F387702

General Info

Members Datasets Scaffolds Average Seq Length
286 203 572 264

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0000070|Ga0500635_0000070_37778_38701
Length 307
Sequence MATPHHPDAEKSSSGAPQRRAYEGGGTRAVALVTGAARRIGRVIALELAHAGFDIALHHRGSDAHAVDEAEATACELRAAGAAVRLFPADFADPAATAALLPAVALAFGRVDAVVNSASRFEYDSPATFDAALLEQMMRSNTAAPVALAQALAAQVPAQARHARVSPCVVNLLDQKLHNPNPDYFSYTLTKAALAHATVLLAQALAPAVRVCAVSPGITLVSGPMDEQEFAKAHRLTALGRSSTPEDIARAVRFLIESPAITGIDLAVDGGQHLIGQARDVLFLARNDASSLLPSLPPEGELGQARM

Samples

Sample ID Description Type Environment
1 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
131 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
194 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
195 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
196 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
202 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
203 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.88
Nodule 0.7
Rhizoplane 6.99
Rhizosphere 61.19
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500635_0000070 3300053080 Bacteria 67480
2 JGI24751J29686_10000393 3300002459 Bacteria 14516
3 JGI25156J39149_1000273 3300002705 Bacteria 35022
4 JGI25157J39369_1000141 3300002741 Bacteria 61029
5 rootH1_10009326 3300003316 Bacteria 7939
6 rootH1_10023151 3300003316 Bacteria 2036
7 rootH2_10067644 3300003320 Bacteria 2572
8 rootH1_10044102 3300003323 Bacteria 1586
9 rootH1_10044115 3300003323 Bacteria 1613
10 Ga0055539_1000219 3300003752 Bacteria 40919
11 Ga0055533_1000008 3300003756 Bacteria 575861
12 Ga0055535_1000271 3300003761 Bacteria 54319
13 Ga0055535_1009156 3300003761 Bacteria 1728
14 Ga0055529_1000321 3300003763 Bacteria 54307
15 Ga0055524_1000140 3300003775 Bacteria 85990
16 Ga0055540_1000133 3300003792 Bacteria 75104
17 Ga0055540_1000280 3300003792 Bacteria 45825
18 Ga0055540_1018445 3300003792 Bacteria 1912
19 Ga0055531_10007365 3300003794 Bacteria 6028
20 Ga0070658_10028018 3300005327 Bacteria 4521
21 Ga0070658_10292710 3300005327 Bacteria 1388
22 Ga0070666_10044783 3300005335 Bacteria 2965
23 Ga0070666_10367917 3300005335 Bacteria 1031
24 Ga0070689_100025310 3300005340 Bacteria 4458
25 Ga0070669_100000181 3300005353 Bacteria 55105
26 Ga0070671_100000092 3300005355 Bacteria 57744
27 Ga0070671_100015750 3300005355 Bacteria 6109
28 Ga0070671_100019110 3300005355 Bacteria 5572
29 Ga0070671_100041505 3300005355 Bacteria 3824
30 Ga0070674_100202757 3300005356 Bacteria 1533
31 Ga0070659_100047911 3300005366 Bacteria 3354
32 Ga0070659_100315100 3300005366 Bacteria 1307
33 Ga0070667_100057902 3300005367 Bacteria 3276
34 Ga0070708_100065056 3300005445 Bacteria 3269
35 Ga0068867_100000245 3300005459 Bacteria 35758
36 Ga0070706_100134438 3300005467 Bacteria 2309
37 Ga0070665_100017524 3300005548 Bacteria 7192
38 Ga0070665_100072884 3300005548 Bacteria 3441
39 Ga0070665_100084469 3300005548 Bacteria 3180
40 Ga0068855_100026312 3300005563 Bacteria 6959
41 Ga0068855_100043408 3300005563 Bacteria 5326
42 Ga0070664_100034342 3300005564 Bacteria 4254
43 Ga0070664_100507290 3300005564 Bacteria 1112
44 Ga0068857_100438821 3300005577 Bacteria 1219
45 Ga0068857_100548897 3300005577 Bacteria 1088
46 Ga0068854_100015824 3300005578 Bacteria 5010
47 Ga0068856_100000135 3300005614 Bacteria 74419
48 Ga0068852_100097357 3300005616 Bacteria 2647
49 Ga0068852_100138865 3300005616 Bacteria 2247
50 Ga0068859_100022425 3300005617 Bacteria 6330
51 Ga0068859_100148607 3300005617 Bacteria 2419
52 Ga0068864_100017245 3300005618 Bacteria 6022
53 Ga0068864_100029342 3300005618 Bacteria 4657
54 Ga0068864_100097698 3300005618 Bacteria 2600
55 Ga0068864_100206685 3300005618 Bacteria 1806
56 Ga0068863_100000016 3300005841 Bacteria 213575
57 Ga0068863_100019286 3300005841 Bacteria 6522
58 Ga0068863_100119259 3300005841 Bacteria 2515
59 Ga0068863_100172582 3300005841 Bacteria 2074
60 Ga0068858_100007418 3300005842 Bacteria 10607
61 Ga0068858_100041814 3300005842 Bacteria 4249
62 Ga0068860_100000170 3300005843 Bacteria 106984
63 Ga0068862_100090277 3300005844 Bacteria 2667
64 Ga0075368_10033780 3300006042 Bacteria 1991
65 Ga0075364_10216936 3300006051 Bacteria 1298
66 Ga0075432_10011920 3300006058 Bacteria 2954
67 Ga0075367_10008280 3300006178 Bacteria 5382
68 Ga0075369_10024289 3300006186 Bacteria 2511
69 Ga0075370_10035840 3300006353 Bacteria 2786
70 Ga0068871_100575609 3300006358 Bacteria 1022
71 Ga0075429_100000224 3300006880 Bacteria 38311
72 Ga0097620_100022426 3300006931 Bacteria 6330
73 Ga0097620_100148604 3300006931 Bacteria 2419
74 Ga0079104_1000053 3300006946 Bacteria 168604
75 Ga0105240_10379660 3300009093 Bacteria 1596
76 Ga0105245_10059815 3300009098 Bacteria 3431
77 Ga0105243_10037562 3300009148 Bacteria 3765
78 Ga0105242_10122784 3300009176 Bacteria 2231
79 Ga0105242_10277066 3300009176 Bacteria 1522
80 Ga0105248_10046762 3300009177 Bacteria 4852
81 Ga0105248_10099545 3300009177 Bacteria 3276
82 Ga0105237_10144733 3300009545 Bacteria 2371
83 Ga0105237_10351070 3300009545 Bacteria 1479
84 Ga0105238_10183493 3300009551 Bacteria 2069
85 Ga0105249_10270797 3300009553 Bacteria 1692
86 Ga0157374_10017239 3300013296 Bacteria 6359
87 Ga0157378_10197187 3300013297 Bacteria 1902
88 Ga0157375_10284617 3300013308 Bacteria 1816
89 Ga0163163_10398190 3300014325 Bacteria 1435
90 Ga0157377_10000034 3300014745 Bacteria 117744
91 Ga0157379_10026193 3300014968 Bacteria 5190
92 Ga0157379_10111873 3300014968 Bacteria 2453
93 Ga0157376_10285066 3300014969 Bacteria 1557
94 Ga0213872_10120860 3300021361 Bacteria 1158
95 Ga0209674_100015 3300025226 Bacteria 697299
96 Ga0209563_100017 3300025230 Bacteria 796449
97 Ga0207427_101011 3300025231 Bacteria 11765
98 Ga0209258_100025 3300025242 Bacteria 534777
99 Ga0209258_100726 3300025242 Bacteria 21958
100 Ga0209646_1000229 3300025246 Bacteria 59524
101 Ga0209026_1000028 3300025250 Bacteria 341399
102 Ga0209677_100037 3300025253 Bacteria 286702
103 Ga0209677_100113 3300025253 Bacteria 84174
104 Ga0209677_102386 3300025253 Bacteria 7157
105 Ga0209759_1000021 3300025256 Bacteria 341399
106 Ga0209759_1000844 3300025256 Bacteria 23901
107 Ga0209759_1005745 3300025256 Bacteria 4275
108 Ga0209759_1007241 3300025256 Bacteria 3600
109 Ga0209759_1013572 3300025256 Bacteria 2197
110 Ga0209565_1013388 3300025263 Bacteria 1921
111 Ga0209455_1000166 3300025272 Bacteria 113101
112 Ga0209050_1000996 3300025298 Bacteria 35727
113 Ga0209256_1000045 3300025299 Bacteria 325506
114 Ga0209051_1000004 3300025303 Bacteria 1155596
115 Ga0209051_1005569 3300025303 Bacteria 7319
116 Ga0209051_1021379 3300025303 Bacteria 2757
117 Ga0209257_1000315 3300025304 Bacteria 102293
118 Ga0207684_10069326 3300025910 Bacteria 2997
119 Ga0207695_10047967 3300025913 Bacteria 4514
120 Ga0207695_10088918 3300025913 Bacteria 3107
121 Ga0207695_10354003 3300025913 Bacteria 1355
122 Ga0207671_10400951 3300025914 Bacteria 1091
123 Ga0207657_10026545 3300025919 Bacteria 5319
124 Ga0207681_10000629 3300025923 Bacteria 23581
125 Ga0207650_10120377 3300025925 Bacteria 2043
126 Ga0207644_10000005 3300025931 Bacteria 441948
127 Ga0207644_10028963 3300025931 Bacteria 3839
128 Ga0207644_10278006 3300025931 Bacteria 1344
129 Ga0207686_10041022 3300025934 Bacteria 2819
130 Ga0207709_10000838 3300025935 Bacteria 23593
131 Ga0207709_10081451 3300025935 Bacteria 2087
132 Ga0207670_10311553 3300025936 Unclassified 1236
133 Ga0207669_10037240 3300025937 Bacteria 2789
134 Ga0207669_10254264 3300025937 Bacteria 1310
135 Ga0207711_10016903 3300025941 Bacteria 6060
136 Ga0207689_10030365 3300025942 Bacteria 4504
137 Ga0207679_10451475 3300025945 Bacteria 1140
138 Ga0207667_10015476 3300025949 Bacteria 8664
139 Ga0207667_10016779 3300025949 Bacteria 8262
140 Ga0207640_10049542 3300025981 Bacteria 2720
141 Ga0207658_10002421 3300025986 Bacteria 13663
142 Ga0207703_10031400 3300026035 Bacteria 4200
143 Ga0207702_10089840 3300026078 Bacteria 2687
144 Ga0207641_10000187 3300026088 Bacteria 86568
145 Ga0207641_10011495 3300026088 Bacteria 7268
146 Ga0207641_10045767 3300026088 Bacteria 3687
147 Ga0207641_10131147 3300026088 Bacteria 2251
148 Ga0207641_10542959 3300026088 Bacteria 1133
149 Ga0207648_10000054 3300026089 Bacteria 106684
150 Ga0207676_10009136 3300026095 Bacteria 7059
151 Ga0207676_10177952 3300026095 Unclassified 1860
152 Ga0207676_10232950 3300026095 Bacteria 1647
153 Ga0207676_10505269 3300026095 Unclassified 1148
154 Ga0207674_10173381 3300026116 Bacteria 2110
155 Ga0207683_10058365 3300026121 Bacteria 3388
156 Ga0207683_10113650 3300026121 Bacteria 2425
157 Ga0207698_10051544 3300026142 Bacteria 3147
158 Ga0207698_10372081 3300026142 Bacteria 1357
159 Ga0209281_1000147 3300027111 Bacteria 168586
160 Ga0209974_10002739 3300027876 Bacteria 6389
161 Ga0268266_10038788 3300028379 Bacteria 4055
162 Ga0268266_10098349 3300028379 Bacteria 2575
163 Ga0268266_10208525 3300028379 Bacteria 1791
164 Ga0268265_10072142 3300028380 Bacteria 2692
165 Ga0268264_10000040 3300028381 Bacteria 373714
166 Ga0265336_10000010 3300028666 Bacteria 277947
167 Ga0307517_10005844 3300028786 Bacteria 18403
168 Ga0307517_10060853 3300028786 Bacteria 3584
169 Ga0307515_10025251 3300028794 Bacteria 10292
170 Ga0265324_10001322 3300029957 Bacteria 14517
171 Ga0307511_10084567 3300030521 Bacteria 2201
172 Ga0307512_10039426 3300030522 Bacteria 3958
173 Ga0307513_10006201 3300031456 Bacteria 15675
174 Ga0307513_10396554 3300031456 Bacteria 1115
175 Ga0307509_10003931 3300031507 Bacteria 21948
176 Ga0307508_10003685 3300031616 Bacteria 15354
177 Ga0307514_10000369 3300031649 Bacteria 102951
178 Ga0307514_10159647 3300031649 Bacteria 1495
179 Ga0307516_10006402 3300031730 Bacteria 13805
180 Ga0307516_10059553 3300031730 Bacteria 3713
181 Ga0307516_10339684 3300031730 Bacteria 1169
182 Ga0307412_10008060 3300031911 Bacteria 6003
183 Ga0307411_10108435 3300032005 Bacteria 1981
184 Ga0307510_10116021 3300033180 Bacteria 2400
185 Ga0373923_0089241 3300035111 Bacteria 1346
186 Ga0373931_0058502 3300035691 Bacteria 2070
187 Ga0373931_0066264 3300035691 Bacteria 1959
188 Ga0373925_0017104 3300037068 Bacteria 5250
189 Ga0373925_0305541 3300037068 Bacteria 1285
190 Ga0395898_0027813 3300037466 Bacteria 5670
191 Ga0395905_0092537 3300037471 Bacteria 2835
192 Ga0395901_0010306 3300038443 Bacteria 9467
193 Ga0436361_0538079 3300039447 Bacteria 3801
194 Ga0436361_0622823 3300039447 Bacteria 4492
195 Ga0450920_006271 3300042122 Bacteria 2135
196 Ga0450898_032969 3300042134 Bacteria 957
197 Ga0451577_0001738 3300042876 Bacteria 28073
198 Ga0451577_0080821 3300042876 Bacteria 2898
199 Ga0466966_0006702 3300044684 Bacteria 7629
200 Ga0466963_0143908 3300044694 Bacteria 1653
201 Ga0466963_0547848 3300044694 Bacteria 817
202 Ga0466964_0001750 3300044706 Bacteria 7523
203 Ga0453684_0108145 3300044712 Bacteria 3385
204 Ga0466971_0022265 3300044719 Bacteria 2822
205 Ga0466957_0005780 3300044842 Bacteria 6952
206 Ga0466957_0125124 3300044842 Bacteria 1642
207 Ga0466959_0132819 3300045049 Bacteria 1763
208 Ga0451576_0011749 3300045051 Bacteria 9916
209 Ga0451576_0132583 3300045051 Bacteria 2597
210 Ga0495641_0145608 3300046461 Bacteria 1058
211 Ga0495650_0010434 3300046471 Bacteria 5182
212 Ga0495583_0000428 3300046506 Bacteria 63526
213 Ga0495606_0000821 3300046507 Bacteria 47099
214 Ga0495628_0311814 3300046516 Bacteria 1163
215 Ga0495648_0091706 3300046524 Bacteria 1699
216 Ga0495668_0040722 3300046616 Bacteria 2590
217 Ga0495625_0019735 3300046660 Bacteria 5219
218 Ga0495624_0068069 3300046690 Bacteria 2220
219 Ga0495671_0176335 3300046692 Bacteria 1038
220 Ga0495649_0000523 3300046694 Bacteria 32634
221 Ga0495589_0001294 3300046794 Bacteria 14757
222 Ga0495604_0274904 3300047317 Bacteria 1140
223 Ga0495686_0011058 3300047472 Bacteria 6383
224 Ga0495593_0037146 3300047673 Bacteria 2637
225 Ga0496100_0058690 3300048903 Bacteria 2526
226 Ga0496101_0058364 3300048904 Bacteria 2794
227 Ga0496102_0440728 3300048905 Unclassified 1222
228 Ga0496102_0553213 3300048905 Bacteria 1073
229 Ga0496103_0076228 3300048906 Bacteria 2104
230 Ga0496104_0032120 3300048907 Bacteria 4886
231 Ga0496104_0159279 3300048907 Bacteria 2165
232 Ga0496104_0438860 3300048907 Unclassified 1217
233 Ga0496105_0021591 3300048908 Bacteria 5211
234 Ga0496105_0080617 3300048908 Bacteria 2688
235 Ga0496105_0224137 3300048908 Bacteria 1530
236 Ga0496107_0013817 3300048910 Bacteria 5644
237 Ga0496108_0452503 3300048911 Bacteria 1122
238 Ga0496109_0057905 3300048912 Bacteria 3539
239 Ga0496109_0101423 3300048912 Bacteria 2671
240 Ga0496109_0245076 3300048912 Bacteria 1687
241 Ga0496113_0035650 3300048916 Bacteria 3639
242 Ga0496113_0195409 3300048916 Bacteria 1607
243 Ga0496114_0023238 3300048917 Bacteria 5058
244 Ga0496117_0110657 3300048920 Bacteria 1712
245 Ga0496118_0021045 3300048921 Bacteria 5758
246 Ga0496121_0001098 3300048924 Bacteria 47733
247 Ga0496126_0004470 3300048929 Bacteria 16694
248 Ga0501033_0197466 3300049570 Bacteria 1438
249 Ga0501034_0002017 3300049571 Bacteria 25579
250 Ga0501037_0004226 3300049573 Bacteria 10418
251 Ga0501043_0000058 3300049579 Bacteria 102030
252 Ga0501046_0000051 3300049580 Bacteria 133545
253 Ga0501047_0000003 3300049581 Bacteria 508375
254 Ga0501048_0000321 3300049582 Bacteria 32907
255 Ga0501224_019288 3300049664 Bacteria 1016
256 Ga0501035_0081025 3300049822 Bacteria 2865
257 Ga0501044_0016706 3300049823 Bacteria 7879
258 Ga0501044_0052767 3300049823 Bacteria 4187
259 Ga0501045_0003740 3300049824 Bacteria 10467
260 nmdc:mga03n38_49295_c1 3300050490 Bacteria 1872
261 nmdc:mga0k408_140261_c1 3300050493 Bacteria 1438
262 nmdc:mga0k408_176408_c1 3300050493 Bacteria 1274
263 nmdc:mga0k408_36281_c1 3300050493 Bacteria 2829
264 nmdc:mga06z11_47945_c1 3300050494 Bacteria 2172
265 nmdc:mga07m45_2604_c3 3300050496 Bacteria 3421
266 nmdc:mga07m45_51144_c1 3300050496 Bacteria 2330
267 nmdc:mga09592_819_c1 3300050508 Bacteria 24059
268 nmdc:mga0sz30_28949_c1 3300050516 Bacteria 1484
269 Ga0500578_0000417 3300053086 Bacteria 52045
270 Ga0500644_0028797 3300053088 Bacteria 1740
271 Ga0500583_0123513 3300053092 Bacteria 1282
272 Ga0500651_0124161 3300053093 Bacteria 1565
273 Ga0500641_0013615 3300053096 Bacteria 2990
274 Ga0500594_0036901 3300053118 Bacteria 1317
275 Ga0500614_024968 3300053123 Bacteria 1417
276 Ga0500559_0000320 3300053136 Bacteria 36442
277 Ga0500559_0076754 3300053136 Bacteria 1512
278 Ga0500619_000069 3300053154 Bacteria 30933
279 Ga0500622_0006355 3300053156 Bacteria 6883
280 Ga0500636_0041239 3300053177 Bacteria 2730
281 Ga0500636_0105082 3300053177 Bacteria 1601
282 Ga0500661_002034 3300055283 Bacteria 3820
283 Ga0466962_0005429 3300061719 Bacteria 6129
284 2600202540 2599185354 Bacteria 4398675
285 2644247202 2643221644 Bacteria 6865017
286 2753764331 2751185897 Bacteria 5322941
287 Ga0500635_0000070
288 JGI24751J29686_10000393
289 JGI25156J39149_1000273
290 JGI25157J39369_1000141
291 rootH1_10009326
292 rootH1_10023151
293 rootH2_10067644
294 rootH1_10044102
295 rootH1_10044115
296 Ga0055539_1000219
297 Ga0055533_1000008
298 Ga0055535_1000271
299 Ga0055535_1009156
300 Ga0055529_1000321
301 Ga0055524_1000140
302 Ga0055540_1000133
303 Ga0055540_1000280
304 Ga0055540_1018445
305 Ga0055531_10007365
306 Ga0070658_10028018
307 Ga0070658_10292710
308 Ga0070666_10044783
309 Ga0070666_10367917
310 Ga0070689_100025310
311 Ga0070669_100000181
312 Ga0070671_100000092
313 Ga0070671_100015750
314 Ga0070671_100019110
315 Ga0070671_100041505
316 Ga0070674_100202757
317 Ga0070659_100047911
318 Ga0070659_100315100
319 Ga0070667_100057902
320 Ga0070708_100065056
321 Ga0068867_100000245
322 Ga0070706_100134438
323 Ga0070665_100017524
324 Ga0070665_100072884
325 Ga0070665_100084469
326 Ga0068855_100026312
327 Ga0068855_100043408
328 Ga0070664_100034342
329 Ga0070664_100507290
330 Ga0068857_100438821
331 Ga0068857_100548897
332 Ga0068854_100015824
333 Ga0068856_100000135
334 Ga0068852_100097357
335 Ga0068852_100138865
336 Ga0068859_100022425
337 Ga0068859_100148607
338 Ga0068864_100017245
339 Ga0068864_100029342
340 Ga0068864_100097698
341 Ga0068864_100206685
342 Ga0068863_100000016
343 Ga0068863_100019286
344 Ga0068863_100119259
345 Ga0068863_100172582
346 Ga0068858_100007418
347 Ga0068858_100041814
348 Ga0068860_100000170
349 Ga0068862_100090277
350 Ga0075368_10033780
351 Ga0075364_10216936
352 Ga0075432_10011920
353 Ga0075367_10008280
354 Ga0075369_10024289
355 Ga0075370_10035840
356 Ga0068871_100575609
357 Ga0075429_100000224
358 Ga0097620_100022426
359 Ga0097620_100148604
360 Ga0079104_1000053
361 Ga0105240_10379660
362 Ga0105245_10059815
363 Ga0105243_10037562
364 Ga0105242_10122784
365 Ga0105242_10277066
366 Ga0105248_10046762
367 Ga0105248_10099545
368 Ga0105237_10144733
369 Ga0105237_10351070
370 Ga0105238_10183493
371 Ga0105249_10270797
372 Ga0157374_10017239
373 Ga0157378_10197187
374 Ga0157375_10284617
375 Ga0163163_10398190
376 Ga0157377_10000034
377 Ga0157379_10026193
378 Ga0157379_10111873
379 Ga0157376_10285066
380 Ga0213872_10120860
381 Ga0209674_100015
382 Ga0209563_100017
383 Ga0207427_101011
384 Ga0209258_100025
385 Ga0209258_100726
386 Ga0209646_1000229
387 Ga0209026_1000028
388 Ga0209677_100037
389 Ga0209677_100113
390 Ga0209677_102386
391 Ga0209759_1000021
392 Ga0209759_1000844
393 Ga0209759_1005745
394 Ga0209759_1007241
395 Ga0209759_1013572
396 Ga0209565_1013388
397 Ga0209455_1000166
398 Ga0209050_1000996
399 Ga0209256_1000045
400 Ga0209051_1000004
401 Ga0209051_1005569
402 Ga0209051_1021379
403 Ga0209257_1000315
404 Ga0207684_10069326
405 Ga0207695_10047967
406 Ga0207695_10088918
407 Ga0207695_10354003
408 Ga0207671_10400951
409 Ga0207657_10026545
410 Ga0207681_10000629
411 Ga0207650_10120377
412 Ga0207644_10000005
413 Ga0207644_10028963
414 Ga0207644_10278006
415 Ga0207686_10041022
416 Ga0207709_10000838
417 Ga0207709_10081451
418 Ga0207670_10311553
419 Ga0207669_10037240
420 Ga0207669_10254264
421 Ga0207711_10016903
422 Ga0207689_10030365
423 Ga0207679_10451475
424 Ga0207667_10015476
425 Ga0207667_10016779
426 Ga0207640_10049542
427 Ga0207658_10002421
428 Ga0207703_10031400
429 Ga0207702_10089840
430 Ga0207641_10000187
431 Ga0207641_10011495
432 Ga0207641_10045767
433 Ga0207641_10131147
434 Ga0207641_10542959
435 Ga0207648_10000054
436 Ga0207676_10009136
437 Ga0207676_10177952
438 Ga0207676_10232950
439 Ga0207676_10505269
440 Ga0207674_10173381
441 Ga0207683_10058365
442 Ga0207683_10113650
443 Ga0207698_10051544
444 Ga0207698_10372081
445 Ga0209281_1000147
446 Ga0209974_10002739
447 Ga0268266_10038788
448 Ga0268266_10098349
449 Ga0268266_10208525
450 Ga0268265_10072142
451 Ga0268264_10000040
452 Ga0265336_10000010
453 Ga0307517_10005844
454 Ga0307517_10060853
455 Ga0307515_10025251
456 Ga0265324_10001322
457 Ga0307511_10084567
458 Ga0307512_10039426
459 Ga0307513_10006201
460 Ga0307513_10396554
461 Ga0307509_10003931
462 Ga0307508_10003685
463 Ga0307514_10000369
464 Ga0307514_10159647
465 Ga0307516_10006402
466 Ga0307516_10059553
467 Ga0307516_10339684
468 Ga0307412_10008060
469 Ga0307411_10108435
470 Ga0307510_10116021
471 Ga0373923_0089241
472 Ga0373931_0058502
473 Ga0373931_0066264
474 Ga0373925_0017104
475 Ga0373925_0305541
476 Ga0395898_0027813
477 Ga0395905_0092537
478 Ga0395901_0010306
479 Ga0436361_0538079
480 Ga0436361_0622823
481 Ga0450920_006271
482 Ga0450898_032969
483 Ga0451577_0001738
484 Ga0451577_0080821
485 Ga0466966_0006702
486 Ga0466963_0143908
487 Ga0466963_0547848
488 Ga0466964_0001750
489 Ga0453684_0108145
490 Ga0466971_0022265
491 Ga0466957_0005780
492 Ga0466957_0125124
493 Ga0466959_0132819
494 Ga0451576_0011749
495 Ga0451576_0132583
496 Ga0495641_0145608
497 Ga0495650_0010434
498 Ga0495583_0000428
499 Ga0495606_0000821
500 Ga0495628_0311814
501 Ga0495648_0091706
502 Ga0495668_0040722
503 Ga0495625_0019735
504 Ga0495624_0068069
505 Ga0495671_0176335
506 Ga0495649_0000523
507 Ga0495589_0001294
508 Ga0495604_0274904
509 Ga0495686_0011058
510 Ga0495593_0037146
511 Ga0496100_0058690
512 Ga0496101_0058364
513 Ga0496102_0440728
514 Ga0496102_0553213
515 Ga0496103_0076228
516 Ga0496104_0032120
517 Ga0496104_0159279
518 Ga0496104_0438860
519 Ga0496105_0021591
520 Ga0496105_0080617
521 Ga0496105_0224137
522 Ga0496107_0013817
523 Ga0496108_0452503
524 Ga0496109_0057905
525 Ga0496109_0101423
526 Ga0496109_0245076
527 Ga0496113_0035650
528 Ga0496113_0195409
529 Ga0496114_0023238
530 Ga0496117_0110657
531 Ga0496118_0021045
532 Ga0496121_0001098
533 Ga0496126_0004470
534 Ga0501033_0197466
535 Ga0501034_0002017
536 Ga0501037_0004226
537 Ga0501043_0000058
538 Ga0501046_0000051
539 Ga0501047_0000003
540 Ga0501048_0000321
541 Ga0501224_019288
542 Ga0501035_0081025
543 Ga0501044_0016706
544 Ga0501044_0052767
545 Ga0501045_0003740
546 nmdc:mga03n38_49295_c1
547 nmdc:mga0k408_140261_c1
548 nmdc:mga0k408_176408_c1
549 nmdc:mga0k408_36281_c1
550 nmdc:mga06z11_47945_c1
551 nmdc:mga07m45_2604_c3
552 nmdc:mga07m45_51144_c1
553 nmdc:mga09592_819_c1
554 nmdc:mga0sz30_28949_c1
555 Ga0500578_0000417
556 Ga0500644_0028797
557 Ga0500583_0123513
558 Ga0500651_0124161
559 Ga0500641_0013615
560 Ga0500594_0036901
561 Ga0500614_024968
562 Ga0500559_0000320
563 Ga0500559_0076754
564 Ga0500619_000069
565 Ga0500622_0006355
566 Ga0500636_0041239
567 Ga0500636_0105082
568 Ga0500661_002034
569 Ga0466962_0005429
570 2600202540
571 2644247202
572 2753764331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08659

KR

KR domain

29

160

0.93

PF00106

adh_short

short chain dehydrogenase

29

233

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

35

273

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bt9-assembly5.cif.gz_D crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.9212 3 240
5tgd-assembly1.cif.gz_B crystal structure of folm alternative dihydrofolate reductase 1 from brucella suis in complex with nadp 0.9204 1 240
5bt9-assembly5.cif.gz_B crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.9187 3 240
5bt9-assembly3.cif.gz_C crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp 0.9162 2 243
5u2w-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp 0.9121 6 235
ID Description Score Start End Superfamily
5bt9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9187 3 240 3.40.50.720
4nbwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9044 3 234 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8997 4 179 3.40.50.720
3wtbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8988 1 236 3.40.50.720
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8974 8 231 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5D0XGB0-F1-model_v4 SDR family oxidoreductase 0.9891 6 249
AF-F6IMH9-F1-model_v4 Putative oxidoreductase protein 0.9864 8 249
AF-A0A0S6X3L4-F1-model_v4 Oxidoreductase protein 0.9856 48 249
AF-A0A2A8HXJ8-F1-model_v4 Oxidoreductase 0.9854 1 249
AF-A0A2A8HXJ8-F1-model_v4 Oxidoreductase 0.9776 1 249

Map