F387398

General Info

Members Datasets Scaffolds Average Seq Length
286 176 286 174

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10023634|Ga0105238_100236345
Length 203
Sequence VGAILVPFVTICHRLTQATGKHKKGFMRRVLVIGSGGSGKSTVAARLGELLGLEVNHLDKFYWRAGWVEPAQDEWIKTVEELMDRDSWVMDGNYSGTLELRLRKCDTVVFLDLPRVLCLWRIVKRFLLYRNGNRPDVAEGCPEKLDFEFVSWVWNYPRRSRPKVIKLLREHAGEKQIFRLRSRNEVKKFLASHQNAKKEHMND

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
134 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
147 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
154 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
155 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
156 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
157 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
158 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
159 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
160 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
161 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
162 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
163 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
164 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
172 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.94
Nodule 0
Rhizoplane 1.4
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000012 3300002459 Bacteria 115709
2 JGI25406J46586_10000408 3300003203 Bacteria 19769
3 JGI25153J46596_10000145 3300003215 Bacteria 72113
4 rootH2_10031820 3300003320 Unclassified 3547
5 rootL2_10225526 3300003322 Unclassified 2553
6 Ga0055531_10004807 3300003794 Bacteria 8067
7 Ga0065714_10023588 3300005288 Bacteria 2306
8 Ga0065704_10256848 3300005289 Bacteria 975
9 Ga0065712_10014942 3300005290 Bacteria 1532
10 Ga0065715_10020811 3300005293 Unclassified 2152
11 Ga0065715_10151092 3300005293 Unclassified 1715
12 Ga0065715_10210023 3300005293 Bacteria 1318
13 Ga0065707_10215494 3300005295 Bacteria 1247
14 Ga0070690_100014306 3300005330 Unclassified 4707
15 Ga0070670_100000174 3300005331 Bacteria 58017
16 Ga0070670_100121146 3300005331 Bacteria 2257
17 Ga0070670_100134854 3300005331 Bacteria 2133
18 Ga0068869_100523505 3300005334 Bacteria 993
19 Ga0068869_100595506 3300005334 Unclassified 933
20 Ga0070666_10007065 3300005335 Bacteria 6918
21 Ga0070666_10425728 3300005335 Unclassified 957
22 Ga0068868_100003437 3300005338 Bacteria 11028
23 Ga0070660_100754014 3300005339 Bacteria 817
24 Ga0070689_100397973 3300005340 Bacteria 1163
25 Ga0070692_10099936 3300005345 Bacteria 1589
26 Ga0070692_10462057 3300005345 Unclassified 815
27 Ga0070692_10598921 3300005345 Unclassified 729
28 Ga0070673_100414864 3300005364 Unclassified 1206
29 Ga0070659_100069651 3300005366 Unclassified 2793
30 Ga0070701_10806764 3300005438 Bacteria 641
31 Ga0070705_100097225 3300005440 Unclassified 1850
32 Ga0070694_100002549 3300005444 Bacteria 10760
33 Ga0070694_100122486 3300005444 Bacteria 1868
34 Ga0070694_100282872 3300005444 Bacteria 1265
35 Ga0070694_100336016 3300005444 Bacteria 1166
36 Ga0070662_100095485 3300005457 Bacteria 2241
37 Ga0070681_10018744 3300005458 Bacteria 6926
38 Ga0070681_10494492 3300005458 Unclassified 1136
39 Ga0068867_100460865 3300005459 Bacteria 1085
40 Ga0068867_100545844 3300005459 Unclassified 1003
41 Ga0070698_100257173 3300005471 Bacteria 1678
42 Ga0070699_100273890 3300005518 Bacteria 1511
43 Ga0070679_100651165 3300005530 Unclassified 996
44 Ga0070684_100124156 3300005535 Bacteria 2324
45 Ga0070684_100229421 3300005535 Bacteria 1695
46 Ga0070672_100004122 3300005543 Bacteria 9486
47 Ga0070695_100167957 3300005545 Unclassified 1546
48 Ga0070695_100309796 3300005545 Bacteria 1170
49 Ga0070695_100533056 3300005545 Unclassified 913
50 Ga0070696_100060632 3300005546 Unclassified 2645
51 Ga0070696_100135113 3300005546 Unclassified 1797
52 Ga0070693_100160138 3300005547 Unclassified 1433
53 Ga0070704_100037229 3300005549 Unclassified 3322
54 Ga0070704_100420387 3300005549 Bacteria 1145
55 Ga0070704_100494109 3300005549 Bacteria 1061
56 Ga0070704_100947755 3300005549 Unclassified 776
57 Ga0068855_100985696 3300005563 Bacteria 886
58 Ga0070664_100004904 3300005564 Bacteria 10712
59 Ga0070664_100102615 3300005564 Bacteria 2489
60 Ga0070664_100278056 3300005564 Bacteria 1509
61 Ga0068857_100531478 3300005577 Bacteria 1106
62 Ga0068857_100631687 3300005577 Bacteria 1014
63 Ga0068854_100133175 3300005578 Bacteria 1900
64 Ga0068854_100185353 3300005578 Unclassified 1628
65 Ga0068854_100307652 3300005578 Bacteria 1284
66 Ga0068859_100002543 3300005617 Bacteria 18515
67 Ga0068859_100100543 3300005617 Unclassified 2947
68 Ga0068859_100135270 3300005617 Bacteria 2537
69 Ga0068859_100512523 3300005617 Bacteria 1295
70 Ga0068859_100742582 3300005617 Unclassified 1071
71 Ga0068859_101030934 3300005617 Unclassified 904
72 Ga0068864_100005294 3300005618 Bacteria 10560
73 Ga0068864_100167147 3300005618 Bacteria 2003
74 Ga0068864_100415687 3300005618 Unclassified 1280
75 Ga0068864_100515029 3300005618 Unclassified 1153
76 Ga0068864_100608722 3300005618 Unclassified 1061
77 Ga0068864_101516966 3300005618 Bacteria 673
78 Ga0068861_100108795 3300005719 Bacteria 2218
79 Ga0068861_101396931 3300005719 Bacteria 684
80 Ga0068861_101629937 3300005719 Unclassified 636
81 Ga0068863_100015617 3300005841 Bacteria 7294
82 Ga0068863_100140800 3300005841 Bacteria 2305
83 Ga0068858_100100275 3300005842 Bacteria 2701
84 Ga0068858_100163424 3300005842 Unclassified 2097
85 Ga0068858_101051547 3300005842 Bacteria 798
86 Ga0068860_100057808 3300005843 Bacteria 3687
87 Ga0068860_100300843 3300005843 Bacteria 1571
88 Ga0068862_100018426 3300005844 Bacteria 5814
89 Ga0068862_100136897 3300005844 Bacteria 2171
90 Ga0068862_100148709 3300005844 Bacteria 2084
91 Ga0068862_100958429 3300005844 Unclassified 844
92 Ga0081455_10421860 3300005937 Bacteria 920
93 Ga0081539_10000033 3300005985 Bacteria 309306
94 Ga0081539_10000612 3300005985 Bacteria 72310
95 Ga0075428_100447497 3300006844 Unclassified 1384
96 Ga0075434_100055595 3300006871 Unclassified 3933
97 Ga0075434_100325716 3300006871 Unclassified 1557
98 Ga0075434_101035466 3300006871 Unclassified 834
99 Ga0097620_100002543 3300006931 Bacteria 18515
100 Ga0097620_100100545 3300006931 Unclassified 2947
101 Ga0097620_100135277 3300006931 Bacteria 2537
102 Ga0097620_100226959 3300006931 Bacteria 1955
103 Ga0097620_100512480 3300006931 Bacteria 1295
104 Ga0097620_100742544 3300006931 Unclassified 1071
105 Ga0097620_101031014 3300006931 Unclassified 904
106 Ga0105240_10150282 3300009093 Unclassified 2775
107 Ga0105240_11031793 3300009093 Unclassified 878
108 Ga0105245_11919503 3300009098 Unclassified 645
109 Ga0105247_10144203 3300009101 Unclassified 1563
110 Ga0105247_10201043 3300009101 Bacteria 1339
111 Ga0114129_10104234 3300009147 Bacteria 3919
112 Ga0114129_12083423 3300009147 Unclassified 685
113 Ga0105243_10111724 3300009148 Bacteria 2288
114 Ga0105243_10429771 3300009148 Bacteria 1234
115 Ga0105241_10353503 3300009174 Bacteria 1276
116 Ga0105241_10377588 3300009174 Bacteria 1237
117 Ga0105241_10478056 3300009174 Unclassified 1107
118 Ga0105241_10680041 3300009174 Unclassified 937
119 Ga0105242_10408221 3300009176 Bacteria 1269
120 Ga0105248_10008746 3300009177 Bacteria 11121
121 Ga0105248_10198578 3300009177 Bacteria 2260
122 Ga0105248_10886256 3300009177 Bacteria 1007
123 Ga0105237_10104163 3300009545 Bacteria 2829
124 Ga0105237_10959684 3300009545 Bacteria 862
125 Ga0105238_10023634 3300009551 Bacteria 6262
126 Ga0105249_10093523 3300009553 Unclassified 2816
127 Ga0105239_10347251 3300010375 Bacteria 1675
128 Ga0105239_10951608 3300010375 Bacteria 986
129 Ga0157373_10155500 3300013100 Bacteria 1609
130 Ga0157373_10357084 3300013100 Bacteria 1043
131 Ga0157374_11925059 3300013296 Unclassified 617
132 Ga0157378_12045993 3300013297 Unclassified 623
133 Ga0163162_10309348 3300013306 Bacteria 1712
134 Ga0163162_10527990 3300013306 Bacteria 1309
135 Ga0157372_11832488 3300013307 Unclassified 698
136 Ga0157372_12290788 3300013307 Bacteria 620
137 Ga0157375_10509157 3300013308 Bacteria 1368
138 Ga0157375_12064630 3300013308 Unclassified 678
139 Ga0163163_10000208 3300014325 Bacteria 60820
140 Ga0157380_10706456 3300014326 Bacteria 1014
141 Ga0157379_10076863 3300014968 Bacteria 2989
142 Ga0157379_10170551 3300014968 Unclassified 1964
143 Ga0157376_10006613 3300014969 Bacteria 8203
144 Ga0182007_10065948 3300015262 Bacteria 1186
145 Ga0213876_10000209 3300021384 Bacteria 58910
146 Ga0209758_1000060 3300025297 Bacteria 324326
147 Ga0209758_1066641 3300025297 Bacteria 1155
148 Ga0209050_1005532 3300025298 Bacteria 7893
149 Ga0209051_1011765 3300025303 Bacteria 4290
150 Ga0209257_1001302 3300025304 Bacteria 30372
151 Ga0209257_1042142 3300025304 Bacteria 1349
152 Ga0207697_10166384 3300025315 Bacteria 963
153 Ga0207647_10026308 3300025904 Unclassified 3809
154 Ga0207647_10382874 3300025904 Unclassified 794
155 Ga0207643_10335066 3300025908 Bacteria 947
156 Ga0207707_10003034 3300025912 Bacteria 14927
157 Ga0207660_10249409 3300025917 Unclassified 1401
158 Ga0207681_10037919 3300025923 Bacteria 3189
159 Ga0207694_10001471 3300025924 Bacteria 20135
160 Ga0207650_10000011 3300025925 Bacteria 450115
161 Ga0207650_10018655 3300025925 Unclassified 4869
162 Ga0207650_10405723 3300025925 Bacteria 1129
163 Ga0207650_10466306 3300025925 Bacteria 1052
164 Ga0207650_10568743 3300025925 Bacteria 951
165 Ga0207650_10725727 3300025925 Unclassified 840
166 Ga0207690_10213400 3300025932 Bacteria 1473
167 Ga0207706_10177931 3300025933 Bacteria 1868
168 Ga0207686_10497956 3300025934 Unclassified 945
169 Ga0207709_10019181 3300025935 Bacteria 3841
170 Ga0207709_10381581 3300025935 Unclassified 1073
171 Ga0207670_10535918 3300025936 Bacteria 955
172 Ga0207670_10662077 3300025936 Unclassified 862
173 Ga0207691_10010672 3300025940 Bacteria 8817
174 Ga0207691_10646465 3300025940 Bacteria 894
175 Ga0207711_10002600 3300025941 Bacteria 16036
176 Ga0207711_10010678 3300025941 Bacteria 7636
177 Ga0207711_10232636 3300025941 Bacteria 1688
178 Ga0207689_10084801 3300025942 Unclassified 2604
179 Ga0207689_10589358 3300025942 Bacteria 935
180 Ga0207679_10087564 3300025945 Unclassified 2398
181 Ga0207679_10369043 3300025945 Bacteria 1256
182 Ga0207679_10511852 3300025945 Unclassified 1072
183 Ga0207679_10537536 3300025945 Unclassified 1047
184 Ga0207667_10460366 3300025949 Bacteria 1292
185 Ga0207651_10792666 3300025960 Unclassified 840
186 Ga0207712_10190574 3300025961 Bacteria 1618
187 Ga0207668_10109581 3300025972 Bacteria 2069
188 Ga0207640_10148337 3300025981 Bacteria 1720
189 Ga0207640_10274628 3300025981 Bacteria 1320
190 Ga0207677_10093162 3300026023 Bacteria 2195
191 Ga0207703_10311666 3300026035 Bacteria 1439
192 Ga0207703_11036709 3300026035 Bacteria 787
193 Ga0207703_11862713 3300026035 Unclassified 578
194 Ga0207708_10000091 3300026075 Bacteria 71484
195 Ga0207708_10190870 3300026075 Bacteria 1631
196 Ga0207708_10282602 3300026075 Unclassified 1345
197 Ga0207641_10161938 3300026088 Bacteria 2035
198 Ga0207648_10102457 3300026089 Bacteria 2509
199 Ga0207676_10007651 3300026095 Bacteria 7669
200 Ga0207676_10453324 3300026095 Bacteria 1209
201 Ga0207676_10795594 3300026095 Unclassified 922
202 Ga0207674_10226957 3300026116 Bacteria 1815
203 Ga0207674_10487962 3300026116 Bacteria 1191
204 Ga0207674_10566455 3300026116 Bacteria 1097
205 Ga0207675_100634793 3300026118 Bacteria 1073
206 Ga0207675_101164216 3300026118 Unclassified 791
207 Ga0207675_101777652 3300026118 Unclassified 636
208 Ga0268266_10606697 3300028379 Bacteria 1052
209 Ga0268265_10031452 3300028380 Bacteria 3832
210 Ga0268265_11778140 3300028380 Unclassified 623
211 Ga0265322_10013920 3300028654 Bacteria 2328
212 Ga0265329_10027413 3300031242 Bacteria 1872
213 Ga0265316_10021063 3300031344 Bacteria 5532
214 Ga0265316_10388987 3300031344 Unclassified 1005
215 Ga0307513_10002993 3300031456 Bacteria 23041
216 Ga0307508_10106593 3300031616 Bacteria 2401
217 Ga0265342_10073055 3300031712 Bacteria 1995
218 Ga0307516_10387578 3300031730 Bacteria 1058
219 Ga0307405_10285872 3300031731 Bacteria 1244
220 Ga0307413_10511665 3300031824 Unclassified 966
221 Ga0307413_10883529 3300031824 Unclassified 758
222 Ga0307410_10514670 3300031852 Unclassified 987
223 Ga0307406_10652334 3300031901 Unclassified 874
224 Ga0307407_10125100 3300031903 Unclassified 1636
225 Ga0307409_100324608 3300031995 Bacteria 1442
226 Ga0307416_100498680 3300032002 Bacteria 1281
227 Ga0307416_102181613 3300032002 Unclassified 655
228 Ga0307411_10035237 3300032005 Bacteria 3123
229 Ga0307415_100089390 3300032126 Bacteria 2225
230 Ga0307415_100489575 3300032126 Unclassified 1073
231 Ga0373931_0019084 3300035691 Unclassified 3418
232 Ga0242420_001268 3300038996 Bacteria 3317
233 Ga0436365_0039241 3300039437 Bacteria 90885
234 Ga0439455_0013404 3300042012 Bacteria 1856
235 Ga0450890_025784 3300042127 Bacteria 817
236 Ga0450892_011964 3300042130 Unclassified 776
237 Ga0439458_0005424 3300042157 Bacteria 2868
238 Ga0453684_0015762 3300044712 Bacteria 11898
239 Ga0466957_0277231 3300044842 Bacteria 1121
240 Ga0466960_0320125 3300044901 Bacteria 878
241 Ga0451576_0274664 3300045051 Bacteria 1762
242 Ga0495592_0011757 3300046454 Bacteria 6631
243 Ga0495632_0057935 3300046519 Bacteria 1889
244 Ga0496106_0033416 3300048909 Bacteria 3838
245 Ga0496108_0016303 3300048911 Bacteria 6061
246 Ga0496112_0082107 3300048915 Bacteria 3188
247 Ga0496112_0274327 3300048915 Bacteria 1634
248 Ga0496121_0102057 3300048924 Bacteria 2211
249 Ga0501291_005582 3300049514 Unclassified 1650
250 Ga0501296_023712 3300049519 Unclassified 796
251 Ga0501298_000185 3300049521 Bacteria 7784
252 Ga0501299_026669 3300049522 Unclassified 1093
253 Ga0501299_057610 3300049522 Bacteria 816
254 Ga0501072_0007245 3300049588 Bacteria 8420
255 Ga0501076_0981757 3300049592 Bacteria 696
256 Ga0501077_0385935 3300049593 Bacteria 895
257 Ga0501207_108430 3300049654 Unclassified 565
258 Ga0501217_025920 3300049661 Bacteria 1414
259 Ga0501217_248594 3300049661 Bacteria 572
260 Ga0501224_004394 3300049664 Unclassified 2004
261 Ga0501227_001994 3300049665 Bacteria 4532
262 Ga0501236_064179 3300049670 Unclassified 658
263 Ga0501243_018678 3300049675 Unclassified 1131
264 Ga0501260_015891 3300049689 Unclassified 788
265 Ga0501261_060808 3300049690 Unclassified 641
266 Ga0501225_0016133 3300049705 Bacteria 2078
267 Ga0501225_0028004 3300049705 Unclassified 1549
268 Ga0501225_0041113 3300049705 Bacteria 1275
269 Ga0501225_0083353 3300049705 Unclassified 920
270 Ga0501234_012874 3300049707 Unclassified 1312
271 Ga0501283_000449 3300049779 Bacteria 5431
272 Ga0501212_011982 3300049851 Unclassified 1256
273 nmdc:mga05p37_128384_c1 3300050507 Bacteria 3112
274 nmdc:mga06r32_457189_c1 3300050510 Unclassified 1256
275 nmdc:mga0n895_10109_c1 3300050512 Bacteria 8307
276 nmdc:mga0n895_154512_c1 3300050512 Unclassified 2325
277 nmdc:mga0a205_76618_c1 3300050515 Bacteria 3232
278 Ga0500646_0339368 3300053090 Bacteria 546
279 Ga0500651_0642539 3300053093 Bacteria 572
280 Ga0500555_006606 3300053103 Bacteria 3298
281 Ga0500594_0018973 3300053118 Bacteria 1700
282 Ga0500642_0004697 3300053130 Bacteria 4312
283 Ga0500642_0168507 3300053130 Bacteria 1025
284 Ga0500568_0028605 3300053139 Bacteria 2322
285 Ga0500577_0007821 3300053142 Bacteria 3014
286 Ga0500609_001512 3300053731 Bacteria 3403

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049670 Ga0501236_064179 Ga0501236_064179_174_641 142
2 3300005331 Ga0070670_100134854 Ga0070670_1001348543 151
3 3300005564 Ga0070664_100102615 Ga0070664_1001026152 151
4 3300025925 Ga0207650_10405723 Ga0207650_104057232 151
5 3300025945 Ga0207679_10369043 Ga0207679_103690432 151
6 3300026075 Ga0207708_10282602 Ga0207708_102826022 152
7 3300003215 JGI25153J46596_10000145 JGI25153J46596_1000014531 163
8 3300003322 rootL2_10225526 rootL2_102255262 163
9 3300003794 Ga0055531_10004807 Ga0055531_100048074 163
10 3300005844 Ga0068862_100018426 Ga0068862_1000184265 163
11 3300005937 Ga0081455_10421860 Ga0081455_104218602 163
12 3300025297 Ga0209758_1000060 Ga0209758_1000060119 163
13 3300025297 Ga0209758_1066641 Ga0209758_10666412 163
14 3300025298 Ga0209050_1005532 Ga0209050_10055328 163
15 3300025303 Ga0209051_1011765 Ga0209051_10117653 163
16 3300025304 Ga0209257_1001302 Ga0209257_100130221 163
17 3300025304 Ga0209257_1042142 Ga0209257_10421422 163
18 3300028379 Ga0268266_10606697 Ga0268266_106066972 163
19 3300028380 Ga0268265_10031452 Ga0268265_100314523 163
20 3300031730 Ga0307516_10387578 Ga0307516_103875782 163
21 3300053090 Ga0500646_0339368 Ga0500646_0339368_13_534 163
22 3300053093 Ga0500651_0642539 Ga0500651_0642539_32_544 163
23 3300053103 Ga0500555_006606 Ga0500555_006606_2689_3210 163
24 3300053118 Ga0500594_0018973 Ga0500594_0018973_128_649 163
25 3300053130 Ga0500642_0004697 Ga0500642_0004697_3073_3594 163
26 3300053130 Ga0500642_0168507 Ga0500642_0168507_77_598 163
27 3300053142 Ga0500577_0007821 Ga0500577_0007821_249_764 163
28 3300053731 Ga0500609_001512 Ga0500609_001512_2734_3255 163
29 3300005549 Ga0070704_100947755 Ga0070704_1009477551 164
30 3300025972 Ga0207668_10109581 Ga0207668_101095813 164
31 3300005330 Ga0070690_100014306 Ga0070690_1000143062 165
32 3300005335 Ga0070666_10425728 Ga0070666_104257281 165
33 3300005457 Ga0070662_100095485 Ga0070662_1000954852 165
34 3300005459 Ga0068867_100545844 Ga0068867_1005458441 165
35 3300009553 Ga0105249_10093523 Ga0105249_100935232 165
36 3300013306 Ga0163162_10309348 Ga0163162_103093482 165
37 3300014969 Ga0157376_10006613 Ga0157376_100066134 165
38 3300025908 Ga0207643_10335066 Ga0207643_103350661 165
39 3300025917 Ga0207660_10249409 Ga0207660_102494091 165
40 3300025933 Ga0207706_10177931 Ga0207706_101779312 165
41 3300025961 Ga0207712_10190574 Ga0207712_101905741 165
42 3300044712 Ga0453684_0015762 Ga0453684_0015762_815_1324 165
43 3300044842 Ga0466957_0277231 Ga0466957_0277231_80_607 165
44 3300048924 Ga0496121_0102057 Ga0496121_0102057_959_1492 165
45 3300005289 Ga0065704_10256848 Ga0065704_102568482 166
46 3300005295 Ga0065707_10215494 Ga0065707_102154942 166
47 3300005578 Ga0068854_100307652 Ga0068854_1003076522 166
48 3300005618 Ga0068864_100608722 Ga0068864_1006087222 166
49 3300005843 Ga0068860_100057808 Ga0068860_1000578084 166
50 3300014968 Ga0157379_10076863 Ga0157379_100768634 166
51 3300021384 Ga0213876_10000209 Ga0213876_1000020923 166
52 3300025936 Ga0207670_10662077 Ga0207670_106620772 166
53 3300025981 Ga0207640_10274628 Ga0207640_102746282 166
54 3300026088 Ga0207641_10161938 Ga0207641_101619383 166
55 3300031901 Ga0307406_10652334 Ga0307406_106523342 166
56 3300039437 Ga0436365_0039241 Ga0436365_0039241_65440_65946 166
57 3300044901 Ga0466960_0320125 Ga0466960_0320125_165_680 166
58 3300046454 Ga0495592_0011757 Ga0495592_0011757_5494_6000 166
59 3300049588 Ga0501072_0007245 Ga0501072_0007245_136_642 166
60 3300049654 Ga0501207_108430 Ga0501207_108430_45_551 166
61 3300049661 Ga0501217_248594 Ga0501217_248594_25_531 166
62 3300005293 Ga0065715_10151092 Ga0065715_101510923 167
63 3300005293 Ga0065715_10210023 Ga0065715_102100232 167
64 3300005334 Ga0068869_100595506 Ga0068869_1005955062 167
65 3300005345 Ga0070692_10099936 Ga0070692_100999361 167
66 3300005345 Ga0070692_10462057 Ga0070692_104620571 167
67 3300005345 Ga0070692_10598921 Ga0070692_105989211 167
68 3300005364 Ga0070673_100414864 Ga0070673_1004148642 167
69 3300005440 Ga0070705_100097225 Ga0070705_1000972252 167
70 3300005444 Ga0070694_100002549 Ga0070694_1000025498 167
71 3300005444 Ga0070694_100122486 Ga0070694_1001224863 167
72 3300005444 Ga0070694_100282872 Ga0070694_1002828722 167
73 3300005458 Ga0070681_10018744 Ga0070681_100187446 167
74 3300005545 Ga0070695_100167957 Ga0070695_1001679572 167
75 3300005545 Ga0070695_100309796 Ga0070695_1003097962 167
76 3300005545 Ga0070695_100533056 Ga0070695_1005330562 167
77 3300005546 Ga0070696_100060632 Ga0070696_1000606321 167
78 3300005546 Ga0070696_100135113 Ga0070696_1001351132 167
79 3300005547 Ga0070693_100160138 Ga0070693_1001601382 167
80 3300005549 Ga0070704_100037229 Ga0070704_1000372292 167
81 3300005563 Ga0068855_100985696 Ga0068855_1009856962 167
82 3300005577 Ga0068857_100531478 Ga0068857_1005314782 167
83 3300005578 Ga0068854_100133175 Ga0068854_1001331753 167
84 3300005617 Ga0068859_100512523 Ga0068859_1005125232 167
85 3300005618 Ga0068864_100415687 Ga0068864_1004156872 167
86 3300005618 Ga0068864_101516966 Ga0068864_1015169662 167
87 3300005841 Ga0068863_100140800 Ga0068863_1001408003 167
88 3300005842 Ga0068858_100100275 Ga0068858_1001002754 167
89 3300006931 Ga0097620_100226959 Ga0097620_1002269592 167
90 3300006931 Ga0097620_100512480 Ga0097620_1005124802 167
91 3300009093 Ga0105240_10150282 Ga0105240_101502821 167
92 3300009098 Ga0105245_11919503 Ga0105245_119195031 167
93 3300009147 Ga0114129_10104234 Ga0114129_101042345 167
94 3300009174 Ga0105241_10353503 Ga0105241_103535032 167
95 3300009174 Ga0105241_10680041 Ga0105241_106800411 167
96 3300009545 Ga0105237_10104163 Ga0105237_101041634 167
97 3300010375 Ga0105239_10347251 Ga0105239_103472512 167
98 3300013100 Ga0157373_10357084 Ga0157373_103570843 167
99 3300013307 Ga0157372_11832488 Ga0157372_118324882 167
100 3300013307 Ga0157372_12290788 Ga0157372_122907881 167
101 3300014968 Ga0157379_10170551 Ga0157379_101705512 167
102 3300025904 Ga0207647_10026308 Ga0207647_100263083 167
103 3300025912 Ga0207707_10003034 Ga0207707_1000303412 167
104 3300025925 Ga0207650_10466306 Ga0207650_104663062 167
105 3300025934 Ga0207686_10497956 Ga0207686_104979562 167
106 3300025942 Ga0207689_10084801 Ga0207689_100848014 167
107 3300025942 Ga0207689_10589358 Ga0207689_105893582 167
108 3300025949 Ga0207667_10460366 Ga0207667_104603663 167
109 3300025960 Ga0207651_10792666 Ga0207651_107926662 167
110 3300025981 Ga0207640_10148337 Ga0207640_101483373 167
111 3300026035 Ga0207703_11862713 Ga0207703_118627131 167
112 3300026116 Ga0207674_10566455 Ga0207674_105664552 167
113 3300028380 Ga0268265_11778140 Ga0268265_117781401 167
114 3300038996 Ga0242420_001268 Ga0242420_001268_1548_2057 167
115 3300042012 Ga0439455_0013404 Ga0439455_0013404_801_1310 167
116 3300042127 Ga0450890_025784 Ga0450890_025784_200_709 167
117 3300042157 Ga0439458_0005424 Ga0439458_0005424_118_627 167
118 3300045051 Ga0451576_0274664 Ga0451576_0274664_1100_1609 167
119 3300048909 Ga0496106_0033416 Ga0496106_0033416_2321_2830 167
120 3300048911 Ga0496108_0016303 Ga0496108_0016303_3855_4364 167
121 3300049592 Ga0501076_0981757 Ga0501076_0981757_116_625 167
122 3300049593 Ga0501077_0385935 Ga0501077_0385935_27_536 167
123 3300050507 nmdc:mga05p37_128384_c1 nmdc:mga05p37_128384_c1_462_971 167
124 3300005459 Ga0068867_100460865 Ga0068867_1004608652 168
125 3300013100 Ga0157373_10155500 Ga0157373_101555001 168
126 3300013297 Ga0157378_12045993 Ga0157378_120459932 168
127 3300015262 Ga0182007_10065948 Ga0182007_100659482 168
128 3300026035 Ga0207703_10311666 Ga0207703_103116661 168
129 3300046519 Ga0495632_0057935 Ga0495632_0057935_1128_1640 168
130 3300048915 Ga0496112_0082107 Ga0496112_0082107_1252_1764 168
131 3300005334 Ga0068869_100523505 Ga0068869_1005235052 169
132 3300005340 Ga0070689_100397973 Ga0070689_1003979731 169
133 3300005438 Ga0070701_10806764 Ga0070701_108067641 169
134 3300005518 Ga0070699_100273890 Ga0070699_1002738903 169
135 3300005549 Ga0070704_100420387 Ga0070704_1004203872 169
136 3300005564 Ga0070664_100278056 Ga0070664_1002780563 169
137 3300005617 Ga0068859_101030934 Ga0068859_1010309342 169
138 3300005719 Ga0068861_101396931 Ga0068861_1013969311 169
139 3300005842 Ga0068858_101051547 Ga0068858_1010515472 169
140 3300005843 Ga0068860_100300843 Ga0068860_1003008433 169
141 3300005844 Ga0068862_100148709 Ga0068862_1001487092 169
142 3300006871 Ga0075434_100325716 Ga0075434_1003257163 169
143 3300006931 Ga0097620_101031014 Ga0097620_1010310141 169
144 3300009093 Ga0105240_11031793 Ga0105240_110317932 169
145 3300009101 Ga0105247_10144203 Ga0105247_101442032 169
146 3300009174 Ga0105241_10478056 Ga0105241_104780562 169
147 3300009176 Ga0105242_10408221 Ga0105242_104082212 169
148 3300009177 Ga0105248_10886256 Ga0105248_108862562 169
149 3300025904 Ga0207647_10382874 Ga0207647_103828742 169
150 3300025936 Ga0207670_10535918 Ga0207670_105359182 169
151 3300025945 Ga0207679_10511852 Ga0207679_105118522 169
152 3300025945 Ga0207679_10537536 Ga0207679_105375362 169
153 3300026035 Ga0207703_11036709 Ga0207703_110367092 169
154 3300026089 Ga0207648_10102457 Ga0207648_101024572 169
155 3300026118 Ga0207675_100634793 Ga0207675_1006347932 169
156 3300031731 Ga0307405_10285872 Ga0307405_102858723 169
157 3300032002 Ga0307416_100498680 Ga0307416_1004986802 169
158 3300032126 Ga0307415_100089390 Ga0307415_1000893903 169
159 3300048915 Ga0496112_0274327 Ga0496112_0274327_647_1162 169
160 3300050512 nmdc:mga0n895_10109_c1 nmdc:mga0n895_10109_c1_3574_4161 169
161 3300050515 nmdc:mga0a205_76618_c1 nmdc:mga0a205_76618_c1_2168_2686 169
162 3300003203 JGI25406J46586_10000408 JGI25406J46586_1000040810 170
163 3300003320 rootH2_10031820 rootH2_100318204 170
164 3300005288 Ga0065714_10023588 Ga0065714_100235883 170
165 3300005290 Ga0065712_10014942 Ga0065712_100149422 170
166 3300005293 Ga0065715_10020811 Ga0065715_100208113 170
167 3300005331 Ga0070670_100121146 Ga0070670_1001211464 170
168 3300005842 Ga0068858_100163424 Ga0068858_1001634242 170
169 3300005985 Ga0081539_10000612 Ga0081539_1000061216 170
170 3300009174 Ga0105241_10377588 Ga0105241_103775882 170
171 3300009177 Ga0105248_10198578 Ga0105248_101985782 170
172 3300010375 Ga0105239_10951608 Ga0105239_109516081 170
173 3300013306 Ga0163162_10527990 Ga0163162_105279902 170
174 3300013308 Ga0157375_10509157 Ga0157375_105091572 170
175 3300025925 Ga0207650_10725727 Ga0207650_107257271 170
176 3300025941 Ga0207711_10232636 Ga0207711_102326362 170
177 3300026116 Ga0207674_10487962 Ga0207674_104879622 170
178 3300031616 Ga0307508_10106593 Ga0307508_101065933 170
179 3300031824 Ga0307413_10511665 Ga0307413_105116652 170
180 3300031995 Ga0307409_100324608 Ga0307409_1003246082 170
181 3300032005 Ga0307411_10035237 Ga0307411_100352372 170
182 3300049705 Ga0501225_0041113 Ga0501225_0041113_690_1208 170
183 3300005335 Ga0070666_10007065 Ga0070666_100070655 171
184 3300005338 Ga0068868_100003437 Ga0068868_10000343710 171
185 3300005339 Ga0070660_100754014 Ga0070660_1007540142 171
186 3300005366 Ga0070659_100069651 Ga0070659_1000696513 171
187 3300005444 Ga0070694_100336016 Ga0070694_1003360162 171
188 3300005471 Ga0070698_100257173 Ga0070698_1002571732 171
189 3300005535 Ga0070684_100124156 Ga0070684_1001241562 171
190 3300005535 Ga0070684_100229421 Ga0070684_1002294212 171
191 3300005543 Ga0070672_100004122 Ga0070672_1000041227 171
192 3300005549 Ga0070704_100494109 Ga0070704_1004941092 171
193 3300005564 Ga0070664_100004904 Ga0070664_1000049046 171
194 3300005577 Ga0068857_100631687 Ga0068857_1006316872 171
195 3300005578 Ga0068854_100185353 Ga0068854_1001853532 171
196 3300005617 Ga0068859_100002543 Ga0068859_1000025439 171
197 3300005617 Ga0068859_100100543 Ga0068859_1001005433 171
198 3300005617 Ga0068859_100135270 Ga0068859_1001352704 171
199 3300005618 Ga0068864_100005294 Ga0068864_1000052949 171
200 3300005618 Ga0068864_100515029 Ga0068864_1005150292 171
201 3300005719 Ga0068861_100108795 Ga0068861_1001087952 171
202 3300005841 Ga0068863_100015617 Ga0068863_1000156174 171
203 3300005844 Ga0068862_100136897 Ga0068862_1001368973 171
204 3300005844 Ga0068862_100958429 Ga0068862_1009584291 171
205 3300005985 Ga0081539_10000033 Ga0081539_10000033119 171
206 3300006844 Ga0075428_100447497 Ga0075428_1004474972 171
207 3300006871 Ga0075434_100055595 Ga0075434_1000555953 171
208 3300006871 Ga0075434_101035466 Ga0075434_1010354662 171
209 3300006931 Ga0097620_100002543 Ga0097620_1000025439 171
210 3300006931 Ga0097620_100100545 Ga0097620_1001005453 171
211 3300006931 Ga0097620_100135277 Ga0097620_1001352774 171
212 3300009101 Ga0105247_10201043 Ga0105247_102010432 171
213 3300009147 Ga0114129_12083423 Ga0114129_120834231 171
214 3300009148 Ga0105243_10429771 Ga0105243_104297712 171
215 3300009177 Ga0105248_10008746 Ga0105248_100087469 171
216 3300013296 Ga0157374_11925059 Ga0157374_119250591 171
217 3300013308 Ga0157375_12064630 Ga0157375_120646301 171
218 3300025925 Ga0207650_10018655 Ga0207650_100186555 171
219 3300025925 Ga0207650_10568743 Ga0207650_105687433 171
220 3300025932 Ga0207690_10213400 Ga0207690_102134002 171
221 3300025935 Ga0207709_10381581 Ga0207709_103815812 171
222 3300025940 Ga0207691_10010672 Ga0207691_100106723 171
223 3300025940 Ga0207691_10646465 Ga0207691_106464652 171
224 3300025941 Ga0207711_10002600 Ga0207711_100026009 171
225 3300025941 Ga0207711_10010678 Ga0207711_100106787 171
226 3300025945 Ga0207679_10087564 Ga0207679_100875642 171
227 3300026023 Ga0207677_10093162 Ga0207677_100931622 171
228 3300026075 Ga0207708_10000091 Ga0207708_100000919 171
229 3300026095 Ga0207676_10007651 Ga0207676_1000765110 171
230 3300026095 Ga0207676_10795594 Ga0207676_107955942 171
231 3300026116 Ga0207674_10226957 Ga0207674_102269572 171
232 3300026118 Ga0207675_101164216 Ga0207675_1011642161 171
233 3300028654 Ga0265322_10013920 Ga0265322_100139203 171
234 3300031242 Ga0265329_10027413 Ga0265329_100274131 171
235 3300031344 Ga0265316_10021063 Ga0265316_100210636 171
236 3300031456 Ga0307513_10002993 Ga0307513_100029937 171
237 3300031712 Ga0265342_10073055 Ga0265342_100730553 171
238 3300031824 Ga0307413_10883529 Ga0307413_108835291 171
239 3300031852 Ga0307410_10514670 Ga0307410_105146701 171
240 3300031903 Ga0307407_10125100 Ga0307407_101251002 171
241 3300032002 Ga0307416_102181613 Ga0307416_1021816131 171
242 3300032126 Ga0307415_100489575 Ga0307415_1004895751 171
243 3300035691 Ga0373931_0019084 Ga0373931_0019084_854_1405 171
244 3300049514 Ga0501291_005582 Ga0501291_005582_281_805 171
245 3300049519 Ga0501296_023712 Ga0501296_023712_218_772 171
246 3300049521 Ga0501298_000185 Ga0501298_000185_431_955 171
247 3300049522 Ga0501299_026669 Ga0501299_026669_137_661 171
248 3300049664 Ga0501224_004394 Ga0501224_004394_1180_1704 171
249 3300049675 Ga0501243_018678 Ga0501243_018678_217_741 171
250 3300049689 Ga0501260_015891 Ga0501260_015891_235_759 171
251 3300049690 Ga0501261_060808 Ga0501261_060808_81_605 171
252 3300049705 Ga0501225_0028004 Ga0501225_0028004_775_1299 171
253 3300049705 Ga0501225_0083353 Ga0501225_0083353_164_718 171
254 3300049707 Ga0501234_012874 Ga0501234_012874_388_912 171
255 3300049779 Ga0501283_000449 Ga0501283_000449_2135_2659 171
256 3300049851 Ga0501212_011982 Ga0501212_011982_208_732 171
257 3300050510 nmdc:mga06r32_457189_c1 nmdc:mga06r32_457189_c1_253_774 171
258 3300050512 nmdc:mga0n895_154512_c1 nmdc:mga0n895_154512_c1_1313_1858 171
259 3300005618 Ga0068864_100167147 Ga0068864_1001671471 172
260 3300026075 Ga0207708_10190870 Ga0207708_101908702 172
261 3300026095 Ga0207676_10453324 Ga0207676_104533242 172
262 3300031344 Ga0265316_10388987 Ga0265316_103889871 172
263 3300049522 Ga0501299_057610 Ga0501299_057610_151_678 172
264 3300049661 Ga0501217_025920 Ga0501217_025920_802_1332 173
265 3300049665 Ga0501227_001994 Ga0501227_001994_1057_1587 173
266 3300049705 Ga0501225_0016133 Ga0501225_0016133_85_615 173
267 3300005458 Ga0070681_10494492 Ga0070681_104944922 174
268 3300005530 Ga0070679_100651165 Ga0070679_1006511652 174
269 3300005719 Ga0068861_101629937 Ga0068861_1016299371 174
270 3300026118 Ga0207675_101777652 Ga0207675_1017776521 174
271 3300042130 Ga0450892_011964 Ga0450892_011964_116_646 174
272 3300005617 Ga0068859_100742582 Ga0068859_1007425822 175
273 3300006931 Ga0097620_100742544 Ga0097620_1007425442 175
274 3300009148 Ga0105243_10111724 Ga0105243_101117243 175
275 3300009545 Ga0105237_10959684 Ga0105237_109596842 175
276 3300009551 Ga0105238_10023634 Ga0105238_100236345 175
277 3300014326 Ga0157380_10706456 Ga0157380_107064562 175
278 3300025315 Ga0207697_10166384 Ga0207697_101663842 175
279 3300025923 Ga0207681_10037919 Ga0207681_100379193 175
280 3300025924 Ga0207694_10001471 Ga0207694_1000147113 175
281 3300025935 Ga0207709_10019181 Ga0207709_100191813 175
282 3300053139 Ga0500568_0028605 Ga0500568_0028605_1743_2309 175
283 3300002459 JGI24751J29686_10000012 JGI24751J29686_1000001212 177
284 3300005331 Ga0070670_100000174 Ga0070670_10000017438 177
285 3300014325 Ga0163163_10000208 Ga0163163_1000020811 177
286 3300025925 Ga0207650_10000011 Ga0207650_10000011287 177

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nwj-assembly3.cif.gz_A crystal structure of shikimate kinase from arabidopsis thaliana (atsk2) 0.7176 2 102
3nwj-assembly3.cif.gz_B crystal structure of shikimate kinase from arabidopsis thaliana (atsk2) 0.6762 2 104
1ukz-assembly1.cif.gz_A substrate specificity and assembly of catalytic center derived from two structures of ligated uridylate kinase 0.6712 2 173
3fb4-assembly1.cif.gz_A crystal structure of adenylate kinase from marinibacillus marinus 0.6697 1 166
4cvn-assembly1.cif.gz_D structure of the fap7-rps14 complex 0.6694 4 166
ID Description Score Start End Superfamily
af_A0A1D6H6N6_28_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7268 1 97 3.40.50.300
af_Q7EYP9_5_180_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6808 1 172 3.40.50.300
3nwjB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6762 2 104 3.40.50.300
4cvnD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6694 4 166 3.40.50.300
af_Q5TCS8_1409_1601_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.666 2 167 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6I3QBT7-F1-model_v4 Adenylate kinase 0.9847 2 170 GO:0016301
AF-A0A0Q1CJ15-F1-model_v4 Adenylate kinase 0.9821 2 166 GO:0016301
AF-A0A1Z4S9T8-F1-model_v4 deleted 0.9811 6 168
AF-A0A2Y9BE67-F1-model_v4 Adenylate kinase family enzyme 0.9799 1 140 GO:0016301
AF-A0A6I5XGN0-F1-model_v4 deleted 0.9788 2 167

Feature Viewer

pLDDT pTM Quality
92.78 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map