F388134

General Info

Members Datasets Scaffolds Average Seq Length
287 157 574 125

Family's Representative Sequence

Representative Sequence 3300041458|Ga0451798_0350630|Ga0451798_0350630_16_447
Length 143
Sequence VSNTQSNTFQTQIRIKKNIMNIQIRKFYYGDIPEDKSGADMKDSSLPSGVGADWPLWEVFIRSKQGLDHKHAGSLHAADAQMAIENARDVYCRRNEGASIWVVLSSDITANNPQESEELFDPAEDKIYRHPTFYHVPEGVKHL

Samples

Sample ID Description Type Environment
1 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
139 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
140 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
141 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 1.05
Rhizosphere 95.47
Stem 0
Stem Tuber 0
Unclassified 22.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451798_0350630 3300041458 Unclassified 547
2 Ga0065704_10824802 3300005289 Unclassified 517
3 Ga0065712_10085213 3300005290 Unclassified 2711
4 Ga0065715_10232931 3300005293 Bacteria 1227
5 Ga0065707_10567184 3300005295 Bacteria 710
6 Ga0070658_10433181 3300005327 Bacteria 1132
7 Ga0070658_11205325 3300005327 Unclassified 658
8 Ga0070676_10033234 3300005328 Bacteria 2959
9 Ga0070676_10217512 3300005328 Unclassified 1260
10 Ga0070683_101093015 3300005329 Unclassified 766
11 Ga0070670_100018268 3300005331 Bacteria 6015
12 Ga0070670_101203649 3300005331 Bacteria 692
13 Ga0070677_10193673 3300005333 Bacteria 976
14 Ga0068869_100037236 3300005334 Bacteria 3458
15 Ga0068869_100254357 3300005334 Bacteria 1404
16 Ga0068869_100611134 3300005334 Bacteria 922
17 Ga0068869_101336914 3300005334 Unclassified 633
18 Ga0070666_10111554 3300005335 Bacteria 1892
19 Ga0070680_101411566 3300005336 Bacteria 603
20 Ga0068868_100275165 3300005338 Bacteria 1423
21 Ga0070689_100247479 3300005340 Unclassified 1470
22 Ga0070689_100591707 3300005340 Bacteria 960
23 Ga0070687_100086050 3300005343 Bacteria 1727
24 Ga0070668_100025010 3300005347 Unclassified 4525
25 Ga0070668_100034555 3300005347 Bacteria 3853
26 Ga0070668_100622873 3300005347 Bacteria 946
27 Ga0070669_100144053 3300005353 Bacteria 1839
28 Ga0070675_100021358 3300005354 Bacteria 5173
29 Ga0070675_100079437 3300005354 Unclassified 2733
30 Ga0070671_101666201 3300005355 Bacteria 566
31 Ga0070674_100067848 3300005356 Bacteria 2510
32 Ga0070674_100095546 3300005356 Bacteria 2155
33 Ga0070673_100045892 3300005364 Unclassified 3391
34 Ga0070673_101718351 3300005364 Bacteria 594
35 Ga0070688_100008553 3300005365 Bacteria 5563
36 Ga0070659_101657555 3300005366 Bacteria 572
37 Ga0070667_100273454 3300005367 Bacteria 1515
38 Ga0070701_10047024 3300005438 Unclassified 2221
39 Ga0070700_100060573 3300005441 Unclassified 2386
40 Ga0070694_101147981 3300005444 Unclassified 649
41 Ga0070662_100481182 3300005457 Bacteria 1034
42 Ga0070662_100734462 3300005457 Bacteria 837
43 Ga0068867_100033959 3300005459 Unclassified 3697
44 Ga0068867_100037980 3300005459 Unclassified 3503
45 Ga0068867_100118408 3300005459 Bacteria 2043
46 Ga0068867_100220480 3300005459 Unclassified 1528
47 Ga0068867_100576718 3300005459 Bacteria 978
48 Ga0068867_100702189 3300005459 Bacteria 893
49 Ga0068867_101061446 3300005459 Bacteria 737
50 Ga0070685_10230848 3300005466 Bacteria 1217
51 Ga0070685_10766066 3300005466 Bacteria 709
52 Ga0070679_100030783 3300005530 Bacteria 5300
53 Ga0068853_100412150 3300005539 Unclassified 1266
54 Ga0068853_100482165 3300005539 Bacteria 1169
55 Ga0068853_100524997 3300005539 Bacteria 1119
56 Ga0070672_100035787 3300005543 Unclassified 3775
57 Ga0070672_100191597 3300005543 Unclassified 1707
58 Ga0070672_100248241 3300005543 Bacteria 1498
59 Ga0070686_100514455 3300005544 Bacteria 931
60 Ga0070686_101230013 3300005544 Bacteria 623
61 Ga0070665_100040736 3300005548 Bacteria 4668
62 Ga0070704_101025859 3300005549 Bacteria 747
63 Ga0068855_100755970 3300005563 Bacteria 1036
64 Ga0068854_100071435 3300005578 Bacteria 2539
65 Ga0068854_100218340 3300005578 Unclassified 1507
66 Ga0068852_101107226 3300005616 Bacteria 812
67 Ga0068852_102216405 3300005616 Bacteria 571
68 Ga0068852_102228622 3300005616 Unclassified 569
69 Ga0068852_102474333 3300005616 Bacteria 539
70 Ga0068859_100078153 3300005617 Unclassified 3349
71 Ga0068859_100112106 3300005617 Bacteria 2790
72 Ga0068859_100137491 3300005617 Bacteria 2517
73 Ga0068864_100125717 3300005618 Bacteria 2298
74 Ga0068864_101245822 3300005618 Bacteria 743
75 Ga0068864_101961286 3300005618 Bacteria 591
76 Ga0068866_10011825 3300005718 Bacteria 3789
77 Ga0068861_100123561 3300005719 Bacteria 2091
78 Ga0068861_100148106 3300005719 Unclassified 1923
79 Ga0068861_100255793 3300005719 Bacteria 1497
80 Ga0068861_100269865 3300005719 Bacteria 1460
81 Ga0068851_10322286 3300005834 Bacteria 893
82 Ga0068851_11110477 3300005834 Unclassified 502
83 Ga0068870_10009534 3300005840 Unclassified 4423
84 Ga0068863_100161183 3300005841 Bacteria 2149
85 Ga0068863_100426835 3300005841 Bacteria 1299
86 Ga0068863_101055980 3300005841 Bacteria 816
87 Ga0068858_100801266 3300005842 Bacteria 919
88 Ga0068860_100071120 3300005843 Bacteria 3307
89 Ga0068860_100237696 3300005843 Bacteria 1771
90 Ga0068860_100299101 3300005843 Unclassified 1576
91 Ga0068860_100389969 3300005843 Unclassified 1376
92 Ga0068860_102481588 3300005843 Bacteria 538
93 Ga0068862_100047695 3300005844 Unclassified 3657
94 Ga0068862_100066206 3300005844 Bacteria 3113
95 Ga0068862_100431393 3300005844 Bacteria 1239
96 Ga0068862_100683895 3300005844 Bacteria 992
97 Ga0068862_100703514 3300005844 Unclassified 979
98 Ga0068862_100910544 3300005844 Bacteria 865
99 Ga0068862_101695252 3300005844 Bacteria 640
100 Ga0075366_10886635 3300006195 Bacteria 556
101 Ga0097621_100260464 3300006237 Bacteria 1521
102 Ga0097621_101863152 3300006237 Bacteria 574
103 Ga0068871_100029335 3300006358 Unclassified 4319
104 Ga0068871_100920260 3300006358 Bacteria 811
105 Ga0075428_100963243 3300006844 Bacteria 904
106 Ga0075429_100655881 3300006880 Bacteria 919
107 Ga0068865_100163891 3300006881 Unclassified 1698
108 Ga0068865_100556544 3300006881 Bacteria 964
109 Ga0097620_100078153 3300006931 Unclassified 3349
110 Ga0097620_100112105 3300006931 Bacteria 2790
111 Ga0097620_100137491 3300006931 Bacteria 2517
112 Ga0111539_10017557 3300009094 Bacteria 8856
113 Ga0105247_10001649 3300009101 Bacteria 15780
114 Ga0105247_10382603 3300009101 Bacteria 998
115 Ga0105243_11023076 3300009148 Bacteria 830
116 Ga0105241_10005645 3300009174 Bacteria 9230
117 Ga0105241_10079832 3300009174 Bacteria 2559
118 Ga0105241_11649277 3300009174 Bacteria 622
119 Ga0105242_10084681 3300009176 Bacteria 2657
120 Ga0105242_10273641 3300009176 Unclassified 1531
121 Ga0105242_12112654 3300009176 Unclassified 607
122 Ga0105242_12505286 3300009176 Bacteria 564
123 Ga0105249_10001666 3300009553 Bacteria 19481
124 Ga0105249_10014727 3300009553 Bacteria 6913
125 Ga0105249_10147884 3300009553 Bacteria 2259
126 Ga0105249_10152963 3300009553 Bacteria 2223
127 Ga0105249_10757410 3300009553 Bacteria 1033
128 Ga0105249_10968605 3300009553 Bacteria 919
129 Ga0105239_11448984 3300010375 Bacteria 793
130 Ga0105239_11674526 3300010375 Bacteria 736
131 Ga0105246_10197287 3300011119 Bacteria 1562
132 Ga0157369_10046481 3300013105 Bacteria 4717
133 Ga0157374_10118187 3300013296 Unclassified 2556
134 Ga0157378_10022575 3300013297 Bacteria 5537
135 Ga0157378_10195818 3300013297 Unclassified 1909
136 Ga0157378_10265416 3300013297 Bacteria 1649
137 Ga0163162_10209436 3300013306 Unclassified 2079
138 Ga0163162_10505053 3300013306 Bacteria 1339
139 Ga0163162_11605292 3300013306 Bacteria 742
140 Ga0163162_12781566 3300013306 Bacteria 563
141 Ga0163162_12829196 3300013306 Bacteria 558
142 Ga0157372_10049589 3300013307 Bacteria 4669
143 Ga0157372_11601109 3300013307 Bacteria 750
144 Ga0157375_10201748 3300013308 Bacteria 2145
145 Ga0157375_10218278 3300013308 Bacteria 2065
146 Ga0157375_10237259 3300013308 Bacteria 1983
147 Ga0157375_10273886 3300013308 Bacteria 1850
148 Ga0157375_10521729 3300013308 Unclassified 1351
149 Ga0163163_10256482 3300014325 Bacteria 1799
150 Ga0157380_10013266 3300014326 Bacteria 6004
151 Ga0157380_10265759 3300014326 Bacteria 1561
152 Ga0157380_10350267 3300014326 Bacteria 1381
153 Ga0157377_10069689 3300014745 Unclassified 2030
154 Ga0157377_10308356 3300014745 Bacteria 1047
155 Ga0157376_11580282 3300014969 Bacteria 690
156 Ga0182005_1101469 3300015265 Bacteria 807
157 Ga0163161_10777669 3300017792 Bacteria 803
158 Ga0207666_1035473 3300025271 Bacteria 773
159 Ga0207697_10016616 3300025315 Bacteria 3031
160 Ga0207656_10293646 3300025321 Bacteria 803
161 Ga0207642_10030740 3300025899 Bacteria 2241
162 Ga0207642_10229823 3300025899 Bacteria 1041
163 Ga0207642_10372103 3300025899 Bacteria 848
164 Ga0207710_10000732 3300025900 Bacteria 18146
165 Ga0207688_10002060 3300025901 Bacteria 10803
166 Ga0207680_10142405 3300025903 Bacteria 1590
167 Ga0207647_10411566 3300025904 Bacteria 761
168 Ga0207645_10006983 3300025907 Bacteria 8039
169 Ga0207645_10040987 3300025907 Bacteria 2965
170 Ga0207645_10616060 3300025907 Bacteria 737
171 Ga0207643_10003655 3300025908 Bacteria 8289
172 Ga0207705_10750099 3300025909 Bacteria 758
173 Ga0207654_11049534 3300025911 Bacteria 593
174 Ga0207662_10490788 3300025918 Bacteria 845
175 Ga0207652_11703174 3300025921 Bacteria 535
176 Ga0207681_10023454 3300025923 Unclassified 3947
177 Ga0207681_10173871 3300025923 Bacteria 1635
178 Ga0207681_10456790 3300025923 Bacteria 1040
179 Ga0207681_10611479 3300025923 Bacteria 901
180 Ga0207694_11872031 3300025924 Bacteria 504
181 Ga0207650_10178837 3300025925 Bacteria 1690
182 Ga0207650_10285118 3300025925 Unclassified 1346
183 Ga0207650_10333587 3300025925 Bacteria 1244
184 Ga0207659_10312912 3300025926 Bacteria 1293
185 Ga0207659_10357863 3300025926 Bacteria 1212
186 Ga0207706_10081459 3300025933 Bacteria 2844
187 Ga0207706_10784531 3300025933 Bacteria 810
188 Ga0207686_10148855 3300025934 Bacteria 1627
189 Ga0207686_10545713 3300025934 Bacteria 906
190 Ga0207670_10041661 3300025936 Unclassified 3021
191 Ga0207670_10591285 3300025936 Bacteria 910
192 Ga0207669_10113546 3300025937 Bacteria 1821
193 Ga0207669_10230907 3300025937 Bacteria 1365
194 Ga0207704_10315737 3300025938 Bacteria 1203
195 Ga0207704_10782827 3300025938 Bacteria 795
196 Ga0207691_10096809 3300025940 Unclassified 2638
197 Ga0207691_10247780 3300025940 Unclassified 1539
198 Ga0207691_10502339 3300025940 Bacteria 1030
199 Ga0207689_10006891 3300025942 Bacteria 9992
200 Ga0207689_10007391 3300025942 Bacteria 9634
201 Ga0207689_10280663 3300025942 Unclassified 1379
202 Ga0207667_11158097 3300025949 Bacteria 754
203 Ga0207651_10010493 3300025960 Bacteria 5138
204 Ga0207712_10014745 3300025961 Bacteria 5032
205 Ga0207712_10102868 3300025961 Bacteria 2127
206 Ga0207712_10198207 3300025961 Bacteria 1590
207 Ga0207712_10237620 3300025961 Unclassified 1466
208 Ga0207712_10504425 3300025961 Bacteria 1035
209 Ga0207712_10667852 3300025961 Bacteria 904
210 Ga0207668_10117121 3300025972 Bacteria 2010
211 Ga0207668_10938630 3300025972 Bacteria 771
212 Ga0207668_11261152 3300025972 Bacteria 665
213 Ga0207640_10101373 3300025981 Unclassified 2020
214 Ga0207640_10141516 3300025981 Unclassified 1754
215 Ga0207640_10958183 3300025981 Bacteria 750
216 Ga0207658_10440405 3300025986 Bacteria 1152
217 Ga0207658_10615080 3300025986 Bacteria 977
218 Ga0207677_10151628 3300026023 Unclassified 1789
219 Ga0207677_10736642 3300026023 Unclassified 877
220 Ga0207703_10541449 3300026035 Unclassified 1097
221 Ga0207703_10793472 3300026035 Bacteria 904
222 Ga0207639_10219546 3300026041 Unclassified 1641
223 Ga0207639_11610589 3300026041 Bacteria 609
224 Ga0207708_10252401 3300026075 Bacteria 1422
225 Ga0207708_10798480 3300026075 Bacteria 812
226 Ga0207641_10081910 3300026088 Bacteria 2803
227 Ga0207648_10001526 3300026089 Bacteria 25504
228 Ga0207648_10058798 3300026089 Bacteria 3352
229 Ga0207648_10130877 3300026089 Bacteria 2208
230 Ga0207648_10148231 3300026089 Bacteria 2070
231 Ga0207648_10280073 3300026089 Bacteria 1491
232 Ga0207676_10191588 3300026095 Bacteria 1799
233 Ga0207674_10096117 3300026116 Unclassified 2948
234 Ga0207675_100006933 3300026118 Bacteria 10720
235 Ga0207675_100008796 3300026118 Bacteria 9478
236 Ga0207675_100167181 3300026118 Bacteria 2101
237 Ga0207675_100868704 3300026118 Bacteria 917
238 Ga0207683_10006324 3300026121 Bacteria 10144
239 Ga0207698_11099525 3300026142 Bacteria 808
240 Ga0207428_10074933 3300027907 Unclassified 2653
241 Ga0268266_10470807 3300028379 Bacteria 1196
242 Ga0268266_11812297 3300028379 Bacteria 585
243 Ga0268265_10121527 3300028380 Unclassified 2152
244 Ga0268265_10469372 3300028380 Bacteria 1179
245 Ga0268265_10500630 3300028380 Unclassified 1145
246 Ga0268265_11493452 3300028380 Bacteria 679
247 Ga0268264_10052789 3300028381 Unclassified 3390
248 Ga0268264_10057818 3300028381 Unclassified 3245
249 Ga0268264_10453741 3300028381 Bacteria 1242
250 Ga0265336_10089676 3300028666 Bacteria 916
251 Ga0265338_10204614 3300028800 Bacteria 1486
252 Ga0265324_10134535 3300029957 Bacteria 839
253 Ga0265331_10114315 3300031250 Bacteria 1236
254 Ga0265327_10000046 3300031251 Bacteria 280722
255 Ga0265316_10694639 3300031344 Bacteria 717
256 Ga0307516_10108579 3300031730 Bacteria 2582
257 Ga0307414_10426491 3300032004 Bacteria 1158
258 Ga0307414_11870563 3300032004 Bacteria 560
259 Ga0436365_0224154 3300039437 Bacteria 909
260 Ga0436365_1586348 3300039437 Bacteria 723
261 Ga0436365_1890468 3300039437 Bacteria 4997
262 Ga0451791_1755655 3300041451 Bacteria 641
263 Ga0451807_2212303 3300041486 Bacteria 633
264 Ga0451835_1097785 3300041492 Unclassified 784
265 Ga0439431_0071074 3300041997 Unclassified 927
266 Ga0439441_157993 3300042001 Bacteria 537
267 Ga0439442_007002 3300042002 Bacteria 2265
268 Ga0439445_0017597 3300042004 Unclassified 1768
269 Ga0450894_016876 3300042131 Bacteria 970
270 Ga0450898_009219 3300042134 Bacteria 1575
271 Ga0439446_0168213 3300042156 Bacteria 728
272 Ga0439434_0005952 3300042435 Unclassified 3562
273 Ga0466972_0123180 3300044658 Unclassified 1222
274 Ga0495650_0011666 3300046471 Bacteria 4791
275 Ga0495643_0345026 3300046522 Bacteria 668
276 Ga0495598_0126917 3300046537 Bacteria 871
277 Ga0495645_0954680 3300046543 Bacteria 506
278 Ga0495668_0000023 3300046616 Bacteria 363848
279 Ga0495625_0878328 3300046660 Bacteria 516
280 Ga0495672_0008179 3300047320 Bacteria 7758
281 Ga0495686_0536882 3300047472 Bacteria 612
282 Ga0501070_0914024 3300049586 Bacteria 684
283 nmdc:mga0k408_241642_c1 3300050493 Bacteria 1078
284 nmdc:mga0k408_777212_c1 3300050493 Bacteria 559
285 nmdc:mga08y16_71383_c1 3300050511 Unclassified 3619
286 Ga0500592_002656 3300053116 Bacteria 2874
287 Ga0500616_0008932 3300053153 Bacteria 6142
288 Ga0451798_0350630
289 Ga0065704_10824802
290 Ga0065712_10085213
291 Ga0065715_10232931
292 Ga0065707_10567184
293 Ga0070658_10433181
294 Ga0070658_11205325
295 Ga0070676_10033234
296 Ga0070676_10217512
297 Ga0070683_101093015
298 Ga0070670_100018268
299 Ga0070670_101203649
300 Ga0070677_10193673
301 Ga0068869_100037236
302 Ga0068869_100254357
303 Ga0068869_100611134
304 Ga0068869_101336914
305 Ga0070666_10111554
306 Ga0070680_101411566
307 Ga0068868_100275165
308 Ga0070689_100247479
309 Ga0070689_100591707
310 Ga0070687_100086050
311 Ga0070668_100025010
312 Ga0070668_100034555
313 Ga0070668_100622873
314 Ga0070669_100144053
315 Ga0070675_100021358
316 Ga0070675_100079437
317 Ga0070671_101666201
318 Ga0070674_100067848
319 Ga0070674_100095546
320 Ga0070673_100045892
321 Ga0070673_101718351
322 Ga0070688_100008553
323 Ga0070659_101657555
324 Ga0070667_100273454
325 Ga0070701_10047024
326 Ga0070700_100060573
327 Ga0070694_101147981
328 Ga0070662_100481182
329 Ga0070662_100734462
330 Ga0068867_100033959
331 Ga0068867_100037980
332 Ga0068867_100118408
333 Ga0068867_100220480
334 Ga0068867_100576718
335 Ga0068867_100702189
336 Ga0068867_101061446
337 Ga0070685_10230848
338 Ga0070685_10766066
339 Ga0070679_100030783
340 Ga0068853_100412150
341 Ga0068853_100482165
342 Ga0068853_100524997
343 Ga0070672_100035787
344 Ga0070672_100191597
345 Ga0070672_100248241
346 Ga0070686_100514455
347 Ga0070686_101230013
348 Ga0070665_100040736
349 Ga0070704_101025859
350 Ga0068855_100755970
351 Ga0068854_100071435
352 Ga0068854_100218340
353 Ga0068852_101107226
354 Ga0068852_102216405
355 Ga0068852_102228622
356 Ga0068852_102474333
357 Ga0068859_100078153
358 Ga0068859_100112106
359 Ga0068859_100137491
360 Ga0068864_100125717
361 Ga0068864_101245822
362 Ga0068864_101961286
363 Ga0068866_10011825
364 Ga0068861_100123561
365 Ga0068861_100148106
366 Ga0068861_100255793
367 Ga0068861_100269865
368 Ga0068851_10322286
369 Ga0068851_11110477
370 Ga0068870_10009534
371 Ga0068863_100161183
372 Ga0068863_100426835
373 Ga0068863_101055980
374 Ga0068858_100801266
375 Ga0068860_100071120
376 Ga0068860_100237696
377 Ga0068860_100299101
378 Ga0068860_100389969
379 Ga0068860_102481588
380 Ga0068862_100047695
381 Ga0068862_100066206
382 Ga0068862_100431393
383 Ga0068862_100683895
384 Ga0068862_100703514
385 Ga0068862_100910544
386 Ga0068862_101695252
387 Ga0075366_10886635
388 Ga0097621_100260464
389 Ga0097621_101863152
390 Ga0068871_100029335
391 Ga0068871_100920260
392 Ga0075428_100963243
393 Ga0075429_100655881
394 Ga0068865_100163891
395 Ga0068865_100556544
396 Ga0097620_100078153
397 Ga0097620_100112105
398 Ga0097620_100137491
399 Ga0111539_10017557
400 Ga0105247_10001649
401 Ga0105247_10382603
402 Ga0105243_11023076
403 Ga0105241_10005645
404 Ga0105241_10079832
405 Ga0105241_11649277
406 Ga0105242_10084681
407 Ga0105242_10273641
408 Ga0105242_12112654
409 Ga0105242_12505286
410 Ga0105249_10001666
411 Ga0105249_10014727
412 Ga0105249_10147884
413 Ga0105249_10152963
414 Ga0105249_10757410
415 Ga0105249_10968605
416 Ga0105239_11448984
417 Ga0105239_11674526
418 Ga0105246_10197287
419 Ga0157369_10046481
420 Ga0157374_10118187
421 Ga0157378_10022575
422 Ga0157378_10195818
423 Ga0157378_10265416
424 Ga0163162_10209436
425 Ga0163162_10505053
426 Ga0163162_11605292
427 Ga0163162_12781566
428 Ga0163162_12829196
429 Ga0157372_10049589
430 Ga0157372_11601109
431 Ga0157375_10201748
432 Ga0157375_10218278
433 Ga0157375_10237259
434 Ga0157375_10273886
435 Ga0157375_10521729
436 Ga0163163_10256482
437 Ga0157380_10013266
438 Ga0157380_10265759
439 Ga0157380_10350267
440 Ga0157377_10069689
441 Ga0157377_10308356
442 Ga0157376_11580282
443 Ga0182005_1101469
444 Ga0163161_10777669
445 Ga0207666_1035473
446 Ga0207697_10016616
447 Ga0207656_10293646
448 Ga0207642_10030740
449 Ga0207642_10229823
450 Ga0207642_10372103
451 Ga0207710_10000732
452 Ga0207688_10002060
453 Ga0207680_10142405
454 Ga0207647_10411566
455 Ga0207645_10006983
456 Ga0207645_10040987
457 Ga0207645_10616060
458 Ga0207643_10003655
459 Ga0207705_10750099
460 Ga0207654_11049534
461 Ga0207662_10490788
462 Ga0207652_11703174
463 Ga0207681_10023454
464 Ga0207681_10173871
465 Ga0207681_10456790
466 Ga0207681_10611479
467 Ga0207694_11872031
468 Ga0207650_10178837
469 Ga0207650_10285118
470 Ga0207650_10333587
471 Ga0207659_10312912
472 Ga0207659_10357863
473 Ga0207706_10081459
474 Ga0207706_10784531
475 Ga0207686_10148855
476 Ga0207686_10545713
477 Ga0207670_10041661
478 Ga0207670_10591285
479 Ga0207669_10113546
480 Ga0207669_10230907
481 Ga0207704_10315737
482 Ga0207704_10782827
483 Ga0207691_10096809
484 Ga0207691_10247780
485 Ga0207691_10502339
486 Ga0207689_10006891
487 Ga0207689_10007391
488 Ga0207689_10280663
489 Ga0207667_11158097
490 Ga0207651_10010493
491 Ga0207712_10014745
492 Ga0207712_10102868
493 Ga0207712_10198207
494 Ga0207712_10237620
495 Ga0207712_10504425
496 Ga0207712_10667852
497 Ga0207668_10117121
498 Ga0207668_10938630
499 Ga0207668_11261152
500 Ga0207640_10101373
501 Ga0207640_10141516
502 Ga0207640_10958183
503 Ga0207658_10440405
504 Ga0207658_10615080
505 Ga0207677_10151628
506 Ga0207677_10736642
507 Ga0207703_10541449
508 Ga0207703_10793472
509 Ga0207639_10219546
510 Ga0207639_11610589
511 Ga0207708_10252401
512 Ga0207708_10798480
513 Ga0207641_10081910
514 Ga0207648_10001526
515 Ga0207648_10058798
516 Ga0207648_10130877
517 Ga0207648_10148231
518 Ga0207648_10280073
519 Ga0207676_10191588
520 Ga0207674_10096117
521 Ga0207675_100006933
522 Ga0207675_100008796
523 Ga0207675_100167181
524 Ga0207675_100868704
525 Ga0207683_10006324
526 Ga0207698_11099525
527 Ga0207428_10074933
528 Ga0268266_10470807
529 Ga0268266_11812297
530 Ga0268265_10121527
531 Ga0268265_10469372
532 Ga0268265_10500630
533 Ga0268265_11493452
534 Ga0268264_10052789
535 Ga0268264_10057818
536 Ga0268264_10453741
537 Ga0265336_10089676
538 Ga0265338_10204614
539 Ga0265324_10134535
540 Ga0265331_10114315
541 Ga0265327_10000046
542 Ga0265316_10694639
543 Ga0307516_10108579
544 Ga0307414_10426491
545 Ga0307414_11870563
546 Ga0436365_0224154
547 Ga0436365_1586348
548 Ga0436365_1890468
549 Ga0451791_1755655
550 Ga0451807_2212303
551 Ga0451835_1097785
552 Ga0439431_0071074
553 Ga0439441_157993
554 Ga0439442_007002
555 Ga0439445_0017597
556 Ga0450894_016876
557 Ga0450898_009219
558 Ga0439446_0168213
559 Ga0439434_0005952
560 Ga0466972_0123180
561 Ga0495650_0011666
562 Ga0495643_0345026
563 Ga0495598_0126917
564 Ga0495645_0954680
565 Ga0495668_0000023
566 Ga0495625_0878328
567 Ga0495672_0008179
568 Ga0495686_0536882
569 Ga0501070_0914024
570 nmdc:mga0k408_241642_c1
571 nmdc:mga0k408_777212_c1
572 nmdc:mga08y16_71383_c1
573 Ga0500592_002656
574 Ga0500616_0008932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06243

PaaB

Phenylacetic acid degradation B

53

141

0.98

Map