F387257

General Info

Members Datasets Scaffolds Average Seq Length
286 184 275 184

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10318426|Ga0070709_103184261
Length 216
Sequence MRDASNTSARPHRTLLRAGIVVLCLAAASALGGCAASGPATNASAFAMATEAAGPTITFESIDGPPPQVFDRMVSVLDSETKLRSLAIVSRDAPAAYRVRSYLSAQVVHGRTVIAWVWDVYDRDQNRALRLTGEEPAGKGGRDATRDPWAAADDLVLRKIAQAGLSGLSGMVNGGPADAPQPAPVPGGKRGPAVANNDLPDGAGGSNTAALGYTDH

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
4 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
5 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
6 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
7 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
8 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
9 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
10 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
11 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
178 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
179 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
180 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
181 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
182 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
183 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
184 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0.7
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.34
Nodule 2.8
Rhizoplane 3.5
Rhizosphere 82.17
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1002032 3300003354 Bacteria 9646
2 Ga0070680_100034795 3300005336 Bacteria 4063
3 Ga0070680_100058484 3300005336 Bacteria 3152
4 Ga0070680_100509784 3300005336 Bacteria 1030
5 Ga0070660_100220545 3300005339 Bacteria 1541
6 Ga0070659_100221237 3300005366 Bacteria 1563
7 Ga0070667_100583476 3300005367 Bacteria 1029
8 Ga0070709_10118644 3300005434 Bacteria 1789
9 Ga0070709_10318426 3300005434 Bacteria 1141
10 Ga0070714_100166833 3300005435 Bacteria 1996
11 Ga0070713_100010153 3300005436 Bacteria 6791
12 Ga0070713_100026661 3300005436 Bacteria 4540
13 Ga0070713_100085258 3300005436 Bacteria 2705
14 Ga0070710_10087335 3300005437 Bacteria 1833
15 Ga0070710_10559213 3300005437 Bacteria 791
16 Ga0070663_100381809 3300005455 Bacteria 1148
17 Ga0070681_10048039 3300005458 Bacteria 4265
18 Ga0070681_10191940 3300005458 Bacteria 1962
19 Ga0070681_10388327 3300005458 Bacteria 1307
20 Ga0070685_10423632 3300005466 Bacteria 927
21 Ga0070679_100124438 3300005530 Bacteria 2561
22 Ga0070679_100315221 3300005530 Bacteria 1514
23 Ga0070684_100025110 3300005535 Bacteria 5004
24 Ga0070684_100553491 3300005535 Bacteria 1068
25 Ga0070684_101066741 3300005535 Bacteria 759
26 Ga0068853_100009938 3300005539 Bacteria 7683
27 Ga0070693_100184150 3300005547 Bacteria 1346
28 Ga0070665_100608784 3300005548 Bacteria 1105
29 Ga0068855_100084583 3300005563 Bacteria 3672
30 Ga0068855_100863738 3300005563 Bacteria 958
31 Ga0070664_100459613 3300005564 Bacteria 1169
32 Ga0070664_100629645 3300005564 Bacteria 996
33 Ga0068857_100111340 3300005577 Bacteria 2461
34 Ga0068856_100012522 3300005614 Bacteria 8211
35 Ga0068856_101327994 3300005614 Bacteria 734
36 Ga0068852_100048293 3300005616 Bacteria 3636
37 Ga0068851_10039654 3300005834 Bacteria 2366
38 Ga0068863_100318214 3300005841 Bacteria 1511
39 Ga0070717_10124033 3300006028 Bacteria 2216
40 Ga0075364_10066914 3300006051 Bacteria 2361
41 Ga0075362_10223486 3300006177 Bacteria 921
42 Ga0075436_100298531 3300006914 Bacteria 1154
43 Ga0099794_10092613 3300007265 Bacteria 1501
44 Ga0099794_10209930 3300007265 Bacteria 998
45 Ga0099795_10015450 3300007788 Bacteria 2392
46 Ga0099795_10072691 3300007788 Bacteria 1301
47 Ga0105240_10069319 3300009093 Bacteria 4365
48 Ga0105240_10073756 3300009093 Bacteria 4214
49 Ga0105240_10238202 3300009093 Bacteria 2111
50 Ga0105248_10342284 3300009177 Bacteria 1684
51 Ga0105237_10153816 3300009545 Bacteria 2296
52 Ga0105237_10233844 3300009545 Bacteria 1839
53 Ga0105237_10672955 3300009545 Bacteria 1042
54 Ga0105238_10047323 3300009551 Bacteria 4338
55 Ga0099796_10249534 3300010159 Bacteria 736
56 Ga0105239_10196154 3300010375 Bacteria 2261
57 Ga0105239_10763838 3300010375 Bacteria 1107
58 Ga0157370_10040561 3300013104 Bacteria 4495
59 Ga0157369_10009599 3300013105 Bacteria 11066
60 Ga0157369_10038736 3300013105 Bacteria 5212
61 Ga0157369_10589102 3300013105 Bacteria 1148
62 Ga0157369_10969873 3300013105 Bacteria 871
63 Ga0157369_11163921 3300013105 Bacteria 787
64 Ga0157374_10090216 3300013296 Bacteria 2922
65 Ga0157372_10185235 3300013307 Bacteria 2411
66 Ga0157372_10214867 3300013307 Bacteria 2229
67 Ga0157372_10653993 3300013307 Bacteria 1224
68 Ga0206353_11560999 3300020082 Bacteria 857
69 Ga0209148_1003513 3300025254 Bacteria 4285
70 Ga0209233_1000632 3300025261 Bacteria 17550
71 Ga0209455_1003858 3300025272 Bacteria 5122
72 Ga0209758_1025363 3300025297 Bacteria 2604
73 Ga0207426_1002035 3300025302 Bacteria 14130
74 Ga0207699_10014962 3300025906 Bacteria 4018
75 Ga0207699_10372160 3300025906 Bacteria 1012
76 Ga0207707_10018870 3300025912 Bacteria 6015
77 Ga0207707_10306254 3300025912 Bacteria 1373
78 Ga0207695_10042621 3300025913 Bacteria 4844
79 Ga0207671_10075759 3300025914 Bacteria 2517
80 Ga0207663_10096118 3300025916 Bacteria 1978
81 Ga0207660_10117120 3300025917 Bacteria 2013
82 Ga0207649_10026494 3300025920 Bacteria 3392
83 Ga0207649_10239875 3300025920 Bacteria 1301
84 Ga0207652_10026205 3300025921 Bacteria 4854
85 Ga0207700_10012174 3300025928 Bacteria 5533
86 Ga0207700_10030323 3300025928 Bacteria 3828
87 Ga0207664_10967106 3300025929 Bacteria 763
88 Ga0207665_10170931 3300025939 Bacteria 1570
89 Ga0207679_10269082 3300025945 Bacteria 1457
90 Ga0207667_10055331 3300025949 Bacteria 4171
91 Ga0207667_10094193 3300025949 Bacteria 3092
92 Ga0207667_10346703 3300025949 Bacteria 1515
93 Ga0207658_10507612 3300025986 Bacteria 1075
94 Ga0207678_10105721 3300026067 Bacteria 2401
95 Ga0207702_10019322 3300026078 Bacteria 5638
96 Ga0207702_10783936 3300026078 Bacteria 942
97 Ga0207698_10094668 3300026142 Bacteria 2456
98 Ga0209179_1043938 3300027512 Bacteria 946
99 Ga0209588_1007959 3300027671 Bacteria 3134
100 Ga0265340_10032597 3300031247 Bacteria 2600
101 Ga0265339_10025233 3300031249 Bacteria 3413
102 Ga0307412_10462671 3300031911 Bacteria 1048
103 Ga0307414_10407933 3300032004 Bacteria 1182
104 Ga0307510_10091320 3300033180 Bacteria 2888
105 Ga0373926_0067383 3300035083 Bacteria 1311
106 Ga0373934_0007485 3300035086 Bacteria 4054
107 Ga0373934_0146194 3300035086 Bacteria 967
108 Ga0373923_0002374 3300035111 Bacteria 5779
109 Ga0373923_0025251 3300035111 Bacteria 2353
110 Ga0373923_0115731 3300035111 Bacteria 1194
111 Ga0373936_0062657 3300035113 Bacteria 1521
112 Ga0373945_0037602 3300035116 Bacteria 1738
113 Ga0373954_0010854 3300035118 Bacteria 4027
114 Ga0373954_0202021 3300035118 Bacteria 977
115 Ga0373956_0006883 3300035119 Bacteria 4567
116 Ga0373943_0070362 3300035170 Bacteria 1770
117 Ga0373943_0086235 3300035170 Bacteria 1618
118 Ga0373946_0019830 3300035171 Bacteria 2594
119 Ga0373946_0022624 3300035171 Bacteria 2448
120 Ga0373955_0000678 3300035172 Bacteria 14552
121 Ga0373955_0018338 3300035172 Bacteria 3479
122 Ga0373924_0006921 3300035410 Bacteria 4080
123 Ga0373924_0145146 3300035410 Bacteria 1036
124 Ga0373935_0072433 3300035692 Bacteria 2224
125 Ga0373927_0001392 3300035695 Bacteria 18221
126 Ga0373927_0002614 3300035695 Bacteria 13125
127 Ga0373927_0011289 3300035695 Bacteria 5945
128 Ga0373933_0250641 3300035724 Bacteria 1140
129 Ga0373947_0002951 3300035725 Bacteria 10153
130 Ga0373947_0006776 3300035725 Bacteria 6644
131 Ga0373947_0044912 3300035725 Bacteria 2643
132 Ga0373937_0008389 3300036401 Bacteria 8977
133 Ga0373937_0053010 3300036401 Bacteria 3720
134 Ga0372808_022896 3300036459 Bacteria 897
135 Ga0373925_0004635 3300037068 Bacteria 10377
136 Ga0373925_0010628 3300037068 Bacteria 6675
137 Ga0373925_0126956 3300037068 Bacteria 1985
138 Ga0395899_0071740 3300037312 Bacteria 2535
139 Ga0395899_0341103 3300037312 Bacteria 1004
140 Ga0395900_0001526 3300037418 Bacteria 27536
141 Ga0395900_0009206 3300037418 Bacteria 10122
142 Ga0395900_0431320 3300037418 Bacteria 1277
143 Ga0395898_0005460 3300037466 Bacteria 13735
144 Ga0395898_0062207 3300037466 Bacteria 3625
145 Ga0436364_0318435 3300037853 Bacteria 5212
146 Ga0436364_1424390 3300037853 Bacteria 759
147 Ga0395901_0015205 3300038443 Bacteria 7830
148 Ga0395901_0232328 3300038443 Bacteria 1925
149 Ga0436365_1746327 3300039437 Bacteria 768
150 Ga0436363_1011758 3300039450 Bacteria 905
151 Ga0466966_0290263 3300044684 Bacteria 983
152 Ga0466968_0104605 3300044735 Bacteria 1267
153 Ga0466957_0407354 3300044842 Bacteria 931
154 Ga0466959_0105874 3300045049 Bacteria 2011
155 Ga0466959_0265885 3300045049 Bacteria 1180
156 Ga0466967_0061875 3300045976 Bacteria 3322
157 Ga0495592_0214181 3300046454 Bacteria 1292
158 Ga0495603_0001860 3300046455 Bacteria 12433
159 Ga0495603_0004304 3300046455 Bacteria 8487
160 Ga0495629_0000333 3300046459 Bacteria 40364
161 Ga0495629_0003378 3300046459 Bacteria 12064
162 Ga0495641_0002407 3300046461 Bacteria 14806
163 Ga0495653_0000367 3300046463 Bacteria 36475
164 Ga0495653_0381976 3300046463 Bacteria 899
165 Ga0495580_0001991 3300046472 Bacteria 17967
166 Ga0495580_0076747 3300046472 Bacteria 2330
167 Ga0495582_0000581 3300046473 Bacteria 20224
168 Ga0495582_0077679 3300046473 Bacteria 1841
169 Ga0495639_0000231 3300046475 Bacteria 27804
170 Ga0495639_0004148 3300046475 Bacteria 6211
171 Ga0495662_0016401 3300046476 Bacteria 3588
172 Ga0495664_0003595 3300046477 Bacteria 8454
173 Ga0495664_0003992 3300046477 Bacteria 8062
174 Ga0495664_0047852 3300046477 Bacteria 2538
175 Ga0495594_0001601 3300046499 Bacteria 11777
176 Ga0495594_0138792 3300046499 Bacteria 1378
177 Ga0495606_0005525 3300046507 Bacteria 12066
178 Ga0495606_0259577 3300046507 Bacteria 960
179 Ga0495608_0008277 3300046511 Bacteria 7299
180 Ga0495618_0167634 3300046514 Bacteria 1398
181 Ga0495618_0233262 3300046514 Bacteria 1158
182 Ga0495628_0010205 3300046516 Bacteria 7991
183 Ga0495628_0086661 3300046516 Bacteria 2428
184 Ga0495630_0255621 3300046517 Bacteria 1338
185 Ga0495630_0275835 3300046517 Bacteria 1284
186 Ga0495648_0000621 3300046524 Bacteria 37988
187 Ga0495648_0252615 3300046524 Bacteria 850
188 Ga0495666_0069298 3300046526 Bacteria 1678
189 Ga0495652_0009044 3300046529 Bacteria 9062
190 Ga0495652_0015210 3300046529 Bacteria 6890
191 Ga0495652_0070356 3300046529 Bacteria 2925
192 Ga0495665_0003505 3300046531 Bacteria 8515
193 Ga0495665_0040330 3300046531 Bacteria 2486
194 Ga0495640_0003357 3300046533 Bacteria 12887
195 Ga0495640_0023189 3300046533 Bacteria 4529
196 Ga0495640_0023956 3300046533 Bacteria 4441
197 Ga0495586_0084073 3300046535 Bacteria 1752
198 Ga0495587_0007028 3300046536 Bacteria 7307
199 Ga0495587_0189937 3300046536 Bacteria 1163
200 Ga0495645_0138848 3300046543 Bacteria 1697
201 Ga0495622_0062911 3300046557 Bacteria 1717
202 Ga0495667_0003583 3300046559 Bacteria 10445
203 Ga0495667_0108896 3300046559 Bacteria 1790
204 Ga0495667_0179888 3300046559 Bacteria 1357
205 Ga0495634_0000633 3300046642 Bacteria 34239
206 Ga0495634_0007068 3300046642 Bacteria 8470
207 Ga0495634_0058715 3300046642 Bacteria 2563
208 Ga0495635_0001089 3300046663 Bacteria 18033
209 Ga0495635_0003610 3300046663 Bacteria 10716
210 Ga0495588_0080698 3300046674 Bacteria 1698
211 Ga0495657_0003520 3300046675 Bacteria 12766
212 Ga0495599_0001176 3300046678 Bacteria 14830
213 Ga0495599_0051516 3300046678 Bacteria 2579
214 Ga0495623_0008590 3300046679 Bacteria 6631
215 Ga0495646_0025940 3300046680 Bacteria 3681
216 Ga0495646_0061774 3300046680 Bacteria 2230
217 Ga0495647_0001403 3300046681 Bacteria 7428
218 Ga0495658_0000725 3300046683 Bacteria 17802
219 Ga0495658_0058059 3300046683 Bacteria 2212
220 Ga0495613_0019437 3300046689 Bacteria 5062
221 Ga0495613_0023674 3300046689 Bacteria 4577
222 Ga0495613_0264550 3300046689 Bacteria 1197
223 Ga0495624_0052860 3300046690 Bacteria 2566
224 Ga0495581_0004200 3300047315 Bacteria 8302
225 Ga0495581_0039254 3300047315 Bacteria 2741
226 Ga0495604_0246324 3300047317 Bacteria 1220
227 Ga0495604_0435642 3300047317 Bacteria 858
228 Ga0495674_0004552 3300047319 Bacteria 13338
229 Ga0495674_0020314 3300047319 Bacteria 6152
230 Ga0495674_0166200 3300047319 Bacteria 1843
231 Ga0495676_0133423 3300047321 Bacteria 1789
232 Ga0495676_0210916 3300047321 Bacteria 1344
233 Ga0495680_0053389 3300047322 Bacteria 3145
234 Ga0495680_0117914 3300047322 Bacteria 1962
235 Ga0495675_0004613 3300047444 Bacteria 8364
236 Ga0495684_0001903 3300047471 Bacteria 16747
237 Ga0495684_0004994 3300047471 Bacteria 10354
238 Ga0495593_0000679 3300047673 Bacteria 19632
239 Ga0495593_0033482 3300047673 Bacteria 2798
240 Ga0495602_0043781 3300048088 Bacteria 4065
241 Ga0496101_0556140 3300048904 Bacteria 907
242 Ga0496105_0409516 3300048908 Bacteria 1075
243 Ga0496109_0164815 3300048912 Bacteria 2077
244 Ga0496110_0133872 3300048913 Bacteria 2239
245 Ga0496111_0020877 3300048914 Bacteria 4566
246 Ga0496111_0170129 3300048914 Bacteria 1619
247 Ga0496112_0141556 3300048915 Bacteria 2374
248 Ga0496113_0237010 3300048916 Bacteria 1455
249 Ga0496115_0082536 3300048918 Bacteria 2619
250 Ga0496115_0306469 3300048918 Bacteria 1301
251 Ga0496121_0022410 3300048924 Bacteria 6132
252 Ga0496126_0110598 3300048929 Bacteria 2393
253 Ga0496126_0228016 3300048929 Bacteria 1562
254 Ga0501047_0004564 3300049581 Bacteria 13023
255 Ga0501070_0059542 3300049586 Bacteria 3166
256 Ga0501074_0211567 3300049590 Bacteria 1381
257 nmdc:mga00v17_175079_c1 3300050491 Bacteria 1384
258 Ga0495601_0010529 3300053077 Bacteria 5507
259 Ga0495601_0018550 3300053077 Bacteria 4237
260 Ga0495612_0049010 3300053078 Bacteria 1732
261 Ga0495612_0067159 3300053078 Bacteria 1491
262 Ga0500635_0013636 3300053080 Bacteria 2365
263 Ga0500635_0017146 3300053080 Bacteria 2165
264 Ga0495595_0028638 3300053084 Bacteria 2488
265 Ga0495619_0000630 3300053085 Bacteria 23277
266 Ga0500572_000169 3300053111 Bacteria 22870
267 Ga0500642_0308803 3300053130 Bacteria 712
268 Ga0500559_0002947 3300053136 Bacteria 8558
269 Ga0500603_002810 3300053150 Bacteria 3775
270 Ga0500603_089440 3300053150 Bacteria 902
271 Ga0500639_016047 3300053163 Bacteria 3947
272 Ga0500636_0082512 3300053177 Bacteria 1850
273 Ga0500637_0016738 3300053178 Bacteria 3913
274 Ga0500637_0028943 3300053178 Bacteria 3069
275 Ga0500596_003401 3300053735 Bacteria 3030

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025254 Ga0209148_1003513 Ga0209148_10035131 138
2 3300025272 Ga0209455_1003858 Ga0209455_10038583 138
3 3300035083 Ga0373926_0067383 Ga0373926_0067383_520_1158 141
4 3300035111 Ga0373923_0115731 Ga0373923_0115731_522_1160 141
5 3300035170 Ga0373943_0070362 Ga0373943_0070362_1006_1644 141
6 3300035171 Ga0373946_0022624 Ga0373946_0022624_1627_2265 141
7 3300035172 Ga0373955_0018338 Ga0373955_0018338_2653_3291 141
8 3300035692 Ga0373935_0072433 Ga0373935_0072433_761_1399 141
9 3300035695 Ga0373927_0001392 Ga0373927_0001392_8788_9426 141
10 3300035725 Ga0373947_0002951 Ga0373947_0002951_8990_9628 141
11 3300036401 Ga0373937_0053010 Ga0373937_0053010_2504_3142 141
12 3300037068 Ga0373925_0004635 Ga0373925_0004635_8420_9058 141
13 3300046455 Ga0495603_0001860 Ga0495603_0001860_6727_7365 141
14 3300046459 Ga0495629_0000333 Ga0495629_0000333_12682_13320 141
15 3300046461 Ga0495641_0002407 Ga0495641_0002407_3434_4072 141
16 3300046463 Ga0495653_0381976 Ga0495653_0381976_88_726 141
17 3300046472 Ga0495580_0001991 Ga0495580_0001991_14910_15548 141
18 3300046473 Ga0495582_0000581 Ga0495582_0000581_6828_7466 141
19 3300046475 Ga0495639_0000231 Ga0495639_0000231_4244_4882 141
20 3300046476 Ga0495662_0016401 Ga0495662_0016401_1528_2166 141
21 3300046477 Ga0495664_0003595 Ga0495664_0003595_7508_8146 141
22 3300046499 Ga0495594_0001601 Ga0495594_0001601_2361_2999 141
23 3300046516 Ga0495628_0010205 Ga0495628_0010205_834_1472 141
24 3300046517 Ga0495630_0275835 Ga0495630_0275835_144_782 141
25 3300046526 Ga0495666_0069298 Ga0495666_0069298_377_1015 141
26 3300046529 Ga0495652_0015210 Ga0495652_0015210_5737_6375 141
27 3300046531 Ga0495665_0003505 Ga0495665_0003505_6452_7090 141
28 3300046533 Ga0495640_0023189 Ga0495640_0023189_2202_2840 141
29 3300046535 Ga0495586_0084073 Ga0495586_0084073_54_692 141
30 3300046536 Ga0495587_0189937 Ga0495587_0189937_436_1074 141
31 3300046557 Ga0495622_0062911 Ga0495622_0062911_366_1004 141
32 3300046559 Ga0495667_0179888 Ga0495667_0179888_403_1041 141
33 3300046642 Ga0495634_0000633 Ga0495634_0000633_10057_10695 141
34 3300046663 Ga0495635_0001089 Ga0495635_0001089_1295_1933 141
35 3300046681 Ga0495647_0001403 Ga0495647_0001403_5479_6117 141
36 3300046683 Ga0495658_0000725 Ga0495658_0000725_623_1261 141
37 3300047315 Ga0495581_0004200 Ga0495581_0004200_6324_6962 141
38 3300047319 Ga0495674_0004552 Ga0495674_0004552_902_1540 141
39 3300047321 Ga0495676_0133423 Ga0495676_0133423_520_1158 141
40 3300047322 Ga0495680_0117914 Ga0495680_0117914_1111_1749 141
41 3300047673 Ga0495593_0000679 Ga0495593_0000679_6210_6848 141
42 3300027512 Ga0209179_1043938 Ga0209179_10439381 147
43 3300048924 Ga0496121_0022410 Ga0496121_0022410_2056_2628 147
44 3300048929 Ga0496126_0228016 Ga0496126_0228016_458_1030 147
45 3300007788 Ga0099795_10015450 Ga0099795_100154502 148
46 3300031911 Ga0307412_10462671 Ga0307412_104626711 150
47 3300005530 Ga0070679_100315221 Ga0070679_1003152212 151
48 3300007788 Ga0099795_10072691 Ga0099795_100726912 152
49 3300005466 Ga0070685_10423632 Ga0070685_104236321 154
50 3300046514 Ga0495618_0233262 Ga0495618_0233262_55_690 154
51 3300013105 Ga0157369_10969873 Ga0157369_109698731 155
52 3300046524 Ga0495648_0000621 Ga0495648_0000621_13878_14459 155
53 3300047317 Ga0495604_0435642 Ga0495604_0435642_51_671 155
54 3300005834 Ga0068851_10039654 Ga0068851_100396542 158
55 3300009545 Ga0105237_10153816 Ga0105237_101538162 158
56 3300009551 Ga0105238_10047323 Ga0105238_100473235 158
57 3300010375 Ga0105239_10196154 Ga0105239_101961542 158
58 3300013105 Ga0157369_10589102 Ga0157369_105891021 158
59 3300013296 Ga0157374_10090216 Ga0157374_100902162 158
60 3300025929 Ga0207664_10967106 Ga0207664_109671061 158
61 3300025949 Ga0207667_10055331 Ga0207667_100553312 158
62 3300035086 Ga0373934_0146194 Ga0373934_0146194_128_778 158
63 3300035724 Ga0373933_0250641 Ga0373933_0250641_97_747 158
64 3300048918 Ga0496115_0306469 Ga0496115_0306469_277_906 158
65 3300053150 Ga0500603_089440 Ga0500603_089440_162_806 158
66 3300053177 Ga0500636_0082512 Ga0500636_0082512_617_1261 158
67 3300005336 Ga0070680_100058484 Ga0070680_1000584843 159
68 3300005367 Ga0070667_100583476 Ga0070667_1005834761 159
69 3300005458 Ga0070681_10191940 Ga0070681_101919402 159
70 3300005530 Ga0070679_100124438 Ga0070679_1001244383 159
71 3300005535 Ga0070684_100025110 Ga0070684_1000251103 159
72 3300005547 Ga0070693_100184150 Ga0070693_1001841502 159
73 3300005563 Ga0068855_100084583 Ga0068855_1000845833 159
74 3300005577 Ga0068857_100111340 Ga0068857_1001113403 159
75 3300005841 Ga0068863_100318214 Ga0068863_1003182142 159
76 3300009545 Ga0105237_10233844 Ga0105237_102338442 159
77 3300013105 Ga0157369_10038736 Ga0157369_100387364 159
78 3300025912 Ga0207707_10018870 Ga0207707_100188705 159
79 3300025914 Ga0207671_10075759 Ga0207671_100757593 159
80 3300025920 Ga0207649_10239875 Ga0207649_102398752 159
81 3300025949 Ga0207667_10094193 Ga0207667_100941933 159
82 3300025986 Ga0207658_10507612 Ga0207658_105076121 159
83 3300037418 Ga0395900_0431320 Ga0395900_0431320_305_919 159
84 3300005535 Ga0070684_100553491 Ga0070684_1005534911 160
85 3300005548 Ga0070665_100608784 Ga0070665_1006087841 160
86 3300035111 Ga0373923_0025251 Ga0373923_0025251_1656_2306 160
87 3300035116 Ga0373945_0037602 Ga0373945_0037602_321_971 160
88 3300035118 Ga0373954_0202021 Ga0373954_0202021_293_943 160
89 3300035170 Ga0373943_0086235 Ga0373943_0086235_557_1207 160
90 3300035171 Ga0373946_0019830 Ga0373946_0019830_1701_2351 160
91 3300035410 Ga0373924_0145146 Ga0373924_0145146_93_743 160
92 3300035695 Ga0373927_0011289 Ga0373927_0011289_1488_2138 160
93 3300035725 Ga0373947_0006776 Ga0373947_0006776_3882_4532 160
94 3300037068 Ga0373925_0010628 Ga0373925_0010628_120_770 160
95 3300046454 Ga0495592_0214181 Ga0495592_0214181_276_926 160
96 3300046472 Ga0495580_0076747 Ga0495580_0076747_936_1586 160
97 3300046473 Ga0495582_0077679 Ga0495582_0077679_425_1075 160
98 3300046475 Ga0495639_0004148 Ga0495639_0004148_2063_2713 160
99 3300046477 Ga0495664_0047852 Ga0495664_0047852_476_1126 160
100 3300046499 Ga0495594_0138792 Ga0495594_0138792_144_794 160
101 3300046516 Ga0495628_0086661 Ga0495628_0086661_430_1080 160
102 3300046517 Ga0495630_0255621 Ga0495630_0255621_290_940 160
103 3300046529 Ga0495652_0070356 Ga0495652_0070356_636_1286 160
104 3300046531 Ga0495665_0040330 Ga0495665_0040330_866_1516 160
105 3300046533 Ga0495640_0023956 Ga0495640_0023956_2267_2917 160
106 3300046559 Ga0495667_0108896 Ga0495667_0108896_1096_1746 160
107 3300046642 Ga0495634_0058715 Ga0495634_0058715_1847_2497 160
108 3300046674 Ga0495588_0080698 Ga0495588_0080698_97_747 160
109 3300046680 Ga0495646_0061774 Ga0495646_0061774_48_698 160
110 3300046683 Ga0495658_0058059 Ga0495658_0058059_1141_1791 160
111 3300046689 Ga0495613_0264550 Ga0495613_0264550_41_691 160
112 3300046690 Ga0495624_0052860 Ga0495624_0052860_771_1421 160
113 3300047315 Ga0495581_0039254 Ga0495581_0039254_1616_2266 160
114 3300047317 Ga0495604_0246324 Ga0495604_0246324_137_787 160
115 3300047319 Ga0495674_0166200 Ga0495674_0166200_1059_1709 160
116 3300047321 Ga0495676_0210916 Ga0495676_0210916_402_1052 160
117 3300047471 Ga0495684_0004994 Ga0495684_0004994_407_1057 160
118 3300047673 Ga0495593_0033482 Ga0495593_0033482_1149_1799 160
119 3300053078 Ga0495612_0049010 Ga0495612_0049010_240_890 160
120 3300032004 Ga0307414_10407933 Ga0307414_104079332 161
121 3300048908 Ga0496105_0409516 Ga0496105_0409516_383_940 161
122 3300048912 Ga0496109_0164815 Ga0496109_0164815_1022_1579 161
123 3300048913 Ga0496110_0133872 Ga0496110_0133872_1322_1879 161
124 3300048914 Ga0496111_0020877 Ga0496111_0020877_2709_3266 161
125 3300048915 Ga0496112_0141556 Ga0496112_0141556_362_919 161
126 3300005455 Ga0070663_100381809 Ga0070663_1003818092 162
127 3300005458 Ga0070681_10388327 Ga0070681_103883272 162
128 3300005535 Ga0070684_101066741 Ga0070684_1010667411 162
129 3300005539 Ga0068853_100009938 Ga0068853_1000099386 162
130 3300005564 Ga0070664_100459613 Ga0070664_1004596132 162
131 3300025920 Ga0207649_10026494 Ga0207649_100264943 162
132 3300025945 Ga0207679_10269082 Ga0207679_102690822 162
133 3300026067 Ga0207678_10105721 Ga0207678_101057213 162
134 3300026142 Ga0207698_10094668 Ga0207698_100946682 162
135 3300045976 Ga0466967_0061875 Ga0466967_0061875_1501_2067 162
136 3300045049 Ga0466959_0265885 Ga0466959_0265885_620_1159 163
137 3300039450 Ga0436363_1011758 Ga0436363_1011758_43_621 164
138 3300045049 Ga0466959_0105874 Ga0466959_0105874_166_810 164
139 3300013307 Ga0157372_10653993 Ga0157372_106539932 165
140 3300026078 Ga0207702_10019322 Ga0207702_100193222 165
141 3300046477 Ga0495664_0003992 Ga0495664_0003992_4226_4882 165
142 3300046678 Ga0495599_0051516 Ga0495599_0051516_1740_2396 165
143 3300053077 Ga0495601_0018550 Ga0495601_0018550_3405_4061 165
144 3300053078 Ga0495612_0067159 Ga0495612_0067159_147_803 165
145 3300037853 Ga0436364_0318435 Ga0436364_0318435_2770_3402 166
146 3300039437 Ga0436365_1746327 Ga0436365_1746327_17_649 166
147 3300025297 Ga0209758_1025363 Ga0209758_10253633 167
148 3300046689 Ga0495613_0023674 Ga0495613_0023674_1644_2279 167
149 3300048916 Ga0496113_0237010 Ga0496113_0237010_71_694 167
150 3300048929 Ga0496126_0110598 Ga0496126_0110598_388_1026 167
151 3300010159 Ga0099796_10249534 Ga0099796_102495341 168
152 3300025261 Ga0209233_1000632 Ga0209233_100063211 168
153 3300044735 Ga0466968_0104605 Ga0466968_0104605_83_712 168
154 3300053111 Ga0500572_000169 Ga0500572_000169_4660_5331 168
155 3300053136 Ga0500559_0002947 Ga0500559_0002947_1566_2237 168
156 3300053163 Ga0500639_016047 Ga0500639_016047_2730_3401 168
157 3300053735 Ga0500596_003401 Ga0500596_003401_528_1199 168
158 3300005336 Ga0070680_100034795 Ga0070680_1000347953 169
159 3300005458 Ga0070681_10048039 Ga0070681_100480393 169
160 3300005564 Ga0070664_100629645 Ga0070664_1006296452 169
161 3300005614 Ga0068856_100012522 Ga0068856_10001252210 169
162 3300005614 Ga0068856_101327994 Ga0068856_1013279941 169
163 3300006914 Ga0075436_100298531 Ga0075436_1002985312 169
164 3300013105 Ga0157369_11163921 Ga0157369_111639211 169
165 3300013307 Ga0157372_10185235 Ga0157372_101852352 169
166 3300025912 Ga0207707_10306254 Ga0207707_103062541 169
167 3300025917 Ga0207660_10117120 Ga0207660_101171202 169
168 3300025939 Ga0207665_10170931 Ga0207665_101709312 169
169 3300026078 Ga0207702_10783936 Ga0207702_107839361 169
170 3300048904 Ga0496101_0556140 Ga0496101_0556140_146_748 169
171 3300005336 Ga0070680_100509784 Ga0070680_1005097842 170
172 3300005437 Ga0070710_10559213 Ga0070710_105592131 170
173 3300025921 Ga0207652_10026205 Ga0207652_100262053 170
174 iso_pu_bacteria 2885383462 2885391217 170
175 3300005434 Ga0070709_10118644 Ga0070709_101186442 171
176 3300005436 Ga0070713_100085258 Ga0070713_1000852582 171
177 3300025906 Ga0207699_10014962 Ga0207699_100149622 171
178 3300025916 Ga0207663_10096118 Ga0207663_100961181 171
179 3300048918 Ga0496115_0082536 Ga0496115_0082536_720_1352 171
180 3300049581 Ga0501047_0004564 Ga0501047_0004564_10833_11477 171
181 3300049586 Ga0501070_0059542 Ga0501070_0059542_2485_3129 171
182 3300049590 Ga0501074_0211567 Ga0501074_0211567_37_681 171
183 3300053080 Ga0500635_0017146 Ga0500635_0017146_1296_1913 171
184 3300053178 Ga0500637_0028943 Ga0500637_0028943_1529_2146 171
185 iso_pu_bacteria 2513237098 2513673539 171
186 iso_pu_bacteria 2903768456 2903777230 171
187 3300009093 Ga0105240_10238202 Ga0105240_102382022 172
188 3300020082 Ga0206353_11560999 Ga0206353_115609991 172
189 3300033180 Ga0307510_10091320 Ga0307510_100913202 172
190 3300035086 Ga0373934_0007485 Ga0373934_0007485_237_869 172
191 3300035111 Ga0373923_0002374 Ga0373923_0002374_338_970 172
192 3300035113 Ga0373936_0062657 Ga0373936_0062657_311_943 172
193 3300035118 Ga0373954_0010854 Ga0373954_0010854_2048_2680 172
194 3300035119 Ga0373956_0006883 Ga0373956_0006883_638_1270 172
195 3300035172 Ga0373955_0000678 Ga0373955_0000678_2047_2679 172
196 3300035410 Ga0373924_0006921 Ga0373924_0006921_2529_3161 172
197 3300036401 Ga0373937_0008389 Ga0373937_0008389_3512_4144 172
198 3300037068 Ga0373925_0126956 Ga0373925_0126956_806_1453 172
199 3300044684 Ga0466966_0290263 Ga0466966_0290263_239_844 172
200 3300046455 Ga0495603_0004304 Ga0495603_0004304_1755_2387 172
201 3300046459 Ga0495629_0003378 Ga0495629_0003378_1349_1981 172
202 3300046463 Ga0495653_0000367 Ga0495653_0000367_2086_2718 172
203 3300046511 Ga0495608_0008277 Ga0495608_0008277_1158_1790 172
204 3300046514 Ga0495618_0167634 Ga0495618_0167634_287_919 172
205 3300046529 Ga0495652_0009044 Ga0495652_0009044_7265_7897 172
206 3300046533 Ga0495640_0003357 Ga0495640_0003357_1469_2101 172
207 3300046536 Ga0495587_0007028 Ga0495587_0007028_1166_1798 172
208 3300046543 Ga0495645_0138848 Ga0495645_0138848_407_1039 172
209 3300046559 Ga0495667_0003583 Ga0495667_0003583_5510_6142 172
210 3300046642 Ga0495634_0007068 Ga0495634_0007068_1942_2574 172
211 3300046663 Ga0495635_0003610 Ga0495635_0003610_5251_5883 172
212 3300046675 Ga0495657_0003520 Ga0495657_0003520_6625_7257 172
213 3300046678 Ga0495599_0001176 Ga0495599_0001176_3431_4063 172
214 3300046679 Ga0495623_0008590 Ga0495623_0008590_4834_5466 172
215 3300046680 Ga0495646_0025940 Ga0495646_0025940_1514_2146 172
216 3300046689 Ga0495613_0019437 Ga0495613_0019437_3563_4195 172
217 3300047319 Ga0495674_0020314 Ga0495674_0020314_5331_5963 172
218 3300047322 Ga0495680_0053389 Ga0495680_0053389_1166_1798 172
219 3300047444 Ga0495675_0004613 Ga0495675_0004613_596_1228 172
220 3300047471 Ga0495684_0001903 Ga0495684_0001903_4834_5466 172
221 3300048088 Ga0495602_0043781 Ga0495602_0043781_1348_1980 172
222 3300053077 Ga0495601_0010529 Ga0495601_0010529_220_852 172
223 3300053080 Ga0500635_0013636 Ga0500635_0013636_1072_1704 172
224 3300053084 Ga0495595_0028638 Ga0495595_0028638_499_1131 172
225 3300053085 Ga0495619_0000630 Ga0495619_0000630_11280_11912 172
226 3300053150 Ga0500603_002810 Ga0500603_002810_1226_1858 172
227 3300053178 Ga0500637_0016738 Ga0500637_0016738_2422_3054 172
228 iso_pu_bacteria 2904690495 2904693032 172
229 iso_pu_bacteria 2908756301 2908757908 172
230 3300005339 Ga0070660_100220545 Ga0070660_1002205452 173
231 3300005366 Ga0070659_100221237 Ga0070659_1002212372 173
232 3300005436 Ga0070713_100026661 Ga0070713_1000266612 173
233 3300005616 Ga0068852_100048293 Ga0068852_1000482933 173
234 3300025928 Ga0207700_10012174 Ga0207700_100121746 173
235 3300025949 Ga0207667_10346703 Ga0207667_103467031 173
236 3300035695 Ga0373927_0002614 Ga0373927_0002614_10457_11089 173
237 3300035725 Ga0373947_0044912 Ga0373947_0044912_1026_1658 173
238 3300037312 Ga0395899_0341103 Ga0395899_0341103_273_866 173
239 3300037418 Ga0395900_0001526 Ga0395900_0001526_15979_16572 173
240 3300037466 Ga0395898_0062207 Ga0395898_0062207_2955_3548 173
241 3300038443 Ga0395901_0015205 Ga0395901_0015205_136_729 173
242 3300005435 Ga0070714_100166833 Ga0070714_1001668332 174
243 3300005436 Ga0070713_100010153 Ga0070713_1000101536 174
244 3300006028 Ga0070717_10124033 Ga0070717_101240332 174
245 3300007265 Ga0099794_10209930 Ga0099794_102099302 174
246 3300025928 Ga0207700_10030323 Ga0207700_100303232 174
247 3300027671 Ga0209588_1007959 Ga0209588_10079592 174
248 3300007265 Ga0099794_10092613 Ga0099794_100926132 175
249 3300009093 Ga0105240_10069319 Ga0105240_100693192 175
250 3300046507 Ga0495606_0005525 Ga0495606_0005525_5643_6269 175
251 3300031247 Ga0265340_10032597 Ga0265340_100325973 176
252 3300031249 Ga0265339_10025233 Ga0265339_100252331 176
253 iso_pu_bacteria 2508501128 2509146582 176
254 3300037853 Ga0436364_1424390 Ga0436364_1424390_88_726 177
255 3300005563 Ga0068855_100863738 Ga0068855_1008637381 178
256 3300009093 Ga0105240_10073756 Ga0105240_100737563 178
257 3300013104 Ga0157370_10040561 Ga0157370_100405613 178
258 3300013105 Ga0157369_10009599 Ga0157369_100095996 178
259 3300013307 Ga0157372_10214867 Ga0157372_102148672 178
260 3300025913 Ga0207695_10042621 Ga0207695_100426213 178
261 3300037312 Ga0395899_0071740 Ga0395899_0071740_331_984 178
262 3300037418 Ga0395900_0009206 Ga0395900_0009206_7041_7694 178
263 3300037466 Ga0395898_0005460 Ga0395898_0005460_10952_11605 178
264 3300038443 Ga0395901_0232328 Ga0395901_0232328_112_765 178
265 3300005434 Ga0070709_10318426 Ga0070709_103184261 179
266 3300005437 Ga0070710_10087335 Ga0070710_100873352 179
267 3300006177 Ga0075362_10223486 Ga0075362_102234861 179
268 3300025906 Ga0207699_10372160 Ga0207699_103721602 179
269 3300036459 Ga0372808_022896 Ga0372808_022896_43_666 179
270 3300044842 Ga0466957_0407354 Ga0466957_0407354_16_654 179
271 iso_pu_bacteria 2513237102 2513699483 179
272 iso_pu_bacteria 2824679649 2824684328 180
273 iso_pu_bacteria 2922393267 2922396480 180
274 iso_pu_bacteria 2935959822 2935965662 180
275 iso_pu_bacteria 3005718088 3005724171 180
276 3300048914 Ga0496111_0170129 Ga0496111_0170129_137_778 182
277 3300009177 Ga0105248_10342284 Ga0105248_103422842 183
278 3300009545 Ga0105237_10672955 Ga0105237_106729552 183
279 3300046507 Ga0495606_0259577 Ga0495606_0259577_320_934 183
280 3300046524 Ga0495648_0252615 Ga0495648_0252615_220_834 183
281 3300053130 Ga0500642_0308803 Ga0500642_0308803_56_670 183
282 3300003354 JGI25160J50197_1002032 JGI25160J50197_10020329 184
283 3300006051 Ga0075364_10066914 Ga0075364_100669141 184
284 3300010375 Ga0105239_10763838 Ga0105239_107638381 184
285 3300025302 Ga0207426_1002035 Ga0207426_10020356 184
286 3300050491 nmdc:mga00v17_175079_c1 nmdc:mga00v17_175079_c1_603_1220 184

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.829 74 111
6dsp-assembly2.cif.gz_B lsrb from clostridium saccharobutylicum in complex with ai-2 0.8234 31 66
5dkv-assembly4.cif.gz_D crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d-tagatopyranose 0.8215 30 65
5xsd-assembly1.cif.gz_A xylfii-lytsn complex mutant - d103a 0.8208 30 65
8abp-assembly1.cif.gz_A sugar-binding and crystallographic studies of an arabinose-binding protein mutant (met108leu) which exhibits enhanced affinity and altered specificity 0.8121 30 65
ID Description Score Start End Superfamily
6dspB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8234 31 66 3.40.50.2300
af_A0A1D6F9G8_47_167_2.60.40.770 Mainly Beta;Sandwich;Immunoglobulin-like; 0.811 86 111 2.60.40.770
4oqeB02 Mainly Beta;Single Sheet;S-adenosyl-L-methionine-dependent methyltransferases;CAC2371-like domains 0.8068 71 111 2.20.130.10
4kzkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8004 31 65 3.40.50.2300
1sxgB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7994 30 65 3.40.50.2300
ID Description Score Start End GO Terms
AF-Q1YDC8-F1-model_v4 Putative sugar ABC transporter, ATP-binding protein 0.9277 31 143 GO:0005524
GO:0016887
AF-A0A529XMX7-F1-model_v4 deleted 0.9121 28 145
AF-A0A5D0VIW9-F1-model_v4 Lipoprotein 0.9095 28 146
AF-A0A529KTV1-F1-model_v4 Uncharacterized protein 0.9067 56 136
AF-A0A2N6B5L0-F1-model_v4 Uncharacterized protein 0.8885 24 146

Feature Viewer

pLDDT pTM Quality
64.13 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map