F387654

General Info

Members Datasets Scaffolds Average Seq Length
286 205 572 510

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0001082|Ga0496116_0001082_7485_9089
Length 534
Sequence LIAGLNRYWQKLGDEGMVGKVFLVGAGPGDARLITVKGWESIGKADAVVYDRLASPRLLKLMKPGAVKIYVGKRPDRHTMKQEEINQLLVDLALEGKVVVRLKGGDPTIFGRVGEEAELLHKNGIPFEIVPGVTAAISVPAYAGIPVTHRDYASSISIITGHESPDKLDRSIQWDKVTNATGTLVFMMGVAKIGYISEQLIRHGRPATTPVALVRWGTRAEQDTITGTLEDIEAKVIAANFQPPAVIVVGDVVRQREQLKWAEVLPLFGKRILVTRARSQASELVNRIEELGGEPYEFPVIETVMPSSESSKQSVKDALSALNIFDWVFFTSVNGVEFFFRHLENEGKDIRSLHLARIAAVGPSTAEALRKHGIAPEVVKGPFQAEGMLEAFESELKAGQKVLIPHGDLARSWLPEQLRERGLHVTEAIIYDTILAGEDDDELLKLLEEGGIHAVTFTSSSTVKNFMKMLKRMGVEDPLPLLKGVEVACIGPVTAETAEAAGLEVTLMAKEATMTSLIDALCEWKRAAASVGSN

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
97 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
98 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
99 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
100 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
127 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
128 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
129 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
130 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
140 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
141 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
146 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
147 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
148 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
149 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
160 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
161 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
162 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
163 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
164 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
165 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
166 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
167 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
168 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
169 2738541295 Bacillus sp. OK085 Isolate Unclassified
170 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
171 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
172 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
173 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
174 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
175 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
176 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
177 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
178 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
179 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
180 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
181 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
182 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
183 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
184 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
185 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
186 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
187 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
188 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
189 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
190 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
191 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
192 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
193 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
194 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
195 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
196 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
197 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
198 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
199 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
200 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
201 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
202 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
203 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
204 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
205 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.42
Metatranscriptomes 3.15
Isolates 16.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 2.1
Rhizosphere 83.57
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0001082 3300048919 Bacteria 32803
2 Ga0006562J51391_1002280 3300003578 Bacteria 4915
3 Ga0006562J51391_1006457 3300003578 Bacteria 5009
4 Ga0055538_1000324 3300003751 Bacteria 21959
5 Ga0070670_100002290 3300005331 Bacteria 15774
6 Ga0070680_100019807 3300005336 Bacteria 5335
7 Ga0070680_100072309 3300005336 Bacteria 2834
8 Ga0070689_100000021 3300005340 Bacteria 133549
9 Ga0070689_100176286 3300005340 Bacteria 1734
10 Ga0070687_100008872 3300005343 Bacteria 4277
11 Ga0070668_100067761 3300005347 Bacteria 2773
12 Ga0070675_100000010 3300005354 Bacteria 243396
13 Ga0070675_100035226 3300005354 Bacteria 4066
14 Ga0070675_100137468 3300005354 Bacteria 2086
15 Ga0070671_100005312 3300005355 Bacteria 10277
16 Ga0070671_100029843 3300005355 Bacteria 4498
17 Ga0070671_100056987 3300005355 Bacteria 3251
18 Ga0070671_100128901 3300005355 Bacteria 2130
19 Ga0070674_100006956 3300005356 Bacteria 6635
20 Ga0070673_100006687 3300005364 Bacteria 7514
21 Ga0070688_100000024 3300005365 Bacteria 69611
22 Ga0070659_100013487 3300005366 Bacteria 6083
23 Ga0070700_100000001 3300005441 Bacteria 346167
24 Ga0070700_100000489 3300005441 Bacteria 19866
25 Ga0070708_100017097 3300005445 Bacteria 6040
26 Ga0070708_100061478 3300005445 Bacteria 3355
27 Ga0070708_100207946 3300005445 Bacteria 1833
28 Ga0070681_10005535 3300005458 Bacteria 12205
29 Ga0068867_100036420 3300005459 Bacteria 3572
30 Ga0070685_10000412 3300005466 Bacteria 25356
31 Ga0070706_100000311 3300005467 Bacteria 59149
32 Ga0070706_100009724 3300005467 Bacteria 8938
33 Ga0070706_100025491 3300005467 Bacteria 5443
34 Ga0070706_100087722 3300005467 Bacteria 2884
35 Ga0070707_100000795 3300005468 Bacteria 31149
36 Ga0070707_100001841 3300005468 Bacteria 20359
37 Ga0070707_100007984 3300005468 Bacteria 9831
38 Ga0070707_100066396 3300005468 Bacteria 3467
39 Ga0070707_100070732 3300005468 Bacteria 3361
40 Ga0070707_100098218 3300005468 Bacteria 2836
41 Ga0070698_100025082 3300005471 Bacteria 6214
42 Ga0070698_100161018 3300005471 Bacteria 2188
43 Ga0070699_100006821 3300005518 Bacteria 9937
44 Ga0070699_100006935 3300005518 Bacteria 9851
45 Ga0070699_100121974 3300005518 Unclassified 2293
46 Ga0070699_100209155 3300005518 Bacteria 1736
47 Ga0070697_100000614 3300005536 Bacteria 27117
48 Ga0070697_100002102 3300005536 Bacteria 15248
49 Ga0070697_100011396 3300005536 Bacteria 6948
50 Ga0070697_100046560 3300005536 Bacteria 3515
51 Ga0070697_100062629 3300005536 Bacteria 3036
52 Ga0070686_100000154 3300005544 Bacteria 47181
53 Ga0070695_100016367 3300005545 Bacteria 4486
54 Ga0070693_100029958 3300005547 Bacteria 2972
55 Ga0070665_100016164 3300005548 Bacteria 7488
56 Ga0070704_100015850 3300005549 Bacteria 4745
57 Ga0070664_100047649 3300005564 Bacteria 3621
58 Ga0070664_100088881 3300005564 Bacteria 2672
59 Ga0068859_100004874 3300005617 Bacteria 13664
60 Ga0068870_10012150 3300005840 Bacteria 4016
61 Ga0081455_10001905 3300005937 Bacteria 25082
62 Ga0081539_10000098 3300005985 Bacteria 202400
63 Ga0070717_10010157 3300006028 Bacteria 7090
64 Ga0070717_10033006 3300006028 Bacteria 4174
65 Ga0070717_10055519 3300006028 Bacteria 3268
66 Ga0070717_10120792 3300006028 Bacteria 2244
67 Ga0070716_100015278 3300006173 Bacteria 3942
68 Ga0070716_100073234 3300006173 Bacteria 2020
69 Ga0097621_100008912 3300006237 Bacteria 7252
70 Ga0097621_100127899 3300006237 Unclassified 2159
71 Ga0068871_100006780 3300006358 Bacteria 8138
72 Ga0075430_100001116 3300006846 Bacteria 21379
73 Ga0075430_100009756 3300006846 Bacteria 8118
74 Ga0075430_100038429 3300006846 Bacteria 4053
75 Ga0075431_100060103 3300006847 Bacteria 3922
76 Ga0075431_100233922 3300006847 Bacteria 1871
77 Ga0075433_10111578 3300006852 Bacteria 2426
78 Ga0075429_100017509 3300006880 Bacteria 6196
79 Ga0097620_100004874 3300006931 Bacteria 13664
80 Ga0075435_100064851 3300007076 Bacteria 2969
81 Ga0105244_10009301 3300009036 Bacteria 6054
82 Ga0105244_10018372 3300009036 Bacteria 3924
83 Ga0105244_10051613 3300009036 Bacteria 2095
84 Ga0111539_10000955 3300009094 Bacteria 37911
85 Ga0114129_10009795 3300009147 Bacteria 13667
86 Ga0105242_10001698 3300009176 Bacteria 17424
87 Ga0105248_10000680 3300009177 Bacteria 38460
88 Ga0105246_10008644 3300011119 Bacteria 6262
89 Ga0157374_10092772 3300013296 Bacteria 2882
90 Ga0157374_10224104 3300013296 Bacteria 1846
91 Ga0157378_10070792 3300013297 Unclassified 3132
92 Ga0157378_10091807 3300013297 Bacteria 2762
93 Ga0157378_10242975 3300013297 Bacteria 1720
94 Ga0163162_10136451 3300013306 Bacteria 2564
95 Ga0157375_10000985 3300013308 Bacteria 24652
96 Ga0157375_10045367 3300013308 Bacteria 4277
97 Ga0157380_10052340 3300014326 Bacteria 3233
98 Ga0209784_100038 3300025224 Bacteria 253212
99 Ga0207697_10005734 3300025315 Bacteria 5723
100 Ga0207682_10024880 3300025893 Unclassified 2373
101 Ga0207688_10012848 3300025901 Bacteria 4552
102 Ga0207680_10004621 3300025903 Bacteria 6539
103 Ga0207645_10002583 3300025907 Bacteria 14118
104 Ga0207645_10004137 3300025907 Bacteria 10794
105 Ga0207684_10000337 3300025910 Bacteria 65590
106 Ga0207684_10000916 3300025910 Bacteria 33453
107 Ga0207684_10016953 3300025910 Bacteria 6257
108 Ga0207684_10061711 3300025910 Bacteria 3183
109 Ga0207707_10011322 3300025912 Bacteria 7765
110 Ga0207660_10012455 3300025917 Bacteria 5566
111 Ga0207660_10114436 3300025917 Bacteria 2035
112 Ga0207646_10000191 3300025922 Bacteria 83638
113 Ga0207646_10000283 3300025922 Bacteria 69717
114 Ga0207646_10001393 3300025922 Bacteria 29980
115 Ga0207646_10005274 3300025922 Bacteria 13629
116 Ga0207646_10021788 3300025922 Bacteria 5913
117 Ga0207650_10001976 3300025925 Bacteria 14386
118 Ga0207650_10081458 3300025925 Unclassified 2455
119 Ga0207659_10000001 3300025926 Bacteria 660958
120 Ga0207659_10004284 3300025926 Bacteria 8627
121 Ga0207659_10057695 3300025926 Bacteria 2785
122 Ga0207644_10014602 3300025931 Bacteria 5258
123 Ga0207644_10044079 3300025931 Bacteria 3168
124 Ga0207690_10026738 3300025932 Bacteria 3637
125 Ga0207686_10005087 3300025934 Bacteria 7073
126 Ga0207686_10007301 3300025934 Bacteria 5947
127 Ga0207670_10000095 3300025936 Bacteria 61053
128 Ga0207665_10033917 3300025939 Bacteria 3386
129 Ga0207691_10000230 3300025940 Bacteria 54440
130 Ga0207691_10016328 3300025940 Bacteria 7049
131 Ga0207711_10010396 3300025941 Bacteria 7727
132 Ga0207679_10040935 3300025945 Bacteria 3320
133 Ga0207651_10000307 3300025960 Bacteria 21032
134 Ga0207651_10023214 3300025960 Bacteria 3810
135 Ga0207677_10054667 3300026023 Bacteria 2726
136 Ga0207708_10000050 3300026075 Bacteria 112028
137 Ga0207708_10000168 3300026075 Bacteria 51719
138 Ga0207648_10005479 3300026089 Bacteria 12788
139 Ga0207648_10145321 3300026089 Bacteria 2092
140 Ga0209974_10000207 3300027876 Bacteria 19008
141 Ga0268266_10022211 3300028379 Bacteria 5407
142 Ga0265760_10001814 3300031090 Bacteria 6269
143 Ga0265325_10027640 3300031241 Bacteria 3064
144 Ga0265329_10007137 3300031242 Bacteria 4350
145 Ga0316576_10000029 3300031727 Bacteria 42507
146 Ga0316576_10005406 3300031727 Bacteria 7801
147 Ga0316578_10025940 3300031728 Bacteria 3301
148 Ga0307416_100113328 3300032002 Bacteria 2396
149 Ga0307411_10101451 3300032005 Bacteria 2036
150 Ga0373943_0030237 3300035170 Unclassified 2563
151 Ga0373935_0064257 3300035692 Unclassified 2353
152 Ga0373927_0065114 3300035695 Bacteria 2358
153 Ga0373937_0030609 3300036401 Bacteria 4874
154 Ga0316582_0050612 3300036647 Bacteria 2633
155 Ga0316584_0032095 3300036712 Bacteria 3885
156 Ga0373925_0060988 3300037068 Unclassified 2833
157 Ga0400483_005644 3300039062 Bacteria 9556
158 Ga0400483_285106 3300039062 Bacteria 2009
159 Ga0400489_18295 3300039093 Bacteria 4436
160 Ga0439447_008494 3300041407 Bacteria 3175
161 Ga0439466_0010864 3300041411 Bacteria 3376
162 Ga0439433_0002820 3300041999 Bacteria 3713
163 Ga0439449_0001044 3300042007 Bacteria 10911
164 Ga0450894_002040 3300042131 Bacteria 2783
165 Ga0451577_0009966 3300042876 Bacteria 9108
166 Ga0451577_0178363 3300042876 Bacteria 1915
167 Ga0453684_0000092 3300044712 Bacteria 386770
168 Ga0453684_0003815 3300044712 Bacteria 33236
169 Ga0453684_0312079 3300044712 Bacteria 1784
170 Ga0495658_0096377 3300046683 Bacteria 1759
171 Ga0495581_0053894 3300047315 Bacteria 2322
172 Ga0495604_0115099 3300047317 Bacteria 1955
173 Ga0495676_0041225 3300047321 Bacteria 3802
174 Ga0495680_0057820 3300047322 Bacteria 2998
175 Ga0496101_0041883 3300048904 Bacteria 3268
176 Ga0496106_0126911 3300048909 Unclassified 1998
177 Ga0496109_0179809 3300048912 Bacteria 1986
178 Ga0496112_0175984 3300048915 Bacteria 2105
179 Ga0496112_0234024 3300048915 Bacteria 1791
180 Ga0496116_0018507 3300048919 Bacteria 5366
181 Ga0496116_0024616 3300048919 Bacteria 4446
182 Ga0496116_0082171 3300048919 Bacteria 1994
183 Ga0496117_0007279 3300048920 Bacteria 10875
184 Ga0496118_0006967 3300048921 Bacteria 12202
185 Ga0496119_0006510 3300048922 Bacteria 10780
186 Ga0496119_0024792 3300048922 Bacteria 4208
187 Ga0496120_0024509 3300048923 Bacteria 3761
188 Ga0496121_0065898 3300048924 Bacteria 2944
189 Ga0496121_0174604 3300048924 Bacteria 1557
190 Ga0496122_0013671 3300048925 Bacteria 7923
191 Ga0496122_0026599 3300048925 Bacteria 4979
192 Ga0496122_0044943 3300048925 Bacteria 3439
193 Ga0496123_0010948 3300048926 Bacteria 7935
194 Ga0496124_0000478 3300048927 Bacteria 68902
195 Ga0496125_0000559 3300048928 Bacteria 64131
196 Ga0496125_0000618 3300048928 Bacteria 60027
197 Ga0496125_0141008 3300048928 Bacteria 1676
198 Ga0496126_0019792 3300048929 Bacteria 6622
199 Ga0501343_000234 3300049132 Bacteria 2928
200 Ga0501344_00334 3300049133 Bacteria 1881
201 Ga0501296_000525 3300049519 Bacteria 3742
202 Ga0501297_000132 3300049520 Bacteria 7869
203 Ga0501299_000616 3300049522 Bacteria 4232
204 Ga0501300_001404 3300049523 Bacteria 3611
205 Ga0501315_000747 3300049531 Bacteria 2431
206 Ga0501335_001211 3300049551 Bacteria 1942
207 Ga0501337_000055 3300049553 Bacteria 3894
208 Ga0501338_00280 3300049554 Bacteria 2172
209 Ga0501034_0101176 3300049571 Unclassified 2876
210 Ga0501039_0146556 3300049575 Unclassified 1855
211 Ga0501043_0045880 3300049579 Bacteria 3436
212 Ga0501067_0017926 3300049583 Bacteria 3921
213 Ga0501068_0021690 3300049584 Bacteria 3753
214 Ga0501233_000090 3300049668 Bacteria 11987
215 Ga0501235_002218 3300049669 Bacteria 4180
216 Ga0501246_001081 3300049676 Bacteria 2048
217 Ga0501249_000936 3300049679 Bacteria 6405
218 Ga0501257_006058 3300049686 Bacteria 2680
219 Ga0501257_018086 3300049686 Bacteria 1642
220 Ga0501079_0014590 3300049741 Bacteria 5992
221 Ga0501271_000050 3300049768 Bacteria 8625
222 Ga0501276_000423 3300049773 Bacteria 2572
223 Ga0501279_001109 3300049775 Bacteria 3537
224 Ga0501283_000045 3300049779 Bacteria 15144
225 Ga0501226_002644 3300049853 Bacteria 2172
226 nmdc:mga05p37_124827_c1 3300050507 Bacteria 3161
227 nmdc:mga05p37_73395_c1 3300050507 Bacteria 4211
228 nmdc:mga09592_67010_c1 3300050508 Bacteria 3044
229 nmdc:mga0qj67_23753_c1 3300050509 Bacteria 4720
230 nmdc:mga0qj67_32755_c1 3300050509 Bacteria 4055
231 nmdc:mga06r32_51962_c1 3300050510 Bacteria 3924
232 nmdc:mga08y16_411_c1 3300050511 Bacteria 39379
233 nmdc:mga08y16_41575_c1 3300050511 Bacteria 4815
234 nmdc:mga0a205_134661_c1 3300050515 Bacteria 2371
235 nmdc:mga0a205_33179_c1 3300050515 Bacteria 4950
236 Ga0495601_0002211 3300053077 Bacteria 10946
237 Ga0495619_0106697 3300053085 Unclassified 1910
238 Ga0495619_0126841 3300053085 Bacteria 1752
239 Ga0501084_0046217 3300054114 Bacteria 3647
240 2524186863 2524023129 Bacteria 6762600
241 2563929964 2563366752 Bacteria 4961801
242 2578338215 2576861424 Bacteria 5270569
243 2580931544 2579778775 Bacteria 5360914
244 2601640567 2600255286 Bacteria 5390125
245 2621276634 2619619294 Bacteria 5575484
246 2643738967 2643221543 Bacteria 6628015
247 2723605535 2721755693 Bacteria 6126117
248 2728530465 2728368933 Bacteria 7044283
249 2730136221 2728369359 Bacteria 5621728
250 2738815092 2738541295 Bacteria 5730091
251 2753810164 2751185905 Bacteria 6142767
252 2793181902 2791355222 Bacteria 5898266
253 2802438868 2802428803 Bacteria 5806948
254 2821117179 2821111986 Bacteria 6894338
255 2864735445 2864733723 Bacteria 6770668
256 2865003180 2865002811 Bacteria 6333767
257 2881640345 2881636855 Bacteria 5205297
258 2885533212 2885526491 Bacteria 7164189
259 2888582952 2888578766 Bacteria 6743310
260 2889047450 2889042446 Bacteria 7618936
261 2889281510 2889276214 Bacteria 5979355
262 2904162593 2904162308 Bacteria 7086713
263 2904495769 2904490793 Bacteria 7046938
264 2904601111 2904595352 Bacteria 6124848
265 2907207410 2907202186 Bacteria 6632024
266 2919164358 2919160200 Bacteria 6929020
267 2919418781 2919414237 Bacteria 5429133
268 2929299042 2929297113 Bacteria 3141306
269 2931384501 2931384279 Bacteria 7299545
270 2938653713 2938649242 Bacteria 7118381
271 2939684737 2939679117 Bacteria 6921672
272 2939704073 2939702853 Bacteria 5139229
273 2945996859 2945991243 Bacteria 7008369
274 2946059536 2946053406 Bacteria 6978655
275 2968562427 2968558590 Bacteria 6956864
276 2971409035 2971403814 Bacteria 7370929
277 2971515838 2971511577 Bacteria 5404012
278 2980178315 2980176882 Bacteria 5397533
279 2988229938 2988225383 Bacteria 7221625
280 2996637003 2996632988 Bacteria 6921523
281 2996711346 2996706504 Bacteria 5757485
282 3001898549 3001892409 Bacteria 6328293
283 648171593 648028048 Bacteria 5394884
284 8054470489 8054465665 Bacteria 7323556
285 8057737257 8057733483 Bacteria 6578323
286 8057977581 8057977335 Bacteria 5694872
287 Ga0496116_0001082
288 Ga0006562J51391_1002280
289 Ga0006562J51391_1006457
290 Ga0055538_1000324
291 Ga0070670_100002290
292 Ga0070680_100019807
293 Ga0070680_100072309
294 Ga0070689_100000021
295 Ga0070689_100176286
296 Ga0070687_100008872
297 Ga0070668_100067761
298 Ga0070675_100000010
299 Ga0070675_100035226
300 Ga0070675_100137468
301 Ga0070671_100005312
302 Ga0070671_100029843
303 Ga0070671_100056987
304 Ga0070671_100128901
305 Ga0070674_100006956
306 Ga0070673_100006687
307 Ga0070688_100000024
308 Ga0070659_100013487
309 Ga0070700_100000001
310 Ga0070700_100000489
311 Ga0070708_100017097
312 Ga0070708_100061478
313 Ga0070708_100207946
314 Ga0070681_10005535
315 Ga0068867_100036420
316 Ga0070685_10000412
317 Ga0070706_100000311
318 Ga0070706_100009724
319 Ga0070706_100025491
320 Ga0070706_100087722
321 Ga0070707_100000795
322 Ga0070707_100001841
323 Ga0070707_100007984
324 Ga0070707_100066396
325 Ga0070707_100070732
326 Ga0070707_100098218
327 Ga0070698_100025082
328 Ga0070698_100161018
329 Ga0070699_100006821
330 Ga0070699_100006935
331 Ga0070699_100121974
332 Ga0070699_100209155
333 Ga0070697_100000614
334 Ga0070697_100002102
335 Ga0070697_100011396
336 Ga0070697_100046560
337 Ga0070697_100062629
338 Ga0070686_100000154
339 Ga0070695_100016367
340 Ga0070693_100029958
341 Ga0070665_100016164
342 Ga0070704_100015850
343 Ga0070664_100047649
344 Ga0070664_100088881
345 Ga0068859_100004874
346 Ga0068870_10012150
347 Ga0081455_10001905
348 Ga0081539_10000098
349 Ga0070717_10010157
350 Ga0070717_10033006
351 Ga0070717_10055519
352 Ga0070717_10120792
353 Ga0070716_100015278
354 Ga0070716_100073234
355 Ga0097621_100008912
356 Ga0097621_100127899
357 Ga0068871_100006780
358 Ga0075430_100001116
359 Ga0075430_100009756
360 Ga0075430_100038429
361 Ga0075431_100060103
362 Ga0075431_100233922
363 Ga0075433_10111578
364 Ga0075429_100017509
365 Ga0097620_100004874
366 Ga0075435_100064851
367 Ga0105244_10009301
368 Ga0105244_10018372
369 Ga0105244_10051613
370 Ga0111539_10000955
371 Ga0114129_10009795
372 Ga0105242_10001698
373 Ga0105248_10000680
374 Ga0105246_10008644
375 Ga0157374_10092772
376 Ga0157374_10224104
377 Ga0157378_10070792
378 Ga0157378_10091807
379 Ga0157378_10242975
380 Ga0163162_10136451
381 Ga0157375_10000985
382 Ga0157375_10045367
383 Ga0157380_10052340
384 Ga0209784_100038
385 Ga0207697_10005734
386 Ga0207682_10024880
387 Ga0207688_10012848
388 Ga0207680_10004621
389 Ga0207645_10002583
390 Ga0207645_10004137
391 Ga0207684_10000337
392 Ga0207684_10000916
393 Ga0207684_10016953
394 Ga0207684_10061711
395 Ga0207707_10011322
396 Ga0207660_10012455
397 Ga0207660_10114436
398 Ga0207646_10000191
399 Ga0207646_10000283
400 Ga0207646_10001393
401 Ga0207646_10005274
402 Ga0207646_10021788
403 Ga0207650_10001976
404 Ga0207650_10081458
405 Ga0207659_10000001
406 Ga0207659_10004284
407 Ga0207659_10057695
408 Ga0207644_10014602
409 Ga0207644_10044079
410 Ga0207690_10026738
411 Ga0207686_10005087
412 Ga0207686_10007301
413 Ga0207670_10000095
414 Ga0207665_10033917
415 Ga0207691_10000230
416 Ga0207691_10016328
417 Ga0207711_10010396
418 Ga0207679_10040935
419 Ga0207651_10000307
420 Ga0207651_10023214
421 Ga0207677_10054667
422 Ga0207708_10000050
423 Ga0207708_10000168
424 Ga0207648_10005479
425 Ga0207648_10145321
426 Ga0209974_10000207
427 Ga0268266_10022211
428 Ga0265760_10001814
429 Ga0265325_10027640
430 Ga0265329_10007137
431 Ga0316576_10000029
432 Ga0316576_10005406
433 Ga0316578_10025940
434 Ga0307416_100113328
435 Ga0307411_10101451
436 Ga0373943_0030237
437 Ga0373935_0064257
438 Ga0373927_0065114
439 Ga0373937_0030609
440 Ga0316582_0050612
441 Ga0316584_0032095
442 Ga0373925_0060988
443 Ga0400483_005644
444 Ga0400483_285106
445 Ga0400489_18295
446 Ga0439447_008494
447 Ga0439466_0010864
448 Ga0439433_0002820
449 Ga0439449_0001044
450 Ga0450894_002040
451 Ga0451577_0009966
452 Ga0451577_0178363
453 Ga0453684_0000092
454 Ga0453684_0003815
455 Ga0453684_0312079
456 Ga0495658_0096377
457 Ga0495581_0053894
458 Ga0495604_0115099
459 Ga0495676_0041225
460 Ga0495680_0057820
461 Ga0496101_0041883
462 Ga0496106_0126911
463 Ga0496109_0179809
464 Ga0496112_0175984
465 Ga0496112_0234024
466 Ga0496116_0018507
467 Ga0496116_0024616
468 Ga0496116_0082171
469 Ga0496117_0007279
470 Ga0496118_0006967
471 Ga0496119_0006510
472 Ga0496119_0024792
473 Ga0496120_0024509
474 Ga0496121_0065898
475 Ga0496121_0174604
476 Ga0496122_0013671
477 Ga0496122_0026599
478 Ga0496122_0044943
479 Ga0496123_0010948
480 Ga0496124_0000478
481 Ga0496125_0000559
482 Ga0496125_0000618
483 Ga0496125_0141008
484 Ga0496126_0019792
485 Ga0501343_000234
486 Ga0501344_00334
487 Ga0501296_000525
488 Ga0501297_000132
489 Ga0501299_000616
490 Ga0501300_001404
491 Ga0501315_000747
492 Ga0501335_001211
493 Ga0501337_000055
494 Ga0501338_00280
495 Ga0501034_0101176
496 Ga0501039_0146556
497 Ga0501043_0045880
498 Ga0501067_0017926
499 Ga0501068_0021690
500 Ga0501233_000090
501 Ga0501235_002218
502 Ga0501246_001081
503 Ga0501249_000936
504 Ga0501257_006058
505 Ga0501257_018086
506 Ga0501079_0014590
507 Ga0501271_000050
508 Ga0501276_000423
509 Ga0501279_001109
510 Ga0501283_000045
511 Ga0501226_002644
512 nmdc:mga05p37_124827_c1
513 nmdc:mga05p37_73395_c1
514 nmdc:mga09592_67010_c1
515 nmdc:mga0qj67_23753_c1
516 nmdc:mga0qj67_32755_c1
517 nmdc:mga06r32_51962_c1
518 nmdc:mga08y16_411_c1
519 nmdc:mga08y16_41575_c1
520 nmdc:mga0a205_134661_c1
521 nmdc:mga0a205_33179_c1
522 Ga0495601_0002211
523 Ga0495619_0106697
524 Ga0495619_0126841
525 Ga0501084_0046217
526 2524186863
527 2563929964
528 2578338215
529 2580931544
530 2601640567
531 2621276634
532 2643738967
533 2723605535
534 2728530465
535 2730136221
536 2738815092
537 2753810164
538 2793181902
539 2802438868
540 2821117179
541 2864735445
542 2865003180
543 2881640345
544 2885533212
545 2888582952
546 2889047450
547 2889281510
548 2904162593
549 2904495769
550 2904601111
551 2907207410
552 2919164358
553 2919418781
554 2929299042
555 2931384501
556 2938653713
557 2939684737
558 2939704073
559 2945996859
560 2946059536
561 2968562427
562 2971409035
563 2971515838
564 2980178315
565 2988229938
566 2996637003
567 2996711346
568 3001898549
569 648171593
570 8054470489
571 8057737257
572 8057977581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02602

HEM4

Uroporphyrinogen-III synthase HemD

282

519

0.98

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

20

233

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s4d-assembly1.cif.gz_A crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9772 2 246
1s4d-assembly4.cif.gz_I crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.976 2 246
1s4d-assembly4.cif.gz_H crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9748 2 246
1s4d-assembly5.cif.gz_J crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.9742 2 248
1s4d-assembly6.cif.gz_L crystal structure analysis of the s-adenosyl-l-methionine dependent uroporphyrinogen-iii c-methyltransferase sumt 0.969 2 246
ID Description Score Start End Superfamily
af_A0A0R0IWM0_102_225_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9821 2 119 3.40.1010.10
1s4dH02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9811 119 246 3.30.950.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9663 3 119 3.40.1010.10
1s4dE01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9637 2 118 3.40.1010.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9494 3 119 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A846C7R2-F1-model_v4 Uroporphyrin-III C-methyltransferase (EC 2.1.1.107) 0.989 167 246 GO:0004851
GO:0019354
GO:0032259
AF-A0A3A0AH43-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.986 2 246 GO:0004851
GO:0019354
GO:0032259
AF-A0A7X8K0F3-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9846 1 135 GO:0004851
GO:0019354
GO:0032259
AF-A0A1G1GJH1-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9823 2 191 GO:0004851
GO:0019354
GO:0032259
AF-A0A5B9PCL1-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9818 2 243 GO:0004851
GO:0019354
GO:0032259

Map