F387704

General Info

Members Datasets Scaffolds Average Seq Length
286 197 264 401

Family's Representative Sequence

Representative Sequence 3300053084|Ga0495595_0029311|Ga0495595_0029311_975_2363
Length 462
Sequence LVVGSVALTADETTQNGGCGLVQLLVAPKTAAASKGQAGMHGGQSADKNLSTVAIKTKKKPGYYRDHGDGAARGLYLQVVRLKHGALSKSWTFRYVSPTSGKARWMGLGSVSDLGLADARELAKAARRLKALDLDPIDERNKERMXXXLEAAKAVSFKEAAERYVEAHQTGWKNDKHRAQWAATLKTYAYPVVGALPMAAIDEGHVLKVLEPIWTTKPETASRVRQRMESVIDWATARKYRVGDNPARWRGHLDKLLPKTSKVRRVRNHPALPYAEIQPFMTALRERDGISARTLEFTVLTACRTGEAIGAKWDEFNLADKIWTVPAERMKSGREHRVPLSGAVLEVLRKLPREKNNPHVFIGARSSALSNMAMLELLRGLRPGMTVHGFRSTFRDWAAEKTNYPNHVVEAALAHVIGDRVEAAYRRGDLLDHRKRLMDAWATYCDQKPAKGGTVVSLQAKA

Samples

Sample ID Description Type Environment
1 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
2 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
3 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
4 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
5 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
6 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
7 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
8 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
9 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
10 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
11 2919513703 Luteimonas sp. 3794 Isolate Unclassified
12 2919675420 Luteimonas terrae 4099 Isolate Unclassified
13 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
14 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
15 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
16 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
17 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
18 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
19 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
96 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
97 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
114 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
169 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
197 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.26
Metatranscriptomes 1.4
Isolates 7.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 4.9
Rhizoplane 4.55
Rhizosphere 81.47
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000649 3300001915 Bacteria 10510
2 JGI24740J21852_10000019 3300001979 Bacteria 54662
3 Ga0065714_10100516 3300005288 Unclassified 1663
4 Ga0070658_10003702 3300005327 Bacteria 12509
5 Ga0070658_10021205 3300005327 Bacteria 5205
6 Ga0070683_100142583 3300005329 Bacteria 2270
7 Ga0070670_100161097 3300005331 Bacteria 1944
8 Ga0070680_100130984 3300005336 Bacteria 2098
9 Ga0070674_100197420 3300005356 Unclassified 1551
10 Ga0070709_10171841 3300005434 Bacteria 1515
11 Ga0070713_100186925 3300005436 Bacteria 1865
12 Ga0070713_100304566 3300005436 Bacteria 1468
13 Ga0070711_100000115 3300005439 Bacteria 41554
14 Ga0070663_100000022 3300005455 Bacteria 111612
15 Ga0070663_100176056 3300005455 Unclassified 1656
16 Ga0070662_100150546 3300005457 Unclassified 1811
17 Ga0070681_10290007 3300005458 Bacteria 1546
18 Ga0070706_100014202 3300005467 Bacteria 7358
19 Ga0070706_100194592 3300005467 Bacteria 1894
20 Ga0070698_100058757 3300005471 Bacteria 3887
21 Ga0070698_100385475 3300005471 Unclassified 1334
22 Ga0070679_100230098 3300005530 Bacteria 1813
23 Ga0070686_100084834 3300005544 Unclassified 2106
24 Ga0070665_100029889 3300005548 Bacteria 5483
25 Ga0068855_100008309 3300005563 Bacteria 12546
26 Ga0070664_100274661 3300005564 Bacteria 1519
27 Ga0068856_100000041 3300005614 Bacteria 112613
28 Ga0068856_100000227 3300005614 Bacteria 61212
29 Ga0068856_100113352 3300005614 Unclassified 2710
30 Ga0068856_100313655 3300005614 Bacteria 1586
31 Ga0068852_100034556 3300005616 Unclassified 4207
32 Ga0070717_10047469 3300006028 Unclassified 3518
33 Ga0070717_10317499 3300006028 Bacteria 1388
34 Ga0075368_10021141 3300006042 Unclassified 2469
35 Ga0075364_10003727 3300006051 Bacteria 8699
36 Ga0075366_10083825 3300006195 Bacteria 1905
37 Ga0075428_100047977 3300006844 Bacteria 4689
38 Ga0075428_100167868 3300006844 Bacteria 2380
39 Ga0075431_100000047 3300006847 Bacteria 64846
40 Ga0075431_100169950 3300006847 Bacteria 2240
41 Ga0075429_100242013 3300006880 Bacteria 1580
42 Ga0099826_10000112 3300006948 Bacteria 37415
43 Ga0105240_10003971 3300009093 Bacteria 22834
44 Ga0105240_10007316 3300009093 Bacteria 16066
45 Ga0105240_10051044 3300009093 Bacteria 5208
46 Ga0105240_10052520 3300009093 Bacteria 5123
47 Ga0105240_10185711 3300009093 Bacteria 2449
48 Ga0111539_10004711 3300009094 Bacteria 17824
49 Ga0111539_10062791 3300009094 Bacteria 4396
50 Ga0114129_10001108 3300009147 Bacteria 35473
51 Ga0114129_10038819 3300009147 Bacteria 6712
52 Ga0114129_10081818 3300009147 Bacteria 4488
53 Ga0114129_10150424 3300009147 Bacteria 3186
54 Ga0114129_10349772 3300009147 Bacteria 1958
55 Ga0105241_10000037 3300009174 Bacteria 115452
56 Ga0105238_10006919 3300009551 Bacteria 11329
57 Ga0105239_10005341 3300010375 Bacteria 15073
58 Ga0105239_10082577 3300010375 Bacteria 3539
59 Ga0157373_10000046 3300013100 Bacteria 112179
60 Ga0157371_10036654 3300013102 Bacteria 3512
61 Ga0157370_10000071 3300013104 Bacteria 111640
62 Ga0157370_10030280 3300013104 Bacteria 5304
63 Ga0157370_10052774 3300013104 Viruses 3880
64 Ga0157370_10138110 3300013104 Bacteria 2271
65 Ga0157369_10007532 3300013105 Bacteria 12526
66 Ga0157375_10478013 3300013308 Bacteria 1411
67 Ga0182008_10004304 3300014497 Bacteria 8335
68 Ga0182007_10027128 3300015262 Bacteria 1978
69 Ga0209676_1000730 3300025292 Bacteria 44985
70 Ga0209758_1013385 3300025297 Bacteria 4476
71 Ga0207705_10003165 3300025909 Bacteria 12523
72 Ga0207705_10102593 3300025909 Bacteria 2106
73 Ga0207654_10000032 3300025911 Bacteria 120553
74 Ga0207707_10003175 3300025912 Bacteria 14586
75 Ga0207707_10246531 3300025912 Bacteria 1552
76 Ga0207695_10003464 3300025913 Bacteria 22205
77 Ga0207695_10005895 3300025913 Bacteria 16070
78 Ga0207695_10021533 3300025913 Bacteria 7352
79 Ga0207695_10025568 3300025913 Bacteria 6606
80 Ga0207663_10000165 3300025916 Bacteria 29860
81 Ga0207660_10103567 3300025917 Bacteria 2129
82 Ga0207652_10310128 3300025921 Bacteria 1424
83 Ga0207694_10010035 3300025924 Bacteria 7137
84 Ga0207694_10083508 3300025924 Unclassified 2512
85 Ga0207706_10141924 3300025933 Unclassified 2113
86 Ga0207667_10025397 3300025949 Bacteria 6484
87 Ga0207678_10006433 3300026067 Bacteria 10421
88 Ga0207702_10000061 3300026078 Bacteria 125368
89 Ga0207702_10000533 3300026078 Bacteria 42539
90 Ga0207702_10335245 3300026078 Bacteria 1444
91 Ga0207674_10129262 3300026116 Bacteria 2490
92 Ga0207683_10136237 3300026121 Bacteria 2210
93 Ga0207698_10024016 3300026142 Unclassified 4270
94 Ga0209282_1000268 3300027666 Bacteria 25932
95 Ga0268266_10256791 3300028379 Bacteria 1618
96 Ga0307515_10001540 3300028794 Bacteria 51551
97 Ga0265338_10000028 3300028800 Bacteria 279132
98 Ga0265338_10011875 3300028800 Bacteria 10003
99 Ga0307512_10075062 3300030522 Bacteria 2476
100 Ga0265325_10000001 3300031241 Bacteria 726814
101 Ga0265339_10000093 3300031249 Bacteria 75604
102 Ga0316579_10000750 3300031691 Bacteria 11126
103 Ga0316579_10035671 3300031691 Bacteria 2293
104 Ga0316576_10053623 3300031727 Unclassified 2938
105 Ga0316578_10003982 3300031728 Bacteria 6886
106 Ga0316578_10081585 3300031728 Bacteria 1924
107 Ga0307516_10102777 3300031730 Bacteria 2672
108 Ga0316577_10021648 3300031733 Bacteria 3567
109 Ga0307412_10000347 3300031911 Bacteria 28990
110 Ga0307414_10000162 3300032004 Bacteria 44661
111 Ga0316585_10000549 3300032137 Bacteria 9105
112 Ga0316580_10000646 3300032139 Bacteria 8230
113 Ga0316580_10016751 3300032139 Bacteria 2250
114 Ga0316593_10002419 3300032168 Bacteria 4418
115 Ga0316593_10031197 3300032168 Unclassified 1735
116 Ga0316592_1018887 3300033524 Bacteria 1455
117 Ga0316596_1023195 3300033541 Bacteria 1589
118 Ga0373943_0000209 3300035170 Bacteria 24029
119 Ga0373943_0091442 3300035170 Unclassified 1576
120 Ga0316574_0000473 3300035398 Bacteria 16222
121 Ga0373931_0137290 3300035691 Bacteria 1413
122 Ga0373935_0025920 3300035692 Bacteria 3614
123 Ga0373927_0000682 3300035695 Bacteria 25864
124 Ga0373927_0013430 3300035695 Bacteria 5442
125 Ga0373947_0000365 3300035725 Bacteria 25566
126 Ga0373947_0043088 3300035725 Unclassified 2695
127 Ga0316582_0000251 3300036647 Bacteria 17982
128 Ga0316584_0016159 3300036712 Bacteria 5347
129 Ga0316584_0153801 3300036712 Bacteria 1711
130 Ga0373925_0169819 3300037068 Unclassified 1721
131 Ga0395900_0006055 3300037418 Bacteria 12615
132 Ga0395898_0001029 3300037466 Bacteria 43484
133 Ga0395898_0020582 3300037466 Bacteria 6701
134 Ga0395901_0000526 3300038443 Bacteria 44086
135 Ga0395901_0010587 3300038443 Bacteria 9343
136 Ga0395901_0180959 3300038443 Bacteria 2211
137 Ga0436363_0650200 3300039450 Bacteria 3467
138 Ga0439436_0006413 3300041404 Bacteria 3612
139 Ga0451851_0312888 3300041507 Bacteria 1479
140 Ga0451853_2154476 3300041512 Plasmid 4433
141 Ga0466965_0007100 3300044683 Bacteria 5129
142 Ga0466964_0006798 3300044706 Bacteria 4265
143 Ga0466968_0006198 3300044735 Bacteria 4497
144 Ga0466957_0005503 3300044842 Bacteria 7109
145 Ga0495638_0000666 3300046460 Bacteria 37403
146 Ga0495641_0049163 3300046461 Unclassified 1932
147 Ga0495641_0094418 3300046461 Bacteria 1336
148 Ga0495653_0034113 3300046463 Bacteria 4028
149 Ga0495650_0000002 3300046471 Bacteria 1057165
150 Ga0495582_0108124 3300046473 Unclassified 1561
151 Ga0495664_0005477 3300046477 Bacteria 6970
152 Ga0495583_0000120 3300046506 Bacteria 133285
153 Ga0495583_0015529 3300046506 Bacteria 4137
154 Ga0495608_0118110 3300046511 Unclassified 1701
155 Ga0495610_0000002 3300046512 Bacteria 1282131
156 Ga0495610_0003391 3300046512 Bacteria 12449
157 Ga0495630_0019668 3300046517 Bacteria 4967
158 Ga0495632_0054261 3300046519 Bacteria 1965
159 Ga0495637_0000010 3300046520 Bacteria 378927
160 Ga0495643_0000060 3300046522 Bacteria 190075
161 Ga0495648_0012780 3300046524 Bacteria 6237
162 Ga0495648_0098916 3300046524 Bacteria 1615
163 Ga0495666_0028038 3300046526 Bacteria 2772
164 Ga0495652_0031462 3300046529 Bacteria 4647
165 Ga0495654_0003712 3300046530 Bacteria 9267
166 Ga0495654_0008952 3300046530 Bacteria 5501
167 Ga0495665_0066249 3300046531 Unclassified 1906
168 Ga0495640_0045644 3300046533 Bacteria 3040
169 Ga0495640_0075635 3300046533 Unclassified 2248
170 Ga0495640_0083803 3300046533 Bacteria 2115
171 Ga0495597_0000001 3300046542 Bacteria 1110529
172 Ga0495597_0000664 3300046542 Bacteria 27946
173 Ga0495667_0048917 3300046559 Unclassified 2791
174 Ga0495634_0023871 3300046642 Bacteria 4295
175 Ga0495635_0063429 3300046663 Bacteria 2537
176 Ga0495635_0114541 3300046663 Unclassified 1841
177 Ga0495588_0074052 3300046674 Bacteria 1774
178 Ga0495657_0101413 3300046675 Unclassified 1834
179 Ga0495599_0150915 3300046678 Bacteria 1439
180 Ga0495671_0002527 3300046692 Bacteria 11500
181 Ga0495600_0125908 3300046809 Unclassified 1666
182 Ga0495581_0080524 3300047315 Bacteria 1885
183 Ga0495604_0133108 3300047317 Unclassified 1785
184 Ga0495674_0023006 3300047319 Bacteria 5741
185 Ga0495672_0004667 3300047320 Bacteria 11103
186 Ga0495676_0067335 3300047321 Unclassified 2771
187 Ga0495676_0147113 3300047321 Unclassified 1681
188 Ga0495680_0003995 3300047322 Bacteria 14249
189 Ga0495677_0003599 3300047445 Bacteria 6010
190 Ga0495677_0081239 3300047445 Unclassified 1215
191 Ga0495673_0000116 3300047469 Bacteria 154310
192 Ga0495684_0005380 3300047471 Bacteria 9968
193 Ga0495684_0073267 3300047471 Unclassified 2602
194 Ga0495684_0076251 3300047471 Bacteria 2546
195 Ga0495686_0002092 3300047472 Bacteria 19598
196 Ga0496104_0051207 3300048907 Bacteria 3897
197 Ga0496104_0157480 3300048907 Bacteria 2179
198 Ga0496105_0146190 3300048908 Bacteria 1944
199 Ga0496108_0122892 3300048911 Unclassified 2228
200 Ga0496109_0168137 3300048912 Bacteria 2056
201 Ga0496110_0001302 3300048913 Bacteria 17928
202 Ga0496110_0021830 3300048913 Bacteria 5427
203 Ga0496112_0009932 3300048915 Bacteria 8610
204 Ga0496113_0086567 3300048916 Bacteria 2408
205 Ga0496113_0117019 3300048916 Bacteria 2080
206 Ga0496114_0095528 3300048917 Bacteria 2530
207 Ga0496115_0240807 3300048918 Bacteria 1491
208 Ga0495678_020172 3300049459 Unclassified 2957
209 Ga0501290_004967 3300049513 Bacteria 1661
210 Ga0501300_003844 3300049523 Bacteria 2235
211 Ga0501032_0066580 3300049569 Unclassified 2407
212 Ga0501033_0004329 3300049570 Bacteria 11389
213 Ga0501034_0000182 3300049571 Bacteria 117605
214 Ga0501034_0000595 3300049571 Bacteria 57174
215 Ga0501034_0001056 3300049571 Bacteria 39120
216 Ga0501034_0002770 3300049571 Bacteria 20554
217 Ga0501034_0002816 3300049571 Bacteria 20328
218 Ga0501034_0002886 3300049571 Bacteria 19984
219 Ga0501034_0004131 3300049571 Bacteria 16261
220 Ga0501034_0017628 3300049571 Bacteria 7321
221 Ga0501034_0022989 3300049571 Bacteria 6353
222 Ga0501034_0053685 3300049571 Bacteria 4058
223 Ga0501034_0118666 3300049571 Bacteria 2632
224 Ga0501034_0201763 3300049571 Unclassified 1946
225 Ga0501034_0213340 3300049571 Bacteria 1885
226 Ga0501034_0288965 3300049571 Bacteria 1578
227 Ga0501038_0022617 3300049574 Bacteria 5630
228 Ga0501043_0007441 3300049579 Bacteria 8695
229 Ga0501223_005941 3300049663 Bacteria 2546
230 Ga0501225_0001604 3300049705 Bacteria 7070
231 Ga0501035_0000494 3300049822 Bacteria 44339
232 Ga0501035_0002527 3300049822 Bacteria 17889
233 Ga0501035_0025432 3300049822 Bacteria 5428
234 Ga0501044_0028954 3300049823 Bacteria 5842
235 Ga0501044_0244957 3300049823 Bacteria 1735
236 Ga0501044_0293106 3300049823 Bacteria 1558
237 nmdc:mga00v17_2069_c1 3300050491 Bacteria 10332
238 nmdc:mga07m45_121580_c1 3300050496 Bacteria 1508
239 nmdc:mga05p37_286631_c1 3300050507 Bacteria 1962
240 nmdc:mga05p37_47071_c1 3300050507 Bacteria 5304
241 nmdc:mga05p37_57_c1 3300050507 Bacteria 96042
242 nmdc:mga09592_248985_c1 3300050508 Bacteria 1540
243 nmdc:mga09592_81608_c2 3300050508 Bacteria 2191
244 nmdc:mga06r32_133005_c1 3300050510 Bacteria 2461
245 nmdc:mga06r32_1829_c1 3300050510 Bacteria 18995
246 nmdc:mga08y16_153771_c1 3300050511 Bacteria 2391
247 nmdc:mga08y16_58801_c1 3300050511 Bacteria 4017
248 Ga0495601_0003461 3300053077 Bacteria 9052
249 Ga0495601_0008249 3300053077 Bacteria 6147
250 Ga0495601_0011171 3300053077 Bacteria 5363
251 Ga0495601_0041633 3300053077 Bacteria 2880
252 Ga0495612_0085967 3300053078 Unclassified 1326
253 Ga0495595_0029311 3300053084 Bacteria 2462
254 Ga0495595_0051984 3300053084 Bacteria 1900
255 Ga0495619_0013174 3300053085 Bacteria 5211
256 Ga0495619_0105941 3300053085 Bacteria 1917
257 Ga0500643_000804 3300053087 Bacteria 20293
258 Ga0500650_0040140 3300053098 Bacteria 2159
259 Ga0500555_000043 3300053103 Bacteria 64581
260 Ga0500655_000079 3300053133 Bacteria 25542
261 Ga0500622_0019147 3300053156 Bacteria 3636
262 Ga0500622_0022367 3300053156 Bacteria 3352
263 Ga0500627_0005534 3300053158 Bacteria 4204
264 Ga0466962_0020246 3300061719 Bacteria 3198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046461 Ga0495641_0094418 Ga0495641_0094418_312_1325 312
2 iso_pu_bacteria 8019538911 8019544441 318
3 3300049571 Ga0501034_0201763 Ga0501034_0201763_552_1526 322
4 3300026121 Ga0207683_10136237 Ga0207683_101362373 328
5 3300005327 Ga0070658_10021205 Ga0070658_100212055 335
6 3300025917 Ga0207660_10103567 Ga0207660_101035673 335
7 3300036712 Ga0316584_0153801 Ga0316584_0153801_255_1319 336
8 iso_pu_bacteria 2597489875 2597815097 337
9 3300049513 Ga0501290_004967 Ga0501290_004967_200_1297 343
10 3300049523 Ga0501300_003844 Ga0501300_003844_612_1709 343
11 3300009093 Ga0105240_10007316 Ga0105240_1000731618 344
12 3300046511 Ga0495608_0118110 Ga0495608_0118110_28_1155 345
13 3300047445 Ga0495677_0081239 Ga0495677_0081239_65_1192 345
14 3300046526 Ga0495666_0028038 Ga0495666_0028038_32_1129 347
15 3300049571 Ga0501034_0053685 Ga0501034_0053685_603_1700 347
16 3300046461 Ga0495641_0049163 Ga0495641_0049163_114_1262 351
17 3300046678 Ga0495599_0150915 Ga0495599_0150915_44_1138 354
18 3300035692 Ga0373935_0025920 Ga0373935_0025920_93_1289 358
19 3300047471 Ga0495684_0005380 Ga0495684_0005380_1327_2523 358
20 3300025909 Ga0207705_10102593 Ga0207705_101025931 359
21 3300025912 Ga0207707_10246531 Ga0207707_102465311 359
22 3300025921 Ga0207652_10310128 Ga0207652_103101281 359
23 3300038443 Ga0395901_0180959 Ga0395901_0180959_1095_2180 359
24 3300038443 Ga0395901_0000526 Ga0395901_0000526_34916_36031 361
25 3300049571 Ga0501034_0288965 Ga0501034_0288965_249_1343 361
26 3300048913 Ga0496110_0001302 Ga0496110_0001302_11114_12280 365
27 3300048917 Ga0496114_0095528 Ga0496114_0095528_164_1330 365
28 iso_pu_bacteria 2869278585 2869278825 366
29 3300037418 Ga0395900_0006055 Ga0395900_0006055_1536_2651 369
30 3300037466 Ga0395898_0020582 Ga0395898_0020582_2661_3776 369
31 3300048907 Ga0496104_0051207 Ga0496104_0051207_1324_2532 370
32 3300048908 Ga0496105_0146190 Ga0496105_0146190_160_1368 370
33 3300048912 Ga0496109_0168137 Ga0496109_0168137_263_1471 370
34 3300048913 Ga0496110_0021830 Ga0496110_0021830_227_1435 370
35 3300048915 Ga0496112_0009932 Ga0496112_0009932_237_1445 370
36 3300048916 Ga0496113_0117019 Ga0496113_0117019_253_1461 370
37 3300048918 Ga0496115_0240807 Ga0496115_0240807_251_1459 370
38 3300005455 Ga0070663_100176056 Ga0070663_1001760561 371
39 3300005544 Ga0070686_100084834 Ga0070686_1000848342 371
40 3300005564 Ga0070664_100274661 Ga0070664_1002746612 371
41 3300035170 Ga0373943_0091442 Ga0373943_0091442_333_1544 371
42 3300037068 Ga0373925_0169819 Ga0373925_0169819_216_1424 371
43 3300046473 Ga0495582_0108124 Ga0495582_0108124_190_1398 371
44 3300046531 Ga0495665_0066249 Ga0495665_0066249_485_1696 371
45 3300046533 Ga0495640_0075635 Ga0495640_0075635_220_1428 371
46 3300046559 Ga0495667_0048917 Ga0495667_0048917_1410_2618 371
47 3300046663 Ga0495635_0063429 Ga0495635_0063429_138_1346 371
48 3300046675 Ga0495657_0101413 Ga0495657_0101413_260_1468 371
49 3300046809 Ga0495600_0125908 Ga0495600_0125908_84_1292 371
50 3300047321 Ga0495676_0147113 Ga0495676_0147113_167_1375 371
51 3300047471 Ga0495684_0073267 Ga0495684_0073267_139_1347 371
52 3300048907 Ga0496104_0157480 Ga0496104_0157480_897_2105 371
53 3300053078 Ga0495612_0085967 Ga0495612_0085967_69_1277 371
54 3300025912 Ga0207707_10003175 Ga0207707_100031756 373
55 3300046524 Ga0495648_0012780 Ga0495648_0012780_406_1611 373
56 3300046530 Ga0495654_0008952 Ga0495654_0008952_1916_3121 373
57 iso_pu_bacteria 8054563764 8054564902 373
58 3300025292 Ga0209676_1000730 Ga0209676_100073028 374
59 iso_pu_bacteria 2935777560 2935782615 374
60 3300035691 Ga0373931_0137290 Ga0373931_0137290_20_1201 375
61 3300005439 Ga0070711_100000115 Ga0070711_10000011571 376
62 3300025916 Ga0207663_10000165 Ga0207663_1000016518 376
63 3300005548 Ga0070665_100029889 Ga0070665_1000298897 377
64 3300028379 Ga0268266_10256791 Ga0268266_102567912 377
65 3300037466 Ga0395898_0001029 Ga0395898_0001029_7302_8453 377
66 3300038443 Ga0395901_0010587 Ga0395901_0010587_1562_2713 377
67 iso_pu_bacteria 2599185156 2599335184 377
68 3300013104 Ga0157370_10052774 Ga0157370_100527741 378
69 3300041512 Ga0451853_2154476 Ga0451853_2154476_741_1916 378
70 3300053077 Ga0495601_0011171 Ga0495601_0011171_499_1671 378
71 3300053084 Ga0495595_0051984 Ga0495595_0051984_542_1714 378
72 3300053085 Ga0495619_0105941 Ga0495619_0105941_469_1641 378
73 3300009147 Ga0114129_10150424 Ga0114129_101504242 379
74 3300013308 Ga0157375_10478013 Ga0157375_104780131 379
75 3300035695 Ga0373927_0013430 Ga0373927_0013430_4130_5350 379
76 3300035725 Ga0373947_0043088 Ga0373947_0043088_39_1259 379
77 3300039450 Ga0436363_0650200 Ga0436363_0650200_318_1508 379
78 3300046674 Ga0495588_0074052 Ga0495588_0074052_511_1731 379
79 3300047321 Ga0495676_0067335 Ga0495676_0067335_703_1923 379
80 3300048911 Ga0496108_0122892 Ga0496108_0122892_235_1425 379
81 3300049822 Ga0501035_0002527 Ga0501035_0002527_13009_14154 379
82 3300049823 Ga0501044_0244957 Ga0501044_0244957_443_1588 379
83 3300053077 Ga0495601_0008249 Ga0495601_0008249_1179_2399 379
84 3300032168 Ga0316593_10031197 Ga0316593_100311972 380
85 3300049571 Ga0501034_0213340 Ga0501034_0213340_453_1604 380
86 3300005614 Ga0068856_100000227 Ga0068856_10000022750 381
87 3300026078 Ga0207702_10000533 Ga0207702_1000053355 381
88 iso_pu_bacteria 2842333319 2842338030 381
89 3300006948 Ga0099826_10000112 Ga0099826_1000011213 382
90 3300014497 Ga0182008_10004304 Ga0182008_100043046 382
91 3300015262 Ga0182007_10027128 Ga0182007_100271282 382
92 3300027666 Ga0209282_1000268 Ga0209282_10002681 382
93 3300047322 Ga0495680_0003995 Ga0495680_0003995_5308_6516 382
94 3300047469 Ga0495673_0000116 Ga0495673_0000116_113087_114295 382
95 3300005436 Ga0070713_100186925 Ga0070713_1001869251 383
96 3300009093 Ga0105240_10051044 Ga0105240_100510449 383
97 3300049571 Ga0501034_0002816 Ga0501034_0002816_18028_19227 383
98 3300049705 Ga0501225_0001604 Ga0501225_0001604_3026_4192 383
99 3300013104 Ga0157370_10030280 Ga0157370_100302803 384
100 3300028800 Ga0265338_10011875 Ga0265338_100118752 384
101 3300031241 Ga0265325_10000001 Ga0265325_10000001264 384
102 3300049571 Ga0501034_0017628 Ga0501034_0017628_5694_6860 384
103 3300049571 Ga0501034_0118666 Ga0501034_0118666_663_1913 384
104 3300009093 Ga0105240_10185711 Ga0105240_101857112 385
105 3300046512 Ga0495610_0003391 Ga0495610_0003391_4616_5833 385
106 3300049571 Ga0501034_0001056 Ga0501034_0001056_36037_37218 385
107 3300049571 Ga0501034_0002770 Ga0501034_0002770_451_1629 385
108 3300050496 nmdc:mga07m45_121580_c1 nmdc:mga07m45_121580_c1_276_1472 385
109 3300005336 Ga0070680_100130984 Ga0070680_1001309843 386
110 3300005458 Ga0070681_10290007 Ga0070681_102900071 386
111 3300005471 Ga0070698_100385475 Ga0070698_1003854751 386
112 3300005530 Ga0070679_100230098 Ga0070679_1002300982 386
113 3300031730 Ga0307516_10102777 Ga0307516_101027773 386
114 3300046471 Ga0495650_0000002 Ga0495650_0000002_936938_938203 386
115 3300025913 Ga0207695_10021533 Ga0207695_100215332 387
116 3300032004 Ga0307414_10000162 Ga0307414_1000016250 387
117 3300046512 Ga0495610_0000002 Ga0495610_0000002_1158568_1159845 387
118 3300046520 Ga0495637_0000010 Ga0495637_0000010_132509_133786 387
119 3300046522 Ga0495643_0000060 Ga0495643_0000060_21069_22343 387
120 3300046542 Ga0495597_0000001 Ga0495597_0000001_260960_262237 387
121 3300046692 Ga0495671_0002527 Ga0495671_0002527_9746_11023 387
122 3300047472 Ga0495686_0002092 Ga0495686_0002092_9347_10624 387
123 3300049459 Ga0495678_020172 Ga0495678_020172_1657_2931 387
124 iso_pu_bacteria 2816332527 2818239110 387
125 iso_pu_bacteria 2881364244 2881365506 387
126 3300006042 Ga0075368_10021141 Ga0075368_100211411 388
127 3300006051 Ga0075364_10003727 Ga0075364_100037276 388
128 3300006844 Ga0075428_100167868 Ga0075428_1001678681 388
129 3300006847 Ga0075431_100169950 Ga0075431_1001699502 388
130 3300006880 Ga0075429_100242013 Ga0075429_1002420131 388
131 3300009094 Ga0111539_10004711 Ga0111539_1000471121 388
132 3300009147 Ga0114129_10349772 Ga0114129_103497722 388
133 3300028794 Ga0307515_10001540 Ga0307515_1000154051 388
134 3300031911 Ga0307412_10000347 Ga0307412_100003479 388
135 3300046506 Ga0495583_0000120 Ga0495583_0000120_43751_44998 388
136 3300047320 Ga0495672_0004667 Ga0495672_0004667_8058_9317 388
137 3300049822 Ga0501035_0025432 Ga0501035_0025432_3990_5198 388
138 3300049823 Ga0501044_0293106 Ga0501044_0293106_83_1291 388
139 3300050491 nmdc:mga00v17_2069_c1 nmdc:mga00v17_2069_c1_727_1959 388
140 3300050507 nmdc:mga05p37_286631_c1 nmdc:mga05p37_286631_c1_436_1605 388
141 3300050508 nmdc:mga09592_248985_c1 nmdc:mga09592_248985_c1_64_1233 388
142 3300050510 nmdc:mga06r32_133005_c1 nmdc:mga06r32_133005_c1_358_1527 388
143 3300050511 nmdc:mga08y16_153771_c1 nmdc:mga08y16_153771_c1_382_1551 388
144 3300053098 Ga0500650_0040140 Ga0500650_0040140_588_1847 388
145 3300053103 Ga0500555_000043 Ga0500555_000043_3617_4864 388
146 3300005356 Ga0070674_100197420 Ga0070674_1001974201 389
147 3300013104 Ga0157370_10138110 Ga0157370_101381101 389
148 3300030522 Ga0307512_10075062 Ga0307512_100750623 389
149 3300046530 Ga0495654_0003712 Ga0495654_0003712_279_1481 389
150 3300049571 Ga0501034_0000182 Ga0501034_0000182_115984_117168 389
151 3300053133 Ga0500655_000079 Ga0500655_000079_15601_16872 389
152 3300053158 Ga0500627_0005534 Ga0500627_0005534_257_1459 389
153 3300005327 Ga0070658_10003702 Ga0070658_1000370217 390
154 3300005563 Ga0068855_100008309 Ga0068855_1000083092 390
155 3300013105 Ga0157369_10007532 Ga0157369_100075322 390
156 3300025297 Ga0209758_1013385 Ga0209758_10133854 390
157 3300025909 Ga0207705_10003165 Ga0207705_1000316518 390
158 3300025949 Ga0207667_10025397 Ga0207667_100253977 390
159 3300031691 Ga0316579_10035671 Ga0316579_100356712 390
160 3300031728 Ga0316578_10081585 Ga0316578_100815852 390
161 3300032139 Ga0316580_10016751 Ga0316580_100167512 390
162 3300033541 Ga0316596_1023195 Ga0316596_10231952 390
163 3300049571 Ga0501034_0004131 Ga0501034_0004131_11976_13166 390
164 iso_pu_bacteria 2513237305 2514422945 390
165 iso_pu_bacteria 2721755686 2723573606 390
166 3300009093 Ga0105240_10003971 Ga0105240_100039719 391
167 3300013102 Ga0157371_10036654 Ga0157371_100366543 391
168 3300025913 Ga0207695_10003464 Ga0207695_100034649 391
169 3300046542 Ga0495597_0000664 Ga0495597_0000664_24945_26195 391
170 3300049571 Ga0501034_0000595 Ga0501034_0000595_55551_56753 391
171 iso_pu_bacteria 2818991454 2819645366 391
172 iso_pu_bacteria 2919513703 2919516317 391
173 iso_pu_bacteria 2919675420 2919676845 391
174 3300009093 Ga0105240_10052520 Ga0105240_100525205 392
175 3300025913 Ga0207695_10025568 Ga0207695_100255682 392
176 3300041404 Ga0439436_0006413 Ga0439436_0006413_2119_3351 392
177 3300049571 Ga0501034_0000182 Ga0501034_0000182_54957_56162 392
178 iso_pu_bacteria 2990710928 2990713186 392
179 3300005331 Ga0070670_100161097 Ga0070670_1001610971 393
180 3300006847 Ga0075431_100000047 Ga0075431_10000004756 393
181 3300009147 Ga0114129_10001108 Ga0114129_100011088 393
182 3300031249 Ga0265339_10000093 Ga0265339_100000932 393
183 3300031691 Ga0316579_10000750 Ga0316579_100007508 393
184 3300031727 Ga0316576_10053623 Ga0316576_100536231 393
185 3300031728 Ga0316578_10003982 Ga0316578_100039821 393
186 3300031733 Ga0316577_10021648 Ga0316577_100216482 393
187 3300032137 Ga0316585_10000549 Ga0316585_1000054911 393
188 3300032139 Ga0316580_10000646 Ga0316580_100006462 393
189 3300032168 Ga0316593_10002419 Ga0316593_100024196 393
190 3300033524 Ga0316592_1018887 Ga0316592_10188871 393
191 3300035398 Ga0316574_0000473 Ga0316574_0000473_6339_7583 393
192 3300036647 Ga0316582_0000251 Ga0316582_0000251_6843_8087 393
193 3300036712 Ga0316584_0016159 Ga0316584_0016159_3986_5230 393
194 3300044683 Ga0466965_0007100 Ga0466965_0007100_349_1584 393
195 3300044706 Ga0466964_0006798 Ga0466964_0006798_2119_3354 393
196 3300044735 Ga0466968_0006198 Ga0466968_0006198_244_1479 393
197 3300044842 Ga0466957_0005503 Ga0466957_0005503_5658_6893 393
198 3300049569 Ga0501032_0066580 Ga0501032_0066580_611_1813 393
199 3300050507 nmdc:mga05p37_57_c1 nmdc:mga05p37_57_c1_92659_93879 393
200 3300050510 nmdc:mga06r32_1829_c1 nmdc:mga06r32_1829_c1_1385_2605 393
201 3300061719 Ga0466962_0020246 Ga0466962_0020246_1451_2686 393
202 iso_pu_bacteria 2970540015 2970540106 393
203 3300005288 Ga0065714_10100516 Ga0065714_101005161 394
204 3300005329 Ga0070683_100142583 Ga0070683_1001425832 394
205 3300046529 Ga0495652_0031462 Ga0495652_0031462_1143_2363 394
206 3300046642 Ga0495634_0023871 Ga0495634_0023871_2917_4206 394
207 3300046663 Ga0495635_0114541 Ga0495635_0114541_116_1405 394
208 3300049571 Ga0501034_0002886 Ga0501034_0002886_4733_5950 394
209 3300049571 Ga0501034_0022989 Ga0501034_0022989_183_1415 394
210 iso_pu_bacteria 2856320880 2856323681 394
211 iso_pu_bacteria 2958034702 2958034941 394
212 iso_pu_bacteria 2958041894 2958042930 394
213 iso_pu_bacteria 2970593180 2970593421 394
214 iso_pu_bacteria 3004334049 3004340385 394
215 3300005467 Ga0070706_100194592 Ga0070706_1001945922 395
216 3300006195 Ga0075366_10083825 Ga0075366_100838252 395
217 3300025913 Ga0207695_10005895 Ga0207695_1000589515 395
218 3300035170 Ga0373943_0000209 Ga0373943_0000209_22392_23672 395
219 3300035695 Ga0373927_0000682 Ga0373927_0000682_1698_2978 395
220 3300035725 Ga0373947_0000365 Ga0373947_0000365_8835_10115 395
221 3300046460 Ga0495638_0000666 Ga0495638_0000666_1437_2687 395
222 3300046517 Ga0495630_0019668 Ga0495630_0019668_339_1619 395
223 3300046533 Ga0495640_0045644 Ga0495640_0045644_754_2034 395
224 3300047315 Ga0495581_0080524 Ga0495581_0080524_201_1481 395
225 3300005434 Ga0070709_10171841 Ga0070709_101718411 396
226 3300005436 Ga0070713_100304566 Ga0070713_1003045662 396
227 3300005614 Ga0068856_100313655 Ga0068856_1003136552 396
228 3300006028 Ga0070717_10317499 Ga0070717_103174992 396
229 3300006844 Ga0075428_100047977 Ga0075428_1000479776 396
230 3300009147 Ga0114129_10081818 Ga0114129_100818181 396
231 3300026078 Ga0207702_10335245 Ga0207702_103352452 396
232 3300046463 Ga0495653_0034113 Ga0495653_0034113_2197_3429 396
233 3300046477 Ga0495664_0005477 Ga0495664_0005477_2815_4047 396
234 3300047317 Ga0495604_0133108 Ga0495604_0133108_285_1517 396
235 3300047319 Ga0495674_0023006 Ga0495674_0023006_3322_4554 396
236 3300048916 Ga0496113_0086567 Ga0496113_0086567_77_1303 396
237 3300049663 Ga0501223_005941 Ga0501223_005941_108_1367 396
238 3300053077 Ga0495601_0003461 Ga0495601_0003461_4881_6113 396
239 3300053085 Ga0495619_0013174 Ga0495619_0013174_2928_4160 396
240 3300005457 Ga0070662_100150546 Ga0070662_1001505462 397
241 3300005614 Ga0068856_100113352 Ga0068856_1001133522 397
242 3300009094 Ga0111539_10062791 Ga0111539_100627914 397
243 3300009147 Ga0114129_10038819 Ga0114129_100388191 397
244 3300010375 Ga0105239_10082577 Ga0105239_100825772 397
245 3300025924 Ga0207694_10083508 Ga0207694_100835083 397
246 3300025933 Ga0207706_10141924 Ga0207706_101419242 397
247 3300028800 Ga0265338_10000028 Ga0265338_10000028180 397
248 3300049570 Ga0501033_0004329 Ga0501033_0004329_7393_8592 397
249 3300049574 Ga0501038_0022617 Ga0501038_0022617_279_1478 397
250 3300049579 Ga0501043_0007441 Ga0501043_0007441_7218_8417 397
251 3300049822 Ga0501035_0000494 Ga0501035_0000494_31436_32635 397
252 3300049823 Ga0501044_0028954 Ga0501044_0028954_4362_5561 397
253 3300050507 nmdc:mga05p37_47071_c1 nmdc:mga05p37_47071_c1_257_1513 397
254 3300050508 nmdc:mga09592_81608_c2 nmdc:mga09592_81608_c2_28_1284 397
255 3300050511 nmdc:mga08y16_58801_c1 nmdc:mga08y16_58801_c1_1262_2518 397
256 3300005467 Ga0070706_100014202 Ga0070706_10001420210 398
257 3300005471 Ga0070698_100058757 Ga0070698_1000587575 398
258 3300006028 Ga0070717_10047469 Ga0070717_100474692 398
259 3300041507 Ga0451851_0312888 Ga0451851_0312888_63_1370 398
260 3300046519 Ga0495632_0054261 Ga0495632_0054261_208_1518 398
261 3300046524 Ga0495648_0098916 Ga0495648_0098916_54_1316 398
262 3300010375 Ga0105239_10005341 Ga0105239_1000534115 399
263 3300046533 Ga0495640_0083803 Ga0495640_0083803_298_1551 400
264 3300047471 Ga0495684_0076251 Ga0495684_0076251_752_2005 400
265 3300053077 Ga0495601_0041633 Ga0495601_0041633_1330_2583 400
266 3300005616 Ga0068852_100034556 Ga0068852_1000345563 409
267 3300026142 Ga0207698_10024016 Ga0207698_100240163 409
268 3300046506 Ga0495583_0015529 Ga0495583_0015529_73_1305 410
269 3300047445 Ga0495677_0003599 Ga0495677_0003599_4019_5251 410
270 3300053087 Ga0500643_000804 Ga0500643_000804_11230_12462 410
271 3300053084 Ga0495595_0029311 Ga0495595_0029311_975_2363 411
272 3300053156 Ga0500622_0022367 Ga0500622_0022367_1789_3123 412
273 3300053156 Ga0500622_0019147 Ga0500622_0019147_97_1434 413
274 3300001915 JGI24741J21665_1000649 JGI24741J21665_100064911 423
275 3300001979 JGI24740J21852_10000019 JGI24740J21852_100000192 423
276 3300005455 Ga0070663_100000022 Ga0070663_1000000221 423
277 3300005614 Ga0068856_100000041 Ga0068856_1000000411 423
278 3300009174 Ga0105241_10000037 Ga0105241_100000374 423
279 3300009551 Ga0105238_10006919 Ga0105238_1000691911 423
280 3300013100 Ga0157373_10000046 Ga0157373_1000004699 423
281 3300013104 Ga0157370_10000071 Ga0157370_1000007199 423
282 3300025911 Ga0207654_10000032 Ga0207654_10000032110 423
283 3300025924 Ga0207694_10010035 Ga0207694_100100353 423
284 3300026067 Ga0207678_10006433 Ga0207678_100064331 423
285 3300026078 Ga0207702_10000061 Ga0207702_100000614 423
286 3300026116 Ga0207674_10129262 Ga0207674_101292623 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22022

Phage_int_M

Phage integrase central domain

157

252

0.99

PF13356

Arm-DNA-bind_3

Arm DNA-binding domain

50

143

0.87

PF00589

Phage_integrase

Phage integrase family

271

429

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2khv-assembly1.cif.gz_A solution nmr structure of protein nmul_a0922 from nitrosospira multiformis. northeast structural genomics consortium target nmr38b. 0.9309 115 214
3ju0-assembly1.cif.gz_A structure of the arm-type binding domain of hai7 integrase 0.8785 19 96
2khv-assembly1.cif.gz_A solution nmr structure of protein nmul_a0922 from nitrosospira multiformis. northeast structural genomics consortium target nmr38b. 0.873 115 214
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.8687 116 207
2oxo-assembly1.cif.gz_A crystallization and structure determination of the core-binding domain of bacteriophage lambda integrase 0.8585 115 208
ID Description Score Start End Superfamily
2khvA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9465 115 199 1.10.150.130
af_P39347_1_63_3.30.160.390 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Integrase, DNA-binding domain 0.9394 43 102 3.30.160.390
2khvA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.936 115 199 1.10.150.130
af_P37326_196_376_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.9334 228 402 1.10.443.10
af_P76542_209_389_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.932 231 406 1.10.443.10
ID Description Score Start End GO Terms
AF-A0A826J6A7-F1-model_v4 Integrase 0.9874 258 405 GO:0003677
GO:0006310
GO:0015074
AF-A0A4R3XGU4-F1-model_v4 deleted 0.9765 232 407
AF-A0A4R3XGU4-F1-model_v4 deleted 0.9603 232 407
AF-A0A257JH29-F1-model_v4 Tyr recombinase domain-containing protein 0.9516 248 405 GO:0003677
GO:0006310
GO:0015074
AF-A0A1H6RB47-F1-model_v4 Phage integrase family protein 0.9504 232 408 GO:0003677
GO:0006310
GO:0015074

Feature Viewer

pLDDT pTM Quality
84.19 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map