F387398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 286 | 176 | 286 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10023634|Ga0105238_100236345 |
| Length | 203 |
| Sequence | VGAILVPFVTICHRLTQATGKHKKGFMRRVLVIGSGGSGKSTVAARLGELLGLEVNHLDKFYWRAGWVEPAQDEWIKTVEELMDRDSWVMDGNYSGTLELRLRKCDTVVFLDLPRVLCLWRIVKRFLLYRNGNRPDVAEGCPEKLDFEFVSWVWNYPRRSRPKVIKLLREHAGEKQIFRLRSRNEVKKFLASHQNAKKEHMND |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 77 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 117 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 118 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 128 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 129 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 133 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 134 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 135 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 136 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 137 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 138 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 139 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 140 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 143 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 145 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 146 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 147 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 148 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 149 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 150 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 154 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 155 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 156 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 157 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 158 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 159 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 160 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 161 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 162 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 163 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 164 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 170 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 171 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 172 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 173 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 174 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 175 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 176 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.94 |
| Nodule | 0 |
| Rhizoplane | 1.4 |
| Rhizosphere | 89.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000012 | 3300002459 | Bacteria | 115709 |
| 2 | JGI25406J46586_10000408 | 3300003203 | Bacteria | 19769 |
| 3 | JGI25153J46596_10000145 | 3300003215 | Bacteria | 72113 |
| 4 | rootH2_10031820 | 3300003320 | Unclassified | 3547 |
| 5 | rootL2_10225526 | 3300003322 | Unclassified | 2553 |
| 6 | Ga0055531_10004807 | 3300003794 | Bacteria | 8067 |
| 7 | Ga0065714_10023588 | 3300005288 | Bacteria | 2306 |
| 8 | Ga0065704_10256848 | 3300005289 | Bacteria | 975 |
| 9 | Ga0065712_10014942 | 3300005290 | Bacteria | 1532 |
| 10 | Ga0065715_10020811 | 3300005293 | Unclassified | 2152 |
| 11 | Ga0065715_10151092 | 3300005293 | Unclassified | 1715 |
| 12 | Ga0065715_10210023 | 3300005293 | Bacteria | 1318 |
| 13 | Ga0065707_10215494 | 3300005295 | Bacteria | 1247 |
| 14 | Ga0070690_100014306 | 3300005330 | Unclassified | 4707 |
| 15 | Ga0070670_100000174 | 3300005331 | Bacteria | 58017 |
| 16 | Ga0070670_100121146 | 3300005331 | Bacteria | 2257 |
| 17 | Ga0070670_100134854 | 3300005331 | Bacteria | 2133 |
| 18 | Ga0068869_100523505 | 3300005334 | Bacteria | 993 |
| 19 | Ga0068869_100595506 | 3300005334 | Unclassified | 933 |
| 20 | Ga0070666_10007065 | 3300005335 | Bacteria | 6918 |
| 21 | Ga0070666_10425728 | 3300005335 | Unclassified | 957 |
| 22 | Ga0068868_100003437 | 3300005338 | Bacteria | 11028 |
| 23 | Ga0070660_100754014 | 3300005339 | Bacteria | 817 |
| 24 | Ga0070689_100397973 | 3300005340 | Bacteria | 1163 |
| 25 | Ga0070692_10099936 | 3300005345 | Bacteria | 1589 |
| 26 | Ga0070692_10462057 | 3300005345 | Unclassified | 815 |
| 27 | Ga0070692_10598921 | 3300005345 | Unclassified | 729 |
| 28 | Ga0070673_100414864 | 3300005364 | Unclassified | 1206 |
| 29 | Ga0070659_100069651 | 3300005366 | Unclassified | 2793 |
| 30 | Ga0070701_10806764 | 3300005438 | Bacteria | 641 |
| 31 | Ga0070705_100097225 | 3300005440 | Unclassified | 1850 |
| 32 | Ga0070694_100002549 | 3300005444 | Bacteria | 10760 |
| 33 | Ga0070694_100122486 | 3300005444 | Bacteria | 1868 |
| 34 | Ga0070694_100282872 | 3300005444 | Bacteria | 1265 |
| 35 | Ga0070694_100336016 | 3300005444 | Bacteria | 1166 |
| 36 | Ga0070662_100095485 | 3300005457 | Bacteria | 2241 |
| 37 | Ga0070681_10018744 | 3300005458 | Bacteria | 6926 |
| 38 | Ga0070681_10494492 | 3300005458 | Unclassified | 1136 |
| 39 | Ga0068867_100460865 | 3300005459 | Bacteria | 1085 |
| 40 | Ga0068867_100545844 | 3300005459 | Unclassified | 1003 |
| 41 | Ga0070698_100257173 | 3300005471 | Bacteria | 1678 |
| 42 | Ga0070699_100273890 | 3300005518 | Bacteria | 1511 |
| 43 | Ga0070679_100651165 | 3300005530 | Unclassified | 996 |
| 44 | Ga0070684_100124156 | 3300005535 | Bacteria | 2324 |
| 45 | Ga0070684_100229421 | 3300005535 | Bacteria | 1695 |
| 46 | Ga0070672_100004122 | 3300005543 | Bacteria | 9486 |
| 47 | Ga0070695_100167957 | 3300005545 | Unclassified | 1546 |
| 48 | Ga0070695_100309796 | 3300005545 | Bacteria | 1170 |
| 49 | Ga0070695_100533056 | 3300005545 | Unclassified | 913 |
| 50 | Ga0070696_100060632 | 3300005546 | Unclassified | 2645 |
| 51 | Ga0070696_100135113 | 3300005546 | Unclassified | 1797 |
| 52 | Ga0070693_100160138 | 3300005547 | Unclassified | 1433 |
| 53 | Ga0070704_100037229 | 3300005549 | Unclassified | 3322 |
| 54 | Ga0070704_100420387 | 3300005549 | Bacteria | 1145 |
| 55 | Ga0070704_100494109 | 3300005549 | Bacteria | 1061 |
| 56 | Ga0070704_100947755 | 3300005549 | Unclassified | 776 |
| 57 | Ga0068855_100985696 | 3300005563 | Bacteria | 886 |
| 58 | Ga0070664_100004904 | 3300005564 | Bacteria | 10712 |
| 59 | Ga0070664_100102615 | 3300005564 | Bacteria | 2489 |
| 60 | Ga0070664_100278056 | 3300005564 | Bacteria | 1509 |
| 61 | Ga0068857_100531478 | 3300005577 | Bacteria | 1106 |
| 62 | Ga0068857_100631687 | 3300005577 | Bacteria | 1014 |
| 63 | Ga0068854_100133175 | 3300005578 | Bacteria | 1900 |
| 64 | Ga0068854_100185353 | 3300005578 | Unclassified | 1628 |
| 65 | Ga0068854_100307652 | 3300005578 | Bacteria | 1284 |
| 66 | Ga0068859_100002543 | 3300005617 | Bacteria | 18515 |
| 67 | Ga0068859_100100543 | 3300005617 | Unclassified | 2947 |
| 68 | Ga0068859_100135270 | 3300005617 | Bacteria | 2537 |
| 69 | Ga0068859_100512523 | 3300005617 | Bacteria | 1295 |
| 70 | Ga0068859_100742582 | 3300005617 | Unclassified | 1071 |
| 71 | Ga0068859_101030934 | 3300005617 | Unclassified | 904 |
| 72 | Ga0068864_100005294 | 3300005618 | Bacteria | 10560 |
| 73 | Ga0068864_100167147 | 3300005618 | Bacteria | 2003 |
| 74 | Ga0068864_100415687 | 3300005618 | Unclassified | 1280 |
| 75 | Ga0068864_100515029 | 3300005618 | Unclassified | 1153 |
| 76 | Ga0068864_100608722 | 3300005618 | Unclassified | 1061 |
| 77 | Ga0068864_101516966 | 3300005618 | Bacteria | 673 |
| 78 | Ga0068861_100108795 | 3300005719 | Bacteria | 2218 |
| 79 | Ga0068861_101396931 | 3300005719 | Bacteria | 684 |
| 80 | Ga0068861_101629937 | 3300005719 | Unclassified | 636 |
| 81 | Ga0068863_100015617 | 3300005841 | Bacteria | 7294 |
| 82 | Ga0068863_100140800 | 3300005841 | Bacteria | 2305 |
| 83 | Ga0068858_100100275 | 3300005842 | Bacteria | 2701 |
| 84 | Ga0068858_100163424 | 3300005842 | Unclassified | 2097 |
| 85 | Ga0068858_101051547 | 3300005842 | Bacteria | 798 |
| 86 | Ga0068860_100057808 | 3300005843 | Bacteria | 3687 |
| 87 | Ga0068860_100300843 | 3300005843 | Bacteria | 1571 |
| 88 | Ga0068862_100018426 | 3300005844 | Bacteria | 5814 |
| 89 | Ga0068862_100136897 | 3300005844 | Bacteria | 2171 |
| 90 | Ga0068862_100148709 | 3300005844 | Bacteria | 2084 |
| 91 | Ga0068862_100958429 | 3300005844 | Unclassified | 844 |
| 92 | Ga0081455_10421860 | 3300005937 | Bacteria | 920 |
| 93 | Ga0081539_10000033 | 3300005985 | Bacteria | 309306 |
| 94 | Ga0081539_10000612 | 3300005985 | Bacteria | 72310 |
| 95 | Ga0075428_100447497 | 3300006844 | Unclassified | 1384 |
| 96 | Ga0075434_100055595 | 3300006871 | Unclassified | 3933 |
| 97 | Ga0075434_100325716 | 3300006871 | Unclassified | 1557 |
| 98 | Ga0075434_101035466 | 3300006871 | Unclassified | 834 |
| 99 | Ga0097620_100002543 | 3300006931 | Bacteria | 18515 |
| 100 | Ga0097620_100100545 | 3300006931 | Unclassified | 2947 |
| 101 | Ga0097620_100135277 | 3300006931 | Bacteria | 2537 |
| 102 | Ga0097620_100226959 | 3300006931 | Bacteria | 1955 |
| 103 | Ga0097620_100512480 | 3300006931 | Bacteria | 1295 |
| 104 | Ga0097620_100742544 | 3300006931 | Unclassified | 1071 |
| 105 | Ga0097620_101031014 | 3300006931 | Unclassified | 904 |
| 106 | Ga0105240_10150282 | 3300009093 | Unclassified | 2775 |
| 107 | Ga0105240_11031793 | 3300009093 | Unclassified | 878 |
| 108 | Ga0105245_11919503 | 3300009098 | Unclassified | 645 |
| 109 | Ga0105247_10144203 | 3300009101 | Unclassified | 1563 |
| 110 | Ga0105247_10201043 | 3300009101 | Bacteria | 1339 |
| 111 | Ga0114129_10104234 | 3300009147 | Bacteria | 3919 |
| 112 | Ga0114129_12083423 | 3300009147 | Unclassified | 685 |
| 113 | Ga0105243_10111724 | 3300009148 | Bacteria | 2288 |
| 114 | Ga0105243_10429771 | 3300009148 | Bacteria | 1234 |
| 115 | Ga0105241_10353503 | 3300009174 | Bacteria | 1276 |
| 116 | Ga0105241_10377588 | 3300009174 | Bacteria | 1237 |
| 117 | Ga0105241_10478056 | 3300009174 | Unclassified | 1107 |
| 118 | Ga0105241_10680041 | 3300009174 | Unclassified | 937 |
| 119 | Ga0105242_10408221 | 3300009176 | Bacteria | 1269 |
| 120 | Ga0105248_10008746 | 3300009177 | Bacteria | 11121 |
| 121 | Ga0105248_10198578 | 3300009177 | Bacteria | 2260 |
| 122 | Ga0105248_10886256 | 3300009177 | Bacteria | 1007 |
| 123 | Ga0105237_10104163 | 3300009545 | Bacteria | 2829 |
| 124 | Ga0105237_10959684 | 3300009545 | Bacteria | 862 |
| 125 | Ga0105238_10023634 | 3300009551 | Bacteria | 6262 |
| 126 | Ga0105249_10093523 | 3300009553 | Unclassified | 2816 |
| 127 | Ga0105239_10347251 | 3300010375 | Bacteria | 1675 |
| 128 | Ga0105239_10951608 | 3300010375 | Bacteria | 986 |
| 129 | Ga0157373_10155500 | 3300013100 | Bacteria | 1609 |
| 130 | Ga0157373_10357084 | 3300013100 | Bacteria | 1043 |
| 131 | Ga0157374_11925059 | 3300013296 | Unclassified | 617 |
| 132 | Ga0157378_12045993 | 3300013297 | Unclassified | 623 |
| 133 | Ga0163162_10309348 | 3300013306 | Bacteria | 1712 |
| 134 | Ga0163162_10527990 | 3300013306 | Bacteria | 1309 |
| 135 | Ga0157372_11832488 | 3300013307 | Unclassified | 698 |
| 136 | Ga0157372_12290788 | 3300013307 | Bacteria | 620 |
| 137 | Ga0157375_10509157 | 3300013308 | Bacteria | 1368 |
| 138 | Ga0157375_12064630 | 3300013308 | Unclassified | 678 |
| 139 | Ga0163163_10000208 | 3300014325 | Bacteria | 60820 |
| 140 | Ga0157380_10706456 | 3300014326 | Bacteria | 1014 |
| 141 | Ga0157379_10076863 | 3300014968 | Bacteria | 2989 |
| 142 | Ga0157379_10170551 | 3300014968 | Unclassified | 1964 |
| 143 | Ga0157376_10006613 | 3300014969 | Bacteria | 8203 |
| 144 | Ga0182007_10065948 | 3300015262 | Bacteria | 1186 |
| 145 | Ga0213876_10000209 | 3300021384 | Bacteria | 58910 |
| 146 | Ga0209758_1000060 | 3300025297 | Bacteria | 324326 |
| 147 | Ga0209758_1066641 | 3300025297 | Bacteria | 1155 |
| 148 | Ga0209050_1005532 | 3300025298 | Bacteria | 7893 |
| 149 | Ga0209051_1011765 | 3300025303 | Bacteria | 4290 |
| 150 | Ga0209257_1001302 | 3300025304 | Bacteria | 30372 |
| 151 | Ga0209257_1042142 | 3300025304 | Bacteria | 1349 |
| 152 | Ga0207697_10166384 | 3300025315 | Bacteria | 963 |
| 153 | Ga0207647_10026308 | 3300025904 | Unclassified | 3809 |
| 154 | Ga0207647_10382874 | 3300025904 | Unclassified | 794 |
| 155 | Ga0207643_10335066 | 3300025908 | Bacteria | 947 |
| 156 | Ga0207707_10003034 | 3300025912 | Bacteria | 14927 |
| 157 | Ga0207660_10249409 | 3300025917 | Unclassified | 1401 |
| 158 | Ga0207681_10037919 | 3300025923 | Bacteria | 3189 |
| 159 | Ga0207694_10001471 | 3300025924 | Bacteria | 20135 |
| 160 | Ga0207650_10000011 | 3300025925 | Bacteria | 450115 |
| 161 | Ga0207650_10018655 | 3300025925 | Unclassified | 4869 |
| 162 | Ga0207650_10405723 | 3300025925 | Bacteria | 1129 |
| 163 | Ga0207650_10466306 | 3300025925 | Bacteria | 1052 |
| 164 | Ga0207650_10568743 | 3300025925 | Bacteria | 951 |
| 165 | Ga0207650_10725727 | 3300025925 | Unclassified | 840 |
| 166 | Ga0207690_10213400 | 3300025932 | Bacteria | 1473 |
| 167 | Ga0207706_10177931 | 3300025933 | Bacteria | 1868 |
| 168 | Ga0207686_10497956 | 3300025934 | Unclassified | 945 |
| 169 | Ga0207709_10019181 | 3300025935 | Bacteria | 3841 |
| 170 | Ga0207709_10381581 | 3300025935 | Unclassified | 1073 |
| 171 | Ga0207670_10535918 | 3300025936 | Bacteria | 955 |
| 172 | Ga0207670_10662077 | 3300025936 | Unclassified | 862 |
| 173 | Ga0207691_10010672 | 3300025940 | Bacteria | 8817 |
| 174 | Ga0207691_10646465 | 3300025940 | Bacteria | 894 |
| 175 | Ga0207711_10002600 | 3300025941 | Bacteria | 16036 |
| 176 | Ga0207711_10010678 | 3300025941 | Bacteria | 7636 |
| 177 | Ga0207711_10232636 | 3300025941 | Bacteria | 1688 |
| 178 | Ga0207689_10084801 | 3300025942 | Unclassified | 2604 |
| 179 | Ga0207689_10589358 | 3300025942 | Bacteria | 935 |
| 180 | Ga0207679_10087564 | 3300025945 | Unclassified | 2398 |
| 181 | Ga0207679_10369043 | 3300025945 | Bacteria | 1256 |
| 182 | Ga0207679_10511852 | 3300025945 | Unclassified | 1072 |
| 183 | Ga0207679_10537536 | 3300025945 | Unclassified | 1047 |
| 184 | Ga0207667_10460366 | 3300025949 | Bacteria | 1292 |
| 185 | Ga0207651_10792666 | 3300025960 | Unclassified | 840 |
| 186 | Ga0207712_10190574 | 3300025961 | Bacteria | 1618 |
| 187 | Ga0207668_10109581 | 3300025972 | Bacteria | 2069 |
| 188 | Ga0207640_10148337 | 3300025981 | Bacteria | 1720 |
| 189 | Ga0207640_10274628 | 3300025981 | Bacteria | 1320 |
| 190 | Ga0207677_10093162 | 3300026023 | Bacteria | 2195 |
| 191 | Ga0207703_10311666 | 3300026035 | Bacteria | 1439 |
| 192 | Ga0207703_11036709 | 3300026035 | Bacteria | 787 |
| 193 | Ga0207703_11862713 | 3300026035 | Unclassified | 578 |
| 194 | Ga0207708_10000091 | 3300026075 | Bacteria | 71484 |
| 195 | Ga0207708_10190870 | 3300026075 | Bacteria | 1631 |
| 196 | Ga0207708_10282602 | 3300026075 | Unclassified | 1345 |
| 197 | Ga0207641_10161938 | 3300026088 | Bacteria | 2035 |
| 198 | Ga0207648_10102457 | 3300026089 | Bacteria | 2509 |
| 199 | Ga0207676_10007651 | 3300026095 | Bacteria | 7669 |
| 200 | Ga0207676_10453324 | 3300026095 | Bacteria | 1209 |
| 201 | Ga0207676_10795594 | 3300026095 | Unclassified | 922 |
| 202 | Ga0207674_10226957 | 3300026116 | Bacteria | 1815 |
| 203 | Ga0207674_10487962 | 3300026116 | Bacteria | 1191 |
| 204 | Ga0207674_10566455 | 3300026116 | Bacteria | 1097 |
| 205 | Ga0207675_100634793 | 3300026118 | Bacteria | 1073 |
| 206 | Ga0207675_101164216 | 3300026118 | Unclassified | 791 |
| 207 | Ga0207675_101777652 | 3300026118 | Unclassified | 636 |
| 208 | Ga0268266_10606697 | 3300028379 | Bacteria | 1052 |
| 209 | Ga0268265_10031452 | 3300028380 | Bacteria | 3832 |
| 210 | Ga0268265_11778140 | 3300028380 | Unclassified | 623 |
| 211 | Ga0265322_10013920 | 3300028654 | Bacteria | 2328 |
| 212 | Ga0265329_10027413 | 3300031242 | Bacteria | 1872 |
| 213 | Ga0265316_10021063 | 3300031344 | Bacteria | 5532 |
| 214 | Ga0265316_10388987 | 3300031344 | Unclassified | 1005 |
| 215 | Ga0307513_10002993 | 3300031456 | Bacteria | 23041 |
| 216 | Ga0307508_10106593 | 3300031616 | Bacteria | 2401 |
| 217 | Ga0265342_10073055 | 3300031712 | Bacteria | 1995 |
| 218 | Ga0307516_10387578 | 3300031730 | Bacteria | 1058 |
| 219 | Ga0307405_10285872 | 3300031731 | Bacteria | 1244 |
| 220 | Ga0307413_10511665 | 3300031824 | Unclassified | 966 |
| 221 | Ga0307413_10883529 | 3300031824 | Unclassified | 758 |
| 222 | Ga0307410_10514670 | 3300031852 | Unclassified | 987 |
| 223 | Ga0307406_10652334 | 3300031901 | Unclassified | 874 |
| 224 | Ga0307407_10125100 | 3300031903 | Unclassified | 1636 |
| 225 | Ga0307409_100324608 | 3300031995 | Bacteria | 1442 |
| 226 | Ga0307416_100498680 | 3300032002 | Bacteria | 1281 |
| 227 | Ga0307416_102181613 | 3300032002 | Unclassified | 655 |
| 228 | Ga0307411_10035237 | 3300032005 | Bacteria | 3123 |
| 229 | Ga0307415_100089390 | 3300032126 | Bacteria | 2225 |
| 230 | Ga0307415_100489575 | 3300032126 | Unclassified | 1073 |
| 231 | Ga0373931_0019084 | 3300035691 | Unclassified | 3418 |
| 232 | Ga0242420_001268 | 3300038996 | Bacteria | 3317 |
| 233 | Ga0436365_0039241 | 3300039437 | Bacteria | 90885 |
| 234 | Ga0439455_0013404 | 3300042012 | Bacteria | 1856 |
| 235 | Ga0450890_025784 | 3300042127 | Bacteria | 817 |
| 236 | Ga0450892_011964 | 3300042130 | Unclassified | 776 |
| 237 | Ga0439458_0005424 | 3300042157 | Bacteria | 2868 |
| 238 | Ga0453684_0015762 | 3300044712 | Bacteria | 11898 |
| 239 | Ga0466957_0277231 | 3300044842 | Bacteria | 1121 |
| 240 | Ga0466960_0320125 | 3300044901 | Bacteria | 878 |
| 241 | Ga0451576_0274664 | 3300045051 | Bacteria | 1762 |
| 242 | Ga0495592_0011757 | 3300046454 | Bacteria | 6631 |
| 243 | Ga0495632_0057935 | 3300046519 | Bacteria | 1889 |
| 244 | Ga0496106_0033416 | 3300048909 | Bacteria | 3838 |
| 245 | Ga0496108_0016303 | 3300048911 | Bacteria | 6061 |
| 246 | Ga0496112_0082107 | 3300048915 | Bacteria | 3188 |
| 247 | Ga0496112_0274327 | 3300048915 | Bacteria | 1634 |
| 248 | Ga0496121_0102057 | 3300048924 | Bacteria | 2211 |
| 249 | Ga0501291_005582 | 3300049514 | Unclassified | 1650 |
| 250 | Ga0501296_023712 | 3300049519 | Unclassified | 796 |
| 251 | Ga0501298_000185 | 3300049521 | Bacteria | 7784 |
| 252 | Ga0501299_026669 | 3300049522 | Unclassified | 1093 |
| 253 | Ga0501299_057610 | 3300049522 | Bacteria | 816 |
| 254 | Ga0501072_0007245 | 3300049588 | Bacteria | 8420 |
| 255 | Ga0501076_0981757 | 3300049592 | Bacteria | 696 |
| 256 | Ga0501077_0385935 | 3300049593 | Bacteria | 895 |
| 257 | Ga0501207_108430 | 3300049654 | Unclassified | 565 |
| 258 | Ga0501217_025920 | 3300049661 | Bacteria | 1414 |
| 259 | Ga0501217_248594 | 3300049661 | Bacteria | 572 |
| 260 | Ga0501224_004394 | 3300049664 | Unclassified | 2004 |
| 261 | Ga0501227_001994 | 3300049665 | Bacteria | 4532 |
| 262 | Ga0501236_064179 | 3300049670 | Unclassified | 658 |
| 263 | Ga0501243_018678 | 3300049675 | Unclassified | 1131 |
| 264 | Ga0501260_015891 | 3300049689 | Unclassified | 788 |
| 265 | Ga0501261_060808 | 3300049690 | Unclassified | 641 |
| 266 | Ga0501225_0016133 | 3300049705 | Bacteria | 2078 |
| 267 | Ga0501225_0028004 | 3300049705 | Unclassified | 1549 |
| 268 | Ga0501225_0041113 | 3300049705 | Bacteria | 1275 |
| 269 | Ga0501225_0083353 | 3300049705 | Unclassified | 920 |
| 270 | Ga0501234_012874 | 3300049707 | Unclassified | 1312 |
| 271 | Ga0501283_000449 | 3300049779 | Bacteria | 5431 |
| 272 | Ga0501212_011982 | 3300049851 | Unclassified | 1256 |
| 273 | nmdc:mga05p37_128384_c1 | 3300050507 | Bacteria | 3112 |
| 274 | nmdc:mga06r32_457189_c1 | 3300050510 | Unclassified | 1256 |
| 275 | nmdc:mga0n895_10109_c1 | 3300050512 | Bacteria | 8307 |
| 276 | nmdc:mga0n895_154512_c1 | 3300050512 | Unclassified | 2325 |
| 277 | nmdc:mga0a205_76618_c1 | 3300050515 | Bacteria | 3232 |
| 278 | Ga0500646_0339368 | 3300053090 | Bacteria | 546 |
| 279 | Ga0500651_0642539 | 3300053093 | Bacteria | 572 |
| 280 | Ga0500555_006606 | 3300053103 | Bacteria | 3298 |
| 281 | Ga0500594_0018973 | 3300053118 | Bacteria | 1700 |
| 282 | Ga0500642_0004697 | 3300053130 | Bacteria | 4312 |
| 283 | Ga0500642_0168507 | 3300053130 | Bacteria | 1025 |
| 284 | Ga0500568_0028605 | 3300053139 | Bacteria | 2322 |
| 285 | Ga0500577_0007821 | 3300053142 | Bacteria | 3014 |
| 286 | Ga0500609_001512 | 3300053731 | Bacteria | 3403 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049670 | Ga0501236_064179 | Ga0501236_064179_174_641 | 142 |
| 2 | 3300005331 | Ga0070670_100134854 | Ga0070670_1001348543 | 151 |
| 3 | 3300005564 | Ga0070664_100102615 | Ga0070664_1001026152 | 151 |
| 4 | 3300025925 | Ga0207650_10405723 | Ga0207650_104057232 | 151 |
| 5 | 3300025945 | Ga0207679_10369043 | Ga0207679_103690432 | 151 |
| 6 | 3300026075 | Ga0207708_10282602 | Ga0207708_102826022 | 152 |
| 7 | 3300003215 | JGI25153J46596_10000145 | JGI25153J46596_1000014531 | 163 |
| 8 | 3300003322 | rootL2_10225526 | rootL2_102255262 | 163 |
| 9 | 3300003794 | Ga0055531_10004807 | Ga0055531_100048074 | 163 |
| 10 | 3300005844 | Ga0068862_100018426 | Ga0068862_1000184265 | 163 |
| 11 | 3300005937 | Ga0081455_10421860 | Ga0081455_104218602 | 163 |
| 12 | 3300025297 | Ga0209758_1000060 | Ga0209758_1000060119 | 163 |
| 13 | 3300025297 | Ga0209758_1066641 | Ga0209758_10666412 | 163 |
| 14 | 3300025298 | Ga0209050_1005532 | Ga0209050_10055328 | 163 |
| 15 | 3300025303 | Ga0209051_1011765 | Ga0209051_10117653 | 163 |
| 16 | 3300025304 | Ga0209257_1001302 | Ga0209257_100130221 | 163 |
| 17 | 3300025304 | Ga0209257_1042142 | Ga0209257_10421422 | 163 |
| 18 | 3300028379 | Ga0268266_10606697 | Ga0268266_106066972 | 163 |
| 19 | 3300028380 | Ga0268265_10031452 | Ga0268265_100314523 | 163 |
| 20 | 3300031730 | Ga0307516_10387578 | Ga0307516_103875782 | 163 |
| 21 | 3300053090 | Ga0500646_0339368 | Ga0500646_0339368_13_534 | 163 |
| 22 | 3300053093 | Ga0500651_0642539 | Ga0500651_0642539_32_544 | 163 |
| 23 | 3300053103 | Ga0500555_006606 | Ga0500555_006606_2689_3210 | 163 |
| 24 | 3300053118 | Ga0500594_0018973 | Ga0500594_0018973_128_649 | 163 |
| 25 | 3300053130 | Ga0500642_0004697 | Ga0500642_0004697_3073_3594 | 163 |
| 26 | 3300053130 | Ga0500642_0168507 | Ga0500642_0168507_77_598 | 163 |
| 27 | 3300053142 | Ga0500577_0007821 | Ga0500577_0007821_249_764 | 163 |
| 28 | 3300053731 | Ga0500609_001512 | Ga0500609_001512_2734_3255 | 163 |
| 29 | 3300005549 | Ga0070704_100947755 | Ga0070704_1009477551 | 164 |
| 30 | 3300025972 | Ga0207668_10109581 | Ga0207668_101095813 | 164 |
| 31 | 3300005330 | Ga0070690_100014306 | Ga0070690_1000143062 | 165 |
| 32 | 3300005335 | Ga0070666_10425728 | Ga0070666_104257281 | 165 |
| 33 | 3300005457 | Ga0070662_100095485 | Ga0070662_1000954852 | 165 |
| 34 | 3300005459 | Ga0068867_100545844 | Ga0068867_1005458441 | 165 |
| 35 | 3300009553 | Ga0105249_10093523 | Ga0105249_100935232 | 165 |
| 36 | 3300013306 | Ga0163162_10309348 | Ga0163162_103093482 | 165 |
| 37 | 3300014969 | Ga0157376_10006613 | Ga0157376_100066134 | 165 |
| 38 | 3300025908 | Ga0207643_10335066 | Ga0207643_103350661 | 165 |
| 39 | 3300025917 | Ga0207660_10249409 | Ga0207660_102494091 | 165 |
| 40 | 3300025933 | Ga0207706_10177931 | Ga0207706_101779312 | 165 |
| 41 | 3300025961 | Ga0207712_10190574 | Ga0207712_101905741 | 165 |
| 42 | 3300044712 | Ga0453684_0015762 | Ga0453684_0015762_815_1324 | 165 |
| 43 | 3300044842 | Ga0466957_0277231 | Ga0466957_0277231_80_607 | 165 |
| 44 | 3300048924 | Ga0496121_0102057 | Ga0496121_0102057_959_1492 | 165 |
| 45 | 3300005289 | Ga0065704_10256848 | Ga0065704_102568482 | 166 |
| 46 | 3300005295 | Ga0065707_10215494 | Ga0065707_102154942 | 166 |
| 47 | 3300005578 | Ga0068854_100307652 | Ga0068854_1003076522 | 166 |
| 48 | 3300005618 | Ga0068864_100608722 | Ga0068864_1006087222 | 166 |
| 49 | 3300005843 | Ga0068860_100057808 | Ga0068860_1000578084 | 166 |
| 50 | 3300014968 | Ga0157379_10076863 | Ga0157379_100768634 | 166 |
| 51 | 3300021384 | Ga0213876_10000209 | Ga0213876_1000020923 | 166 |
| 52 | 3300025936 | Ga0207670_10662077 | Ga0207670_106620772 | 166 |
| 53 | 3300025981 | Ga0207640_10274628 | Ga0207640_102746282 | 166 |
| 54 | 3300026088 | Ga0207641_10161938 | Ga0207641_101619383 | 166 |
| 55 | 3300031901 | Ga0307406_10652334 | Ga0307406_106523342 | 166 |
| 56 | 3300039437 | Ga0436365_0039241 | Ga0436365_0039241_65440_65946 | 166 |
| 57 | 3300044901 | Ga0466960_0320125 | Ga0466960_0320125_165_680 | 166 |
| 58 | 3300046454 | Ga0495592_0011757 | Ga0495592_0011757_5494_6000 | 166 |
| 59 | 3300049588 | Ga0501072_0007245 | Ga0501072_0007245_136_642 | 166 |
| 60 | 3300049654 | Ga0501207_108430 | Ga0501207_108430_45_551 | 166 |
| 61 | 3300049661 | Ga0501217_248594 | Ga0501217_248594_25_531 | 166 |
| 62 | 3300005293 | Ga0065715_10151092 | Ga0065715_101510923 | 167 |
| 63 | 3300005293 | Ga0065715_10210023 | Ga0065715_102100232 | 167 |
| 64 | 3300005334 | Ga0068869_100595506 | Ga0068869_1005955062 | 167 |
| 65 | 3300005345 | Ga0070692_10099936 | Ga0070692_100999361 | 167 |
| 66 | 3300005345 | Ga0070692_10462057 | Ga0070692_104620571 | 167 |
| 67 | 3300005345 | Ga0070692_10598921 | Ga0070692_105989211 | 167 |
| 68 | 3300005364 | Ga0070673_100414864 | Ga0070673_1004148642 | 167 |
| 69 | 3300005440 | Ga0070705_100097225 | Ga0070705_1000972252 | 167 |
| 70 | 3300005444 | Ga0070694_100002549 | Ga0070694_1000025498 | 167 |
| 71 | 3300005444 | Ga0070694_100122486 | Ga0070694_1001224863 | 167 |
| 72 | 3300005444 | Ga0070694_100282872 | Ga0070694_1002828722 | 167 |
| 73 | 3300005458 | Ga0070681_10018744 | Ga0070681_100187446 | 167 |
| 74 | 3300005545 | Ga0070695_100167957 | Ga0070695_1001679572 | 167 |
| 75 | 3300005545 | Ga0070695_100309796 | Ga0070695_1003097962 | 167 |
| 76 | 3300005545 | Ga0070695_100533056 | Ga0070695_1005330562 | 167 |
| 77 | 3300005546 | Ga0070696_100060632 | Ga0070696_1000606321 | 167 |
| 78 | 3300005546 | Ga0070696_100135113 | Ga0070696_1001351132 | 167 |
| 79 | 3300005547 | Ga0070693_100160138 | Ga0070693_1001601382 | 167 |
| 80 | 3300005549 | Ga0070704_100037229 | Ga0070704_1000372292 | 167 |
| 81 | 3300005563 | Ga0068855_100985696 | Ga0068855_1009856962 | 167 |
| 82 | 3300005577 | Ga0068857_100531478 | Ga0068857_1005314782 | 167 |
| 83 | 3300005578 | Ga0068854_100133175 | Ga0068854_1001331753 | 167 |
| 84 | 3300005617 | Ga0068859_100512523 | Ga0068859_1005125232 | 167 |
| 85 | 3300005618 | Ga0068864_100415687 | Ga0068864_1004156872 | 167 |
| 86 | 3300005618 | Ga0068864_101516966 | Ga0068864_1015169662 | 167 |
| 87 | 3300005841 | Ga0068863_100140800 | Ga0068863_1001408003 | 167 |
| 88 | 3300005842 | Ga0068858_100100275 | Ga0068858_1001002754 | 167 |
| 89 | 3300006931 | Ga0097620_100226959 | Ga0097620_1002269592 | 167 |
| 90 | 3300006931 | Ga0097620_100512480 | Ga0097620_1005124802 | 167 |
| 91 | 3300009093 | Ga0105240_10150282 | Ga0105240_101502821 | 167 |
| 92 | 3300009098 | Ga0105245_11919503 | Ga0105245_119195031 | 167 |
| 93 | 3300009147 | Ga0114129_10104234 | Ga0114129_101042345 | 167 |
| 94 | 3300009174 | Ga0105241_10353503 | Ga0105241_103535032 | 167 |
| 95 | 3300009174 | Ga0105241_10680041 | Ga0105241_106800411 | 167 |
| 96 | 3300009545 | Ga0105237_10104163 | Ga0105237_101041634 | 167 |
| 97 | 3300010375 | Ga0105239_10347251 | Ga0105239_103472512 | 167 |
| 98 | 3300013100 | Ga0157373_10357084 | Ga0157373_103570843 | 167 |
| 99 | 3300013307 | Ga0157372_11832488 | Ga0157372_118324882 | 167 |
| 100 | 3300013307 | Ga0157372_12290788 | Ga0157372_122907881 | 167 |
| 101 | 3300014968 | Ga0157379_10170551 | Ga0157379_101705512 | 167 |
| 102 | 3300025904 | Ga0207647_10026308 | Ga0207647_100263083 | 167 |
| 103 | 3300025912 | Ga0207707_10003034 | Ga0207707_1000303412 | 167 |
| 104 | 3300025925 | Ga0207650_10466306 | Ga0207650_104663062 | 167 |
| 105 | 3300025934 | Ga0207686_10497956 | Ga0207686_104979562 | 167 |
| 106 | 3300025942 | Ga0207689_10084801 | Ga0207689_100848014 | 167 |
| 107 | 3300025942 | Ga0207689_10589358 | Ga0207689_105893582 | 167 |
| 108 | 3300025949 | Ga0207667_10460366 | Ga0207667_104603663 | 167 |
| 109 | 3300025960 | Ga0207651_10792666 | Ga0207651_107926662 | 167 |
| 110 | 3300025981 | Ga0207640_10148337 | Ga0207640_101483373 | 167 |
| 111 | 3300026035 | Ga0207703_11862713 | Ga0207703_118627131 | 167 |
| 112 | 3300026116 | Ga0207674_10566455 | Ga0207674_105664552 | 167 |
| 113 | 3300028380 | Ga0268265_11778140 | Ga0268265_117781401 | 167 |
| 114 | 3300038996 | Ga0242420_001268 | Ga0242420_001268_1548_2057 | 167 |
| 115 | 3300042012 | Ga0439455_0013404 | Ga0439455_0013404_801_1310 | 167 |
| 116 | 3300042127 | Ga0450890_025784 | Ga0450890_025784_200_709 | 167 |
| 117 | 3300042157 | Ga0439458_0005424 | Ga0439458_0005424_118_627 | 167 |
| 118 | 3300045051 | Ga0451576_0274664 | Ga0451576_0274664_1100_1609 | 167 |
| 119 | 3300048909 | Ga0496106_0033416 | Ga0496106_0033416_2321_2830 | 167 |
| 120 | 3300048911 | Ga0496108_0016303 | Ga0496108_0016303_3855_4364 | 167 |
| 121 | 3300049592 | Ga0501076_0981757 | Ga0501076_0981757_116_625 | 167 |
| 122 | 3300049593 | Ga0501077_0385935 | Ga0501077_0385935_27_536 | 167 |
| 123 | 3300050507 | nmdc:mga05p37_128384_c1 | nmdc:mga05p37_128384_c1_462_971 | 167 |
| 124 | 3300005459 | Ga0068867_100460865 | Ga0068867_1004608652 | 168 |
| 125 | 3300013100 | Ga0157373_10155500 | Ga0157373_101555001 | 168 |
| 126 | 3300013297 | Ga0157378_12045993 | Ga0157378_120459932 | 168 |
| 127 | 3300015262 | Ga0182007_10065948 | Ga0182007_100659482 | 168 |
| 128 | 3300026035 | Ga0207703_10311666 | Ga0207703_103116661 | 168 |
| 129 | 3300046519 | Ga0495632_0057935 | Ga0495632_0057935_1128_1640 | 168 |
| 130 | 3300048915 | Ga0496112_0082107 | Ga0496112_0082107_1252_1764 | 168 |
| 131 | 3300005334 | Ga0068869_100523505 | Ga0068869_1005235052 | 169 |
| 132 | 3300005340 | Ga0070689_100397973 | Ga0070689_1003979731 | 169 |
| 133 | 3300005438 | Ga0070701_10806764 | Ga0070701_108067641 | 169 |
| 134 | 3300005518 | Ga0070699_100273890 | Ga0070699_1002738903 | 169 |
| 135 | 3300005549 | Ga0070704_100420387 | Ga0070704_1004203872 | 169 |
| 136 | 3300005564 | Ga0070664_100278056 | Ga0070664_1002780563 | 169 |
| 137 | 3300005617 | Ga0068859_101030934 | Ga0068859_1010309342 | 169 |
| 138 | 3300005719 | Ga0068861_101396931 | Ga0068861_1013969311 | 169 |
| 139 | 3300005842 | Ga0068858_101051547 | Ga0068858_1010515472 | 169 |
| 140 | 3300005843 | Ga0068860_100300843 | Ga0068860_1003008433 | 169 |
| 141 | 3300005844 | Ga0068862_100148709 | Ga0068862_1001487092 | 169 |
| 142 | 3300006871 | Ga0075434_100325716 | Ga0075434_1003257163 | 169 |
| 143 | 3300006931 | Ga0097620_101031014 | Ga0097620_1010310141 | 169 |
| 144 | 3300009093 | Ga0105240_11031793 | Ga0105240_110317932 | 169 |
| 145 | 3300009101 | Ga0105247_10144203 | Ga0105247_101442032 | 169 |
| 146 | 3300009174 | Ga0105241_10478056 | Ga0105241_104780562 | 169 |
| 147 | 3300009176 | Ga0105242_10408221 | Ga0105242_104082212 | 169 |
| 148 | 3300009177 | Ga0105248_10886256 | Ga0105248_108862562 | 169 |
| 149 | 3300025904 | Ga0207647_10382874 | Ga0207647_103828742 | 169 |
| 150 | 3300025936 | Ga0207670_10535918 | Ga0207670_105359182 | 169 |
| 151 | 3300025945 | Ga0207679_10511852 | Ga0207679_105118522 | 169 |
| 152 | 3300025945 | Ga0207679_10537536 | Ga0207679_105375362 | 169 |
| 153 | 3300026035 | Ga0207703_11036709 | Ga0207703_110367092 | 169 |
| 154 | 3300026089 | Ga0207648_10102457 | Ga0207648_101024572 | 169 |
| 155 | 3300026118 | Ga0207675_100634793 | Ga0207675_1006347932 | 169 |
| 156 | 3300031731 | Ga0307405_10285872 | Ga0307405_102858723 | 169 |
| 157 | 3300032002 | Ga0307416_100498680 | Ga0307416_1004986802 | 169 |
| 158 | 3300032126 | Ga0307415_100089390 | Ga0307415_1000893903 | 169 |
| 159 | 3300048915 | Ga0496112_0274327 | Ga0496112_0274327_647_1162 | 169 |
| 160 | 3300050512 | nmdc:mga0n895_10109_c1 | nmdc:mga0n895_10109_c1_3574_4161 | 169 |
| 161 | 3300050515 | nmdc:mga0a205_76618_c1 | nmdc:mga0a205_76618_c1_2168_2686 | 169 |
| 162 | 3300003203 | JGI25406J46586_10000408 | JGI25406J46586_1000040810 | 170 |
| 163 | 3300003320 | rootH2_10031820 | rootH2_100318204 | 170 |
| 164 | 3300005288 | Ga0065714_10023588 | Ga0065714_100235883 | 170 |
| 165 | 3300005290 | Ga0065712_10014942 | Ga0065712_100149422 | 170 |
| 166 | 3300005293 | Ga0065715_10020811 | Ga0065715_100208113 | 170 |
| 167 | 3300005331 | Ga0070670_100121146 | Ga0070670_1001211464 | 170 |
| 168 | 3300005842 | Ga0068858_100163424 | Ga0068858_1001634242 | 170 |
| 169 | 3300005985 | Ga0081539_10000612 | Ga0081539_1000061216 | 170 |
| 170 | 3300009174 | Ga0105241_10377588 | Ga0105241_103775882 | 170 |
| 171 | 3300009177 | Ga0105248_10198578 | Ga0105248_101985782 | 170 |
| 172 | 3300010375 | Ga0105239_10951608 | Ga0105239_109516081 | 170 |
| 173 | 3300013306 | Ga0163162_10527990 | Ga0163162_105279902 | 170 |
| 174 | 3300013308 | Ga0157375_10509157 | Ga0157375_105091572 | 170 |
| 175 | 3300025925 | Ga0207650_10725727 | Ga0207650_107257271 | 170 |
| 176 | 3300025941 | Ga0207711_10232636 | Ga0207711_102326362 | 170 |
| 177 | 3300026116 | Ga0207674_10487962 | Ga0207674_104879622 | 170 |
| 178 | 3300031616 | Ga0307508_10106593 | Ga0307508_101065933 | 170 |
| 179 | 3300031824 | Ga0307413_10511665 | Ga0307413_105116652 | 170 |
| 180 | 3300031995 | Ga0307409_100324608 | Ga0307409_1003246082 | 170 |
| 181 | 3300032005 | Ga0307411_10035237 | Ga0307411_100352372 | 170 |
| 182 | 3300049705 | Ga0501225_0041113 | Ga0501225_0041113_690_1208 | 170 |
| 183 | 3300005335 | Ga0070666_10007065 | Ga0070666_100070655 | 171 |
| 184 | 3300005338 | Ga0068868_100003437 | Ga0068868_10000343710 | 171 |
| 185 | 3300005339 | Ga0070660_100754014 | Ga0070660_1007540142 | 171 |
| 186 | 3300005366 | Ga0070659_100069651 | Ga0070659_1000696513 | 171 |
| 187 | 3300005444 | Ga0070694_100336016 | Ga0070694_1003360162 | 171 |
| 188 | 3300005471 | Ga0070698_100257173 | Ga0070698_1002571732 | 171 |
| 189 | 3300005535 | Ga0070684_100124156 | Ga0070684_1001241562 | 171 |
| 190 | 3300005535 | Ga0070684_100229421 | Ga0070684_1002294212 | 171 |
| 191 | 3300005543 | Ga0070672_100004122 | Ga0070672_1000041227 | 171 |
| 192 | 3300005549 | Ga0070704_100494109 | Ga0070704_1004941092 | 171 |
| 193 | 3300005564 | Ga0070664_100004904 | Ga0070664_1000049046 | 171 |
| 194 | 3300005577 | Ga0068857_100631687 | Ga0068857_1006316872 | 171 |
| 195 | 3300005578 | Ga0068854_100185353 | Ga0068854_1001853532 | 171 |
| 196 | 3300005617 | Ga0068859_100002543 | Ga0068859_1000025439 | 171 |
| 197 | 3300005617 | Ga0068859_100100543 | Ga0068859_1001005433 | 171 |
| 198 | 3300005617 | Ga0068859_100135270 | Ga0068859_1001352704 | 171 |
| 199 | 3300005618 | Ga0068864_100005294 | Ga0068864_1000052949 | 171 |
| 200 | 3300005618 | Ga0068864_100515029 | Ga0068864_1005150292 | 171 |
| 201 | 3300005719 | Ga0068861_100108795 | Ga0068861_1001087952 | 171 |
| 202 | 3300005841 | Ga0068863_100015617 | Ga0068863_1000156174 | 171 |
| 203 | 3300005844 | Ga0068862_100136897 | Ga0068862_1001368973 | 171 |
| 204 | 3300005844 | Ga0068862_100958429 | Ga0068862_1009584291 | 171 |
| 205 | 3300005985 | Ga0081539_10000033 | Ga0081539_10000033119 | 171 |
| 206 | 3300006844 | Ga0075428_100447497 | Ga0075428_1004474972 | 171 |
| 207 | 3300006871 | Ga0075434_100055595 | Ga0075434_1000555953 | 171 |
| 208 | 3300006871 | Ga0075434_101035466 | Ga0075434_1010354662 | 171 |
| 209 | 3300006931 | Ga0097620_100002543 | Ga0097620_1000025439 | 171 |
| 210 | 3300006931 | Ga0097620_100100545 | Ga0097620_1001005453 | 171 |
| 211 | 3300006931 | Ga0097620_100135277 | Ga0097620_1001352774 | 171 |
| 212 | 3300009101 | Ga0105247_10201043 | Ga0105247_102010432 | 171 |
| 213 | 3300009147 | Ga0114129_12083423 | Ga0114129_120834231 | 171 |
| 214 | 3300009148 | Ga0105243_10429771 | Ga0105243_104297712 | 171 |
| 215 | 3300009177 | Ga0105248_10008746 | Ga0105248_100087469 | 171 |
| 216 | 3300013296 | Ga0157374_11925059 | Ga0157374_119250591 | 171 |
| 217 | 3300013308 | Ga0157375_12064630 | Ga0157375_120646301 | 171 |
| 218 | 3300025925 | Ga0207650_10018655 | Ga0207650_100186555 | 171 |
| 219 | 3300025925 | Ga0207650_10568743 | Ga0207650_105687433 | 171 |
| 220 | 3300025932 | Ga0207690_10213400 | Ga0207690_102134002 | 171 |
| 221 | 3300025935 | Ga0207709_10381581 | Ga0207709_103815812 | 171 |
| 222 | 3300025940 | Ga0207691_10010672 | Ga0207691_100106723 | 171 |
| 223 | 3300025940 | Ga0207691_10646465 | Ga0207691_106464652 | 171 |
| 224 | 3300025941 | Ga0207711_10002600 | Ga0207711_100026009 | 171 |
| 225 | 3300025941 | Ga0207711_10010678 | Ga0207711_100106787 | 171 |
| 226 | 3300025945 | Ga0207679_10087564 | Ga0207679_100875642 | 171 |
| 227 | 3300026023 | Ga0207677_10093162 | Ga0207677_100931622 | 171 |
| 228 | 3300026075 | Ga0207708_10000091 | Ga0207708_100000919 | 171 |
| 229 | 3300026095 | Ga0207676_10007651 | Ga0207676_1000765110 | 171 |
| 230 | 3300026095 | Ga0207676_10795594 | Ga0207676_107955942 | 171 |
| 231 | 3300026116 | Ga0207674_10226957 | Ga0207674_102269572 | 171 |
| 232 | 3300026118 | Ga0207675_101164216 | Ga0207675_1011642161 | 171 |
| 233 | 3300028654 | Ga0265322_10013920 | Ga0265322_100139203 | 171 |
| 234 | 3300031242 | Ga0265329_10027413 | Ga0265329_100274131 | 171 |
| 235 | 3300031344 | Ga0265316_10021063 | Ga0265316_100210636 | 171 |
| 236 | 3300031456 | Ga0307513_10002993 | Ga0307513_100029937 | 171 |
| 237 | 3300031712 | Ga0265342_10073055 | Ga0265342_100730553 | 171 |
| 238 | 3300031824 | Ga0307413_10883529 | Ga0307413_108835291 | 171 |
| 239 | 3300031852 | Ga0307410_10514670 | Ga0307410_105146701 | 171 |
| 240 | 3300031903 | Ga0307407_10125100 | Ga0307407_101251002 | 171 |
| 241 | 3300032002 | Ga0307416_102181613 | Ga0307416_1021816131 | 171 |
| 242 | 3300032126 | Ga0307415_100489575 | Ga0307415_1004895751 | 171 |
| 243 | 3300035691 | Ga0373931_0019084 | Ga0373931_0019084_854_1405 | 171 |
| 244 | 3300049514 | Ga0501291_005582 | Ga0501291_005582_281_805 | 171 |
| 245 | 3300049519 | Ga0501296_023712 | Ga0501296_023712_218_772 | 171 |
| 246 | 3300049521 | Ga0501298_000185 | Ga0501298_000185_431_955 | 171 |
| 247 | 3300049522 | Ga0501299_026669 | Ga0501299_026669_137_661 | 171 |
| 248 | 3300049664 | Ga0501224_004394 | Ga0501224_004394_1180_1704 | 171 |
| 249 | 3300049675 | Ga0501243_018678 | Ga0501243_018678_217_741 | 171 |
| 250 | 3300049689 | Ga0501260_015891 | Ga0501260_015891_235_759 | 171 |
| 251 | 3300049690 | Ga0501261_060808 | Ga0501261_060808_81_605 | 171 |
| 252 | 3300049705 | Ga0501225_0028004 | Ga0501225_0028004_775_1299 | 171 |
| 253 | 3300049705 | Ga0501225_0083353 | Ga0501225_0083353_164_718 | 171 |
| 254 | 3300049707 | Ga0501234_012874 | Ga0501234_012874_388_912 | 171 |
| 255 | 3300049779 | Ga0501283_000449 | Ga0501283_000449_2135_2659 | 171 |
| 256 | 3300049851 | Ga0501212_011982 | Ga0501212_011982_208_732 | 171 |
| 257 | 3300050510 | nmdc:mga06r32_457189_c1 | nmdc:mga06r32_457189_c1_253_774 | 171 |
| 258 | 3300050512 | nmdc:mga0n895_154512_c1 | nmdc:mga0n895_154512_c1_1313_1858 | 171 |
| 259 | 3300005618 | Ga0068864_100167147 | Ga0068864_1001671471 | 172 |
| 260 | 3300026075 | Ga0207708_10190870 | Ga0207708_101908702 | 172 |
| 261 | 3300026095 | Ga0207676_10453324 | Ga0207676_104533242 | 172 |
| 262 | 3300031344 | Ga0265316_10388987 | Ga0265316_103889871 | 172 |
| 263 | 3300049522 | Ga0501299_057610 | Ga0501299_057610_151_678 | 172 |
| 264 | 3300049661 | Ga0501217_025920 | Ga0501217_025920_802_1332 | 173 |
| 265 | 3300049665 | Ga0501227_001994 | Ga0501227_001994_1057_1587 | 173 |
| 266 | 3300049705 | Ga0501225_0016133 | Ga0501225_0016133_85_615 | 173 |
| 267 | 3300005458 | Ga0070681_10494492 | Ga0070681_104944922 | 174 |
| 268 | 3300005530 | Ga0070679_100651165 | Ga0070679_1006511652 | 174 |
| 269 | 3300005719 | Ga0068861_101629937 | Ga0068861_1016299371 | 174 |
| 270 | 3300026118 | Ga0207675_101777652 | Ga0207675_1017776521 | 174 |
| 271 | 3300042130 | Ga0450892_011964 | Ga0450892_011964_116_646 | 174 |
| 272 | 3300005617 | Ga0068859_100742582 | Ga0068859_1007425822 | 175 |
| 273 | 3300006931 | Ga0097620_100742544 | Ga0097620_1007425442 | 175 |
| 274 | 3300009148 | Ga0105243_10111724 | Ga0105243_101117243 | 175 |
| 275 | 3300009545 | Ga0105237_10959684 | Ga0105237_109596842 | 175 |
| 276 | 3300009551 | Ga0105238_10023634 | Ga0105238_100236345 | 175 |
| 277 | 3300014326 | Ga0157380_10706456 | Ga0157380_107064562 | 175 |
| 278 | 3300025315 | Ga0207697_10166384 | Ga0207697_101663842 | 175 |
| 279 | 3300025923 | Ga0207681_10037919 | Ga0207681_100379193 | 175 |
| 280 | 3300025924 | Ga0207694_10001471 | Ga0207694_1000147113 | 175 |
| 281 | 3300025935 | Ga0207709_10019181 | Ga0207709_100191813 | 175 |
| 282 | 3300053139 | Ga0500568_0028605 | Ga0500568_0028605_1743_2309 | 175 |
| 283 | 3300002459 | JGI24751J29686_10000012 | JGI24751J29686_1000001212 | 177 |
| 284 | 3300005331 | Ga0070670_100000174 | Ga0070670_10000017438 | 177 |
| 285 | 3300014325 | Ga0163163_10000208 | Ga0163163_1000020811 | 177 |
| 286 | 3300025925 | Ga0207650_10000011 | Ga0207650_10000011287 | 177 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nwj-assembly3.cif.gz_A | crystal structure of shikimate kinase from arabidopsis thaliana (atsk2) | 0.7176 | 2 | 102 |
| 3nwj-assembly3.cif.gz_B | crystal structure of shikimate kinase from arabidopsis thaliana (atsk2) | 0.6762 | 2 | 104 |
| 1ukz-assembly1.cif.gz_A | substrate specificity and assembly of catalytic center derived from two structures of ligated uridylate kinase | 0.6712 | 2 | 173 |
| 3fb4-assembly1.cif.gz_A | crystal structure of adenylate kinase from marinibacillus marinus | 0.6697 | 1 | 166 |
| 4cvn-assembly1.cif.gz_D | structure of the fap7-rps14 complex | 0.6694 | 4 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6H6N6_28_186_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7268 | 1 | 97 | 3.40.50.300 |
| af_Q7EYP9_5_180_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6808 | 1 | 172 | 3.40.50.300 |
| 3nwjB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6762 | 2 | 104 | 3.40.50.300 |
| 4cvnD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6694 | 4 | 166 | 3.40.50.300 |
| af_Q5TCS8_1409_1601_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.666 | 2 | 167 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3QBT7-F1-model_v4 | Adenylate kinase | 0.9847 | 2 | 170 |
GO:0016301
|
| AF-A0A0Q1CJ15-F1-model_v4 | Adenylate kinase | 0.9821 | 2 | 166 |
GO:0016301
|
| AF-A0A1Z4S9T8-F1-model_v4 | deleted | 0.9811 | 6 | 168 |
|
| AF-A0A2Y9BE67-F1-model_v4 | Adenylate kinase family enzyme | 0.9799 | 1 | 140 |
GO:0016301
|
| AF-A0A6I5XGN0-F1-model_v4 | deleted | 0.9788 | 2 | 167 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar