enhanced affinity and altered specificity | 0.8121 | 30 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dspB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8234 | 31 | 66 | 3.40.50.2300 |
| af_A0A1D6F9G8_47_167_2.60.40.770 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.811 | 86 | 111 | 2.60.40.770 |
| 4oqeB02 | Mainly Beta;Single Sheet;S-adenosyl-L-methionine-dependent methyltransferases;CAC2371-like domains | 0.8068 | 71 | 111 | 2.20.130.10 |
| 4kzkA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8004 | 31 | 65 | 3.40.50.2300 |
| 1sxgB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7994 | 30 | 65 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q1YDC8-F1-model_v4 | Putative sugar ABC transporter, ATP-binding protein | 0.9277 | 31 | 143 |
GO:0005524
GO:0016887 |
| AF-A0A529XMX7-F1-model_v4 | deleted | 0.9121 | 28 | 145 |
|
| AF-A0A5D0VIW9-F1-model_v4 | Lipoprotein | 0.9095 | 28 | 146 |
|
| AF-A0A529KTV1-F1-model_v4 | Uncharacterized protein | 0.9067 | 56 | 136 |
|
| AF-A0A2N6B5L0-F1-model_v4 | Uncharacterized protein | 0.8885 | 24 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar