F388157

General Info

Members Datasets Scaffolds Average Seq Length
287 121 287 209

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0044795|Ga0466961_0044795_1101_1805
Length 234
Sequence LARESFHWTRAKRELTSFAMAKPLTIGNSIAPWRFLVFIAVLVIGAIPASLWLGSWWLGIIDAFDVSAALFLILCWRVIAIDDPKEMERNAQLNDANRTFLLIITGIVMAVLLIAVGAETVGRNPQAFAKALIIVTLIVAWLFSNTVYALHYAHMAYITPAAGCAGFRFPGTPQPVYWDFVYFAFTCGMAFATSDVEVTDQRIRKVVTFHCLAAFAFNIGVLAFTVNLLASGGG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.74
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10033164 3300001979 Bacteria 1643
2 JGI24740J21852_10067258 3300001979 Bacteria 970
3 JGI24735J21928_10024874 3300002067 Bacteria 1809
4 JGI24745J21846_1002113 3300002073 Bacteria 1997
5 rootH1_10026065 3300003323 Bacteria 1955
6 Ga0070658_10028835 3300005327 Bacteria 4456
7 Ga0070658_10287071 3300005327 Bacteria 1402
8 Ga0070683_100056998 3300005329 Bacteria 3629
9 Ga0070683_100327665 3300005329 Bacteria 1458
10 Ga0070683_100373976 3300005329 Bacteria 1358
11 Ga0070670_100241470 3300005331 Bacteria 1573
12 Ga0068869_100011150 3300005334 Bacteria 5891
13 Ga0070680_100001107 3300005336 Bacteria 19340
14 Ga0070680_100006267 3300005336 Bacteria 9026
15 Ga0070680_100180198 3300005336 Bacteria 1779
16 Ga0068868_100791071 3300005338 Bacteria 855
17 Ga0070660_100034868 3300005339 Bacteria 3805
18 Ga0070660_100043777 3300005339 Bacteria 3422
19 Ga0070660_100074462 3300005339 Bacteria 2657
20 Ga0070660_100129580 3300005339 Bacteria 2018
21 Ga0070660_100203914 3300005339 Bacteria 1604
22 Ga0070661_100003711 3300005344 Bacteria 10524
23 Ga0070661_100092680 3300005344 Bacteria 2238
24 Ga0070661_100231607 3300005344 Unclassified 1420
25 Ga0070674_100065224 3300005356 Bacteria 2555
26 Ga0070673_100070377 3300005364 Bacteria 2807
27 Ga0070673_100254312 3300005364 Unclassified 1532
28 Ga0070659_100005660 3300005366 Bacteria 8983
29 Ga0070659_100052895 3300005366 Bacteria 3195
30 Ga0070667_100032031 3300005367 Bacteria 4383
31 Ga0070667_100424251 3300005367 Bacteria 1213
32 Ga0070714_100037700 3300005435 Bacteria 4063
33 Ga0070714_100047169 3300005435 Bacteria 3659
34 Ga0070714_100113463 3300005435 Bacteria 2403
35 Ga0070714_100240774 3300005435 Bacteria 1670
36 Ga0070714_100345034 3300005435 Bacteria 1397
37 Ga0070713_100022349 3300005436 Bacteria 4888
38 Ga0070713_100097079 3300005436 Bacteria 2545
39 Ga0070678_100067128 3300005456 Bacteria 2668
40 Ga0070678_100337887 3300005456 Bacteria 1291
41 Ga0070662_100018099 3300005457 Bacteria 4761
42 Ga0070662_100119075 3300005457 Bacteria 2022
43 Ga0070681_10005224 3300005458 Bacteria 12540
44 Ga0070681_10142444 3300005458 Bacteria 2327
45 Ga0068867_100283411 3300005459 Bacteria 1359
46 Ga0068853_100003622 3300005539 Bacteria 11840
47 Ga0068853_100056455 3300005539 Bacteria 3386
48 Ga0068853_100193784 3300005539 Bacteria 1847
49 Ga0070672_100098993 3300005543 Bacteria 2362
50 Ga0070672_100126623 3300005543 Bacteria 2096
51 Ga0070665_100006014 3300005548 Bacteria 12406
52 Ga0068855_100061376 3300005563 Bacteria 4393
53 Ga0068855_100323259 3300005563 Bacteria 1705
54 Ga0068855_100520548 3300005563 Bacteria 1290
55 Ga0068855_100818499 3300005563 Bacteria 989
56 Ga0068855_101035476 3300005563 Bacteria 861
57 Ga0070664_100623678 3300005564 Bacteria 1001
58 Ga0068857_100002151 3300005577 Bacteria 16023
59 Ga0068854_100075573 3300005578 Bacteria 2474
60 Ga0068854_100106477 3300005578 Bacteria 2109
61 Ga0068854_100205683 3300005578 Bacteria 1550
62 Ga0068854_101152034 3300005578 Bacteria 693
63 Ga0068856_100083141 3300005614 Bacteria 3179
64 Ga0068856_100198619 3300005614 Bacteria 2020
65 Ga0068856_100236632 3300005614 Bacteria 1841
66 Ga0068856_100327735 3300005614 Unclassified 1549
67 Ga0068856_100878434 3300005614 Bacteria 915
68 Ga0068852_100004103 3300005616 Bacteria 10252
69 Ga0068852_100004379 3300005616 Bacteria 9978
70 Ga0068852_100004670 3300005616 Bacteria 9714
71 Ga0068852_100029691 3300005616 Bacteria 4494
72 Ga0068852_100031521 3300005616 Bacteria 4376
73 Ga0068852_100119710 3300005616 Bacteria 2408
74 Ga0068858_100331752 3300005842 Bacteria 1455
75 Ga0105240_10015829 3300009093 Bacteria 10231
76 Ga0105240_10259609 3300009093 Bacteria 2005
77 Ga0105245_10030961 3300009098 Bacteria 4733
78 Ga0105241_10037451 3300009174 Bacteria 3654
79 Ga0105242_10444339 3300009176 Bacteria 1221
80 Ga0105248_10196666 3300009177 Bacteria 2272
81 Ga0105237_10080761 3300009545 Bacteria 3242
82 Ga0105238_10004794 3300009551 Bacteria 13382
83 Ga0105238_10027374 3300009551 Bacteria 5808
84 Ga0105239_10077903 3300010375 Bacteria 3648
85 Ga0105239_10211166 3300010375 Unclassified 2176
86 Ga0157373_10081743 3300013100 Bacteria 2278
87 Ga0157373_10158072 3300013100 Unclassified 1595
88 Ga0157373_10170660 3300013100 Unclassified 1531
89 Ga0157373_10597411 3300013100 Bacteria 803
90 Ga0157371_10062321 3300013102 Bacteria 2644
91 Ga0157371_10092851 3300013102 Bacteria 2139
92 Ga0157371_10130190 3300013102 Unclassified 1790
93 Ga0157371_10172701 3300013102 Bacteria 1545
94 Ga0157371_10245910 3300013102 Bacteria 1287
95 Ga0157370_10005206 3300013104 Bacteria 14654
96 Ga0157370_10075579 3300013104 Bacteria 3175
97 Ga0157370_10213097 3300013104 Bacteria 1790
98 Ga0157370_10299652 3300013104 Bacteria 1484
99 Ga0157370_10381649 3300013104 Bacteria 1298
100 Ga0157369_10002615 3300013105 Bacteria 21530
101 Ga0157369_10026402 3300013105 Bacteria 6442
102 Ga0157369_10075654 3300013105 Bacteria 3609
103 Ga0157369_10549190 3300013105 Bacteria 1194
104 Ga0157369_10651906 3300013105 Bacteria 1086
105 Ga0157369_10858894 3300013105 Unclassified 931
106 Ga0157378_10312952 3300013297 Bacteria 1523
107 Ga0157372_10002970 3300013307 Bacteria 18265
108 Ga0157372_10231199 3300013307 Bacteria 2144
109 Ga0157372_10438505 3300013307 Bacteria 1522
110 Ga0157372_10529094 3300013307 Bacteria 1374
111 Ga0157375_10023087 3300013308 Bacteria 5734
112 Ga0206354_10335319 3300020081 Bacteria 2095
113 Ga0207688_10234301 3300025901 Bacteria 1109
114 Ga0207647_10042174 3300025904 Bacteria 2864
115 Ga0207645_10085999 3300025907 Bacteria 2019
116 Ga0207705_10056839 3300025909 Bacteria 2822
117 Ga0207705_10115420 3300025909 Bacteria 1987
118 Ga0207705_10150546 3300025909 Bacteria 1743
119 Ga0207707_10004536 3300025912 Bacteria 12212
120 Ga0207707_10104375 3300025912 Bacteria 2477
121 Ga0207695_10191420 3300025913 Bacteria 1963
122 Ga0207671_10036322 3300025914 Bacteria 3654
123 Ga0207660_10002184 3300025917 Bacteria 12956
124 Ga0207660_10002693 3300025917 Bacteria 11657
125 Ga0207660_10024640 3300025917 Bacteria 4075
126 Ga0207657_10005276 3300025919 Bacteria 13542
127 Ga0207657_10026544 3300025919 Bacteria 5320
128 Ga0207657_10133527 3300025919 Bacteria 2033
129 Ga0207657_10140815 3300025919 Unclassified 1971
130 Ga0207649_10004144 3300025920 Bacteria 7893
131 Ga0207649_10054754 3300025920 Bacteria 2484
132 Ga0207649_10562230 3300025920 Bacteria 874
133 Ga0207652_10037351 3300025921 Bacteria 4111
134 Ga0207694_10004270 3300025924 Bacteria 11187
135 Ga0207694_10017886 3300025924 Bacteria 5358
136 Ga0207694_10052727 3300025924 Bacteria 3153
137 Ga0207694_10123771 3300025924 Bacteria 2067
138 Ga0207700_10084776 3300025928 Bacteria 2485
139 Ga0207664_10024783 3300025929 Bacteria 4511
140 Ga0207664_10033351 3300025929 Bacteria 3955
141 Ga0207664_10069521 3300025929 Bacteria 2831
142 Ga0207690_10036771 3300025932 Bacteria 3173
143 Ga0207690_10398737 3300025932 Bacteria 1097
144 Ga0207706_10040362 3300025933 Bacteria 4136
145 Ga0207706_10189515 3300025933 Unclassified 1805
146 Ga0207691_10045666 3300025940 Bacteria 4026
147 Ga0207691_10361393 3300025940 Bacteria 1241
148 Ga0207689_10183137 3300025942 Unclassified 1727
149 Ga0207661_10044136 3300025944 Bacteria 3521
150 Ga0207661_10218962 3300025944 Bacteria 1682
151 Ga0207661_10269956 3300025944 Bacteria 1518
152 Ga0207679_10575092 3300025945 Bacteria 1013
153 Ga0207679_10989795 3300025945 Bacteria 771
154 Ga0207667_10058504 3300025949 Bacteria 4041
155 Ga0207667_10173961 3300025949 Bacteria 2212
156 Ga0207667_10211996 3300025949 Bacteria 1985
157 Ga0207667_10542040 3300025949 Bacteria 1177
158 Ga0207651_10013121 3300025960 Bacteria 4726
159 Ga0207651_10141935 3300025960 Bacteria 1856
160 Ga0207668_10757564 3300025972 Bacteria 857
161 Ga0207640_10284261 3300025981 Bacteria 1301
162 Ga0207640_10338879 3300025981 Bacteria 1204
163 Ga0207640_10485325 3300025981 Bacteria 1026
164 Ga0207640_11011674 3300025981 Bacteria 732
165 Ga0207658_10224909 3300025986 Bacteria 1581
166 Ga0207658_10274696 3300025986 Bacteria 1442
167 Ga0207677_10381144 3300026023 Bacteria 1190
168 Ga0207703_10052384 3300026035 Bacteria 3314
169 Ga0207703_10228488 3300026035 Bacteria 1667
170 Ga0207639_10010230 3300026041 Bacteria 6490
171 Ga0207678_10021698 3300026067 Bacteria 5631
172 Ga0207678_10146683 3300026067 Bacteria 2014
173 Ga0207702_10162393 3300026078 Bacteria 2041
174 Ga0207702_10297560 3300026078 Unclassified 1531
175 Ga0207648_10002495 3300026089 Bacteria 19746
176 Ga0207674_10138141 3300026116 Bacteria 2398
177 Ga0207683_10001608 3300026121 Bacteria 20313
178 Ga0207698_10001033 3300026142 Bacteria 16205
179 Ga0207698_10002603 3300026142 Bacteria 10730
180 Ga0207698_10002949 3300026142 Bacteria 10177
181 Ga0207698_10009648 3300026142 Bacteria 6164
182 Ga0207698_10010681 3300026142 Bacteria 5920
183 Ga0207698_10181191 3300026142 Bacteria 1866
184 Ga0207698_10230859 3300026142 Bacteria 1680
185 Ga0268266_10022498 3300028379 Bacteria 5371
186 Ga0307408_100061278 3300031548 Bacteria 2746
187 Ga0307413_10018650 3300031824 Bacteria 3646
188 Ga0307413_10258116 3300031824 Bacteria 1297
189 Ga0307410_10023185 3300031852 Bacteria 3853
190 Ga0307410_10063756 3300031852 Bacteria 2529
191 Ga0307406_10157938 3300031901 Bacteria 1626
192 Ga0307407_10092602 3300031903 Bacteria 1856
193 Ga0307407_10194816 3300031903 Bacteria 1353
194 Ga0307412_10198010 3300031911 Bacteria 1523
195 Ga0307409_100053866 3300031995 Bacteria 3094
196 Ga0307409_100221645 3300031995 Bacteria 1708
197 Ga0307414_10070965 3300032004 Bacteria 2510
198 Ga0307411_10124545 3300032005 Bacteria 1871
199 Ga0307411_10253764 3300032005 Bacteria 1384
200 Ga0307415_100330432 3300032126 Bacteria 1275
201 Ga0307415_100430012 3300032126 Bacteria 1135
202 Ga0395899_0002299 3300037312 Bacteria 15586
203 Ga0395899_0031397 3300037312 Bacteria 3992
204 Ga0395899_0592079 3300037312 Bacteria 707
205 Ga0395900_0001302 3300037418 Bacteria 30375
206 Ga0395900_0040874 3300037418 Bacteria 4779
207 Ga0395900_0086910 3300037418 Bacteria 3213
208 Ga0395900_0129069 3300037418 Bacteria 2591
209 Ga0395900_0191451 3300037418 Bacteria 2074
210 Ga0395900_0198958 3300037418 Bacteria 2028
211 Ga0395900_0217462 3300037418 Bacteria 1927
212 Ga0395900_0299903 3300037418 Bacteria 1593
213 Ga0395900_0300347 3300037418 Bacteria 1592
214 Ga0395900_0500468 3300037418 Unclassified 1165
215 Ga0395898_0021683 3300037466 Bacteria 6511
216 Ga0395898_0092193 3300037466 Bacteria 2913
217 Ga0395898_0285395 3300037466 Bacteria 1574
218 Ga0395898_0356718 3300037466 Bacteria 1394
219 Ga0395905_0025081 3300037471 Bacteria 5623
220 Ga0395905_0031873 3300037471 Bacteria 4959
221 Ga0395905_0282329 3300037471 Bacteria 1546
222 Ga0395905_0307466 3300037471 Bacteria 1473
223 Ga0395905_0323619 3300037471 Bacteria 1432
224 Ga0395901_0000131 3300038443 Bacteria 96504
225 Ga0395901_0001289 3300038443 Bacteria 26489
226 Ga0395901_0005957 3300038443 Bacteria 12344
227 Ga0395901_0109266 3300038443 Bacteria 2903
228 Ga0395901_0144568 3300038443 Bacteria 2500
229 Ga0395901_0254123 3300038443 Bacteria 1830
230 Ga0395901_0569720 3300038443 Unclassified 1145
231 Ga0395901_0800388 3300038443 Unclassified 931
232 Ga0466966_0000021 3300044684 Bacteria 116714
233 Ga0466966_0044397 3300044684 Bacteria 2845
234 Ga0466966_0054135 3300044684 Bacteria 2544
235 Ga0466966_0145634 3300044684 Bacteria 1446
236 Ga0466966_0489904 3300044684 Bacteria 739
237 Ga0466961_0035856 3300044693 Bacteria 3184
238 Ga0466961_0041712 3300044693 Bacteria 2942
239 Ga0466961_0044795 3300044693 Bacteria 2831
240 Ga0466961_0046528 3300044693 Bacteria 2774
241 Ga0466961_0087009 3300044693 Bacteria 1975
242 Ga0466963_0000344 3300044694 Bacteria 21096
243 Ga0466963_0064760 3300044694 Bacteria 2449
244 Ga0466963_0069759 3300044694 Bacteria 2363
245 Ga0466963_0445356 3300044694 Unclassified 914
246 Ga0466964_0017366 3300044706 Bacteria 2753
247 Ga0466964_0079649 3300044706 Unclassified 1403
248 Ga0466964_0192755 3300044706 Bacteria 974
249 Ga0466971_0103074 3300044719 Bacteria 1312
250 Ga0466970_0017974 3300044765 Bacteria 3658
251 Ga0466970_0053764 3300044765 Bacteria 2151
252 Ga0466970_0055286 3300044765 Bacteria 2120
253 Ga0466970_0080984 3300044765 Bacteria 1755
254 Ga0466957_0000196 3300044842 Bacteria 27913
255 Ga0466957_0035908 3300044842 Bacteria 2976
256 Ga0466957_0123502 3300044842 Bacteria 1652
257 Ga0466957_0135986 3300044842 Bacteria 1580
258 Ga0466957_0365032 3300044842 Bacteria 982
259 Ga0466959_0365919 3300045049 Bacteria 982
260 Ga0466958_0000482 3300045836 Bacteria 16679
261 Ga0466958_0013070 3300045836 Bacteria 4718
262 Ga0466958_0077216 3300045836 Unclassified 2045
263 Ga0466958_0113956 3300045836 Bacteria 1689
264 Ga0466958_0604877 3300045836 Bacteria 713
265 Ga0466967_0000471 3300045976 Bacteria 19492
266 Ga0466967_0008368 3300045976 Bacteria 7571
267 Ga0466967_0026526 3300045976 Bacteria 4801
268 Ga0466967_0031603 3300045976 Bacteria 4459
269 Ga0466967_0076803 3300045976 Bacteria 3005
270 Ga0466967_0152369 3300045976 Bacteria 2162
271 Ga0466967_0155078 3300045976 Bacteria 2144
272 Ga0495654_0111613 3300046530 Bacteria 1247
273 Ga0495633_0124215 3300046558 Bacteria 1195
274 Ga0495668_0019980 3300046616 Bacteria 3852
275 Ga0495669_0001357 3300046684 Bacteria 10139
276 Ga0495669_0016715 3300046684 Bacteria 3145
277 Ga0495669_0033605 3300046684 Bacteria 2258
278 Ga0495686_0187501 3300047472 Bacteria 1194
279 Ga0496103_0094893 3300048906 Bacteria 1885
280 Ga0496108_0000944 3300048911 Bacteria 22620
281 Ga0496109_0327159 3300048912 Bacteria 1447
282 Ga0496111_0424902 3300048914 Bacteria 982
283 Ga0496112_0048519 3300048915 Bacteria 4163
284 Ga0501242_004975 3300049674 Bacteria 1484
285 Ga0501080_0027204 3300049742 Bacteria 5319
286 Ga0466962_0114464 3300061719 Bacteria 1299
287 Ga0466962_0292935 3300061719 Unclassified 804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10028835 Ga0070658_100288353 181
2 3300005329 Ga0070683_100327665 Ga0070683_1003276652 181
3 3300005339 Ga0070660_100043777 Ga0070660_1000437772 181
4 3300005435 Ga0070714_100113463 Ga0070714_1001134633 181
5 3300025919 Ga0207657_10133527 Ga0207657_101335272 181
6 3300025932 Ga0207690_10398737 Ga0207690_103987372 181
7 3300025944 Ga0207661_10269956 Ga0207661_102699562 181
8 3300026116 Ga0207674_10138141 Ga0207674_101381413 181
9 3300037312 Ga0395899_0592079 Ga0395899_0592079_36_683 181
10 3300037418 Ga0395900_0191451 Ga0395900_0191451_473_1120 181
11 3300037466 Ga0395898_0021683 Ga0395898_0021683_398_1045 181
12 3300005344 Ga0070661_100231607 Ga0070661_1002316072 191
13 3300005435 Ga0070714_100345034 Ga0070714_1003450342 191
14 3300005578 Ga0068854_100106477 Ga0068854_1001064774 191
15 3300005614 Ga0068856_100327735 Ga0068856_1003277352 191
16 3300009545 Ga0105237_10080761 Ga0105237_100807614 191
17 3300010375 Ga0105239_10211166 Ga0105239_102111663 191
18 3300013100 Ga0157373_10158072 Ga0157373_101580722 191
19 3300013105 Ga0157369_10858894 Ga0157369_108588941 191
20 3300013307 Ga0157372_10231199 Ga0157372_102311994 191
21 3300025913 Ga0207695_10191420 Ga0207695_101914204 191
22 3300025949 Ga0207667_10173961 Ga0207667_101739612 191
23 3300026078 Ga0207702_10297560 Ga0207702_102975602 191
24 3300026142 Ga0207698_10181191 Ga0207698_101811913 191
25 3300037418 Ga0395900_0217462 Ga0395900_0217462_1081_1728 191
26 3300037418 Ga0395900_0500468 Ga0395900_0500468_162_809 191
27 3300037466 Ga0395898_0285395 Ga0395898_0285395_766_1413 191
28 3300037471 Ga0395905_0307466 Ga0395905_0307466_665_1312 191
29 3300038443 Ga0395901_0800388 Ga0395901_0800388_123_770 191
30 3300005339 Ga0070660_100074462 Ga0070660_1000744623 192
31 3300025919 Ga0207657_10140815 Ga0207657_101408153 192
32 3300025929 Ga0207664_10033351 Ga0207664_100333515 192
33 3300005435 Ga0070714_100047169 Ga0070714_1000471694 193
34 3300025929 Ga0207664_10069521 Ga0207664_100695214 193
35 3300038443 Ga0395901_0569720 Ga0395901_0569720_234_902 193
36 3300044693 Ga0466961_0046528 Ga0466961_0046528_206_853 193
37 3300044765 Ga0466970_0017974 Ga0466970_0017974_2570_3217 193
38 3300049742 Ga0501080_0027204 Ga0501080_0027204_1704_2345 197
39 3300002073 JGI24745J21846_1002113 JGI24745J21846_10021132 199
40 3300003323 rootH1_10026065 rootH1_100260651 199
41 3300005334 Ga0068869_100011150 Ga0068869_1000111503 199
42 3300005344 Ga0070661_100092680 Ga0070661_1000926804 199
43 3300005356 Ga0070674_100065224 Ga0070674_1000652242 199
44 3300005364 Ga0070673_100254312 Ga0070673_1002543121 199
45 3300005366 Ga0070659_100005660 Ga0070659_1000056609 199
46 3300005367 Ga0070667_100424251 Ga0070667_1004242512 199
47 3300005456 Ga0070678_100067128 Ga0070678_1000671283 199
48 3300005457 Ga0070662_100018099 Ga0070662_1000180995 199
49 3300005459 Ga0068867_100283411 Ga0068867_1002834113 199
50 3300005543 Ga0070672_100126623 Ga0070672_1001266234 199
51 3300005578 Ga0068854_100075573 Ga0068854_1000755732 199
52 3300009098 Ga0105245_10030961 Ga0105245_100309614 199
53 3300009176 Ga0105242_10444339 Ga0105242_104443393 199
54 3300013100 Ga0157373_10170660 Ga0157373_101706602 199
55 3300025901 Ga0207688_10234301 Ga0207688_102343012 199
56 3300025907 Ga0207645_10085999 Ga0207645_100859992 199
57 3300025933 Ga0207706_10189515 Ga0207706_101895152 199
58 3300025940 Ga0207691_10361393 Ga0207691_103613932 199
59 3300025942 Ga0207689_10183137 Ga0207689_101831372 199
60 3300025960 Ga0207651_10013121 Ga0207651_100131215 199
61 3300025972 Ga0207668_10757564 Ga0207668_107575642 199
62 3300026023 Ga0207677_10381144 Ga0207677_103811442 199
63 3300026067 Ga0207678_10021698 Ga0207678_100216985 199
64 3300026089 Ga0207648_10002495 Ga0207648_100024957 199
65 3300026121 Ga0207683_10001608 Ga0207683_1000160814 199
66 3300045976 Ga0466967_0152369 Ga0466967_0152369_465_1109 199
67 3300048906 Ga0496103_0094893 Ga0496103_0094893_1162_1809 199
68 3300013104 Ga0157370_10381649 Ga0157370_103816491 200
69 3300025919 Ga0207657_10026544 Ga0207657_100265445 200
70 3300048911 Ga0496108_0000944 Ga0496108_0000944_11138_11746 202
71 3300025981 Ga0207640_10485325 Ga0207640_104853252 204
72 3300005539 Ga0068853_100193784 Ga0068853_1001937843 205
73 3300005578 Ga0068854_101152034 Ga0068854_1011520341 205
74 3300025924 Ga0207694_10123771 Ga0207694_101237714 205
75 3300025981 Ga0207640_11011674 Ga0207640_110116741 205
76 3300026142 Ga0207698_10230859 Ga0207698_102308592 205
77 3300044684 Ga0466966_0489904 Ga0466966_0489904_77_724 205
78 3300044693 Ga0466961_0041712 Ga0466961_0041712_1734_2381 205
79 3300037418 Ga0395900_0001302 Ga0395900_0001302_25149_25793 206
80 3300038443 Ga0395901_0000131 Ga0395901_0000131_80397_81041 206
81 3300005563 Ga0068855_100520548 Ga0068855_1005205482 207
82 3300005616 Ga0068852_100031521 Ga0068852_1000315215 207
83 3300013102 Ga0157371_10245910 Ga0157371_102459102 207
84 3300013104 Ga0157370_10213097 Ga0157370_102130972 207
85 3300025909 Ga0207705_10150546 Ga0207705_101505461 207
86 3300025981 Ga0207640_10338879 Ga0207640_103388792 207
87 3300026067 Ga0207678_10146683 Ga0207678_101466833 207
88 3300026142 Ga0207698_10009648 Ga0207698_100096486 207
89 3300044694 Ga0466963_0000344 Ga0466963_0000344_14079_14744 207
90 3300044706 Ga0466964_0017366 Ga0466964_0017366_1996_2661 207
91 3300044842 Ga0466957_0000196 Ga0466957_0000196_7965_8630 207
92 3300045976 Ga0466967_0000471 Ga0466967_0000471_4448_5113 207
93 3300048914 Ga0496111_0424902 Ga0496111_0424902_11_634 207
94 3300037418 Ga0395900_0198958 Ga0395900_0198958_113_760 208
95 3300037466 Ga0395898_0092193 Ga0395898_0092193_1862_2509 208
96 3300037471 Ga0395905_0282329 Ga0395905_0282329_787_1434 208
97 3300038443 Ga0395901_0005957 Ga0395901_0005957_1994_2641 208
98 3300005435 Ga0070714_100240774 Ga0070714_1002407743 209
99 3300005614 Ga0068856_100236632 Ga0068856_1002366322 209
100 3300005614 Ga0068856_100878434 Ga0068856_1008784341 209
101 3300020081 Ga0206354_10335319 Ga0206354_103353192 209
102 3300005436 Ga0070713_100097079 Ga0070713_1000970793 210
103 3300025928 Ga0207700_10084776 Ga0207700_100847764 210
104 3300049674 Ga0501242_004975 Ga0501242_004975_226_867 210
105 3300031548 Ga0307408_100061278 Ga0307408_1000612783 211
106 3300031824 Ga0307413_10018650 Ga0307413_100186504 211
107 3300031824 Ga0307413_10258116 Ga0307413_102581162 211
108 3300031852 Ga0307410_10023185 Ga0307410_100231853 211
109 3300031852 Ga0307410_10063756 Ga0307410_100637563 211
110 3300031901 Ga0307406_10157938 Ga0307406_101579382 211
111 3300031903 Ga0307407_10092602 Ga0307407_100926022 211
112 3300031903 Ga0307407_10194816 Ga0307407_101948162 211
113 3300031911 Ga0307412_10198010 Ga0307412_101980101 211
114 3300031995 Ga0307409_100053866 Ga0307409_1000538662 211
115 3300031995 Ga0307409_100221645 Ga0307409_1002216452 211
116 3300032004 Ga0307414_10070965 Ga0307414_100709654 211
117 3300032005 Ga0307411_10124545 Ga0307411_101245452 211
118 3300032005 Ga0307411_10253764 Ga0307411_102537642 211
119 3300032126 Ga0307415_100330432 Ga0307415_1003304322 211
120 3300032126 Ga0307415_100430012 Ga0307415_1004300122 211
121 3300048912 Ga0496109_0327159 Ga0496109_0327159_779_1423 211
122 3300005331 Ga0070670_100241470 Ga0070670_1002414702 213
123 3300005338 Ga0068868_100791071 Ga0068868_1007910712 213
124 3300026035 Ga0207703_10052384 Ga0207703_100523842 213
125 3300046530 Ga0495654_0111613 Ga0495654_0111613_465_1106 213
126 3300046558 Ga0495633_0124215 Ga0495633_0124215_24_665 213
127 3300046616 Ga0495668_0019980 Ga0495668_0019980_2465_3106 213
128 3300046684 Ga0495669_0001357 Ga0495669_0001357_8864_9505 213
129 3300046684 Ga0495669_0016715 Ga0495669_0016715_2054_2695 213
130 3300046684 Ga0495669_0033605 Ga0495669_0033605_1136_1777 213
131 3300047472 Ga0495686_0187501 Ga0495686_0187501_42_683 213
132 3300048915 Ga0496112_0048519 Ga0496112_0048519_2096_2737 213
133 3300001979 JGI24740J21852_10067258 JGI24740J21852_100672582 214
134 3300002067 JGI24735J21928_10024874 JGI24735J21928_100248744 214
135 3300005327 Ga0070658_10287071 Ga0070658_102870712 214
136 3300005329 Ga0070683_100056998 Ga0070683_1000569983 214
137 3300005339 Ga0070660_100034868 Ga0070660_1000348685 214
138 3300005339 Ga0070660_100129580 Ga0070660_1001295801 214
139 3300005339 Ga0070660_100203914 Ga0070660_1002039142 214
140 3300005344 Ga0070661_100003711 Ga0070661_1000037112 214
141 3300005364 Ga0070673_100070377 Ga0070673_1000703772 214
142 3300005366 Ga0070659_100052895 Ga0070659_1000528954 214
143 3300005367 Ga0070667_100032031 Ga0070667_1000320313 214
144 3300005456 Ga0070678_100337887 Ga0070678_1003378872 214
145 3300005457 Ga0070662_100119075 Ga0070662_1001190753 214
146 3300005458 Ga0070681_10005224 Ga0070681_100052244 214
147 3300005539 Ga0068853_100003622 Ga0068853_10000362211 214
148 3300005539 Ga0068853_100056455 Ga0068853_1000564553 214
149 3300005543 Ga0070672_100098993 Ga0070672_1000989933 214
150 3300005548 Ga0070665_100006014 Ga0070665_1000060144 214
151 3300005563 Ga0068855_100818499 Ga0068855_1008184992 214
152 3300005563 Ga0068855_101035476 Ga0068855_1010354761 214
153 3300005564 Ga0070664_100623678 Ga0070664_1006236782 214
154 3300005577 Ga0068857_100002151 Ga0068857_10000215114 214
155 3300005614 Ga0068856_100198619 Ga0068856_1001986193 214
156 3300005616 Ga0068852_100004379 Ga0068852_10000437911 214
157 3300005616 Ga0068852_100004670 Ga0068852_1000046702 214
158 3300005842 Ga0068858_100331752 Ga0068858_1003317523 214
159 3300009093 Ga0105240_10015829 Ga0105240_100158292 214
160 3300009174 Ga0105241_10037451 Ga0105241_100374515 214
161 3300009177 Ga0105248_10196666 Ga0105248_101966663 214
162 3300009551 Ga0105238_10004794 Ga0105238_1000479413 214
163 3300010375 Ga0105239_10077903 Ga0105239_100779035 214
164 3300013100 Ga0157373_10081743 Ga0157373_100817434 214
165 3300013102 Ga0157371_10062321 Ga0157371_100623214 214
166 3300013102 Ga0157371_10092851 Ga0157371_100928514 214
167 3300013104 Ga0157370_10005206 Ga0157370_100052069 214
168 3300013104 Ga0157370_10075579 Ga0157370_100755791 214
169 3300013105 Ga0157369_10002615 Ga0157369_1000261516 214
170 3300013105 Ga0157369_10026402 Ga0157369_100264023 214
171 3300013105 Ga0157369_10075654 Ga0157369_100756545 214
172 3300013105 Ga0157369_10549190 Ga0157369_105491902 214
173 3300013307 Ga0157372_10002970 Ga0157372_100029704 214
174 3300013307 Ga0157372_10529094 Ga0157372_105290942 214
175 3300013308 Ga0157375_10023087 Ga0157375_100230872 214
176 3300025904 Ga0207647_10042174 Ga0207647_100421741 214
177 3300025909 Ga0207705_10056839 Ga0207705_100568391 214
178 3300025909 Ga0207705_10115420 Ga0207705_101154202 214
179 3300025912 Ga0207707_10004536 Ga0207707_1000453613 214
180 3300025914 Ga0207671_10036322 Ga0207671_100363223 214
181 3300025919 Ga0207657_10005276 Ga0207657_100052769 214
182 3300025920 Ga0207649_10004144 Ga0207649_100041442 214
183 3300025920 Ga0207649_10054754 Ga0207649_100547543 214
184 3300025921 Ga0207652_10037351 Ga0207652_100373514 214
185 3300025924 Ga0207694_10004270 Ga0207694_100042702 214
186 3300025924 Ga0207694_10017886 Ga0207694_100178864 214
187 3300025929 Ga0207664_10024783 Ga0207664_100247833 214
188 3300025932 Ga0207690_10036771 Ga0207690_100367714 214
189 3300025933 Ga0207706_10040362 Ga0207706_100403622 214
190 3300025940 Ga0207691_10045666 Ga0207691_100456664 214
191 3300025944 Ga0207661_10044136 Ga0207661_100441364 214
192 3300025945 Ga0207679_10575092 Ga0207679_105750922 214
193 3300025945 Ga0207679_10989795 Ga0207679_109897951 214
194 3300025949 Ga0207667_10542040 Ga0207667_105420402 214
195 3300025960 Ga0207651_10141935 Ga0207651_101419352 214
196 3300025986 Ga0207658_10274696 Ga0207658_102746962 214
197 3300026035 Ga0207703_10228488 Ga0207703_102284883 214
198 3300026041 Ga0207639_10010230 Ga0207639_100102303 214
199 3300026078 Ga0207702_10162393 Ga0207702_101623932 214
200 3300026142 Ga0207698_10001033 Ga0207698_1000103312 214
201 3300026142 Ga0207698_10010681 Ga0207698_100106815 214
202 3300028379 Ga0268266_10022498 Ga0268266_100224984 214
203 3300037312 Ga0395899_0002299 Ga0395899_0002299_12850_13494 214
204 3300037312 Ga0395899_0031397 Ga0395899_0031397_2196_2840 214
205 3300037418 Ga0395900_0040874 Ga0395900_0040874_1842_2486 214
206 3300037418 Ga0395900_0086910 Ga0395900_0086910_2376_3020 214
207 3300037418 Ga0395900_0129069 Ga0395900_0129069_603_1247 214
208 3300037418 Ga0395900_0299903 Ga0395900_0299903_26_670 214
209 3300037418 Ga0395900_0300347 Ga0395900_0300347_330_974 214
210 3300037466 Ga0395898_0356718 Ga0395898_0356718_705_1349 214
211 3300037471 Ga0395905_0025081 Ga0395905_0025081_3635_4279 214
212 3300037471 Ga0395905_0031873 Ga0395905_0031873_155_799 214
213 3300038443 Ga0395901_0001289 Ga0395901_0001289_15473_16117 214
214 3300038443 Ga0395901_0109266 Ga0395901_0109266_1870_2514 214
215 3300038443 Ga0395901_0144568 Ga0395901_0144568_259_903 214
216 3300038443 Ga0395901_0254123 Ga0395901_0254123_798_1442 214
217 3300044684 Ga0466966_0044397 Ga0466966_0044397_890_1534 214
218 3300044684 Ga0466966_0054135 Ga0466966_0054135_1558_2202 214
219 3300044693 Ga0466961_0035856 Ga0466961_0035856_1771_2415 214
220 3300044693 Ga0466961_0087009 Ga0466961_0087009_974_1618 214
221 3300044694 Ga0466963_0064760 Ga0466963_0064760_1513_2157 214
222 3300044694 Ga0466963_0069759 Ga0466963_0069759_1665_2309 214
223 3300044765 Ga0466970_0053764 Ga0466970_0053764_18_662 214
224 3300044842 Ga0466957_0035908 Ga0466957_0035908_820_1464 214
225 3300044842 Ga0466957_0123502 Ga0466957_0123502_861_1505 214
226 3300044842 Ga0466957_0365032 Ga0466957_0365032_249_893 214
227 3300045836 Ga0466958_0000482 Ga0466958_0000482_276_920 214
228 3300045836 Ga0466958_0113956 Ga0466958_0113956_859_1503 214
229 3300045836 Ga0466958_0604877 Ga0466958_0604877_28_672 214
230 3300045976 Ga0466967_0008368 Ga0466967_0008368_5620_6264 214
231 3300045976 Ga0466967_0031603 Ga0466967_0031603_2773_3417 214
232 3300045976 Ga0466967_0076803 Ga0466967_0076803_1202_1846 214
233 3300045976 Ga0466967_0155078 Ga0466967_0155078_1358_2002 214
234 3300061719 Ga0466962_0114464 Ga0466962_0114464_77_721 214
235 3300001979 JGI24740J21852_10033164 JGI24740J21852_100331643 215
236 3300005329 Ga0070683_100373976 Ga0070683_1003739762 215
237 3300005336 Ga0070680_100001107 Ga0070680_1000011076 215
238 3300005336 Ga0070680_100006267 Ga0070680_1000062678 215
239 3300005336 Ga0070680_100180198 Ga0070680_1001801983 215
240 3300005435 Ga0070714_100037700 Ga0070714_1000377005 215
241 3300005436 Ga0070713_100022349 Ga0070713_1000223492 215
242 3300005458 Ga0070681_10142444 Ga0070681_101424443 215
243 3300005563 Ga0068855_100061376 Ga0068855_1000613763 215
244 3300005563 Ga0068855_100323259 Ga0068855_1003232593 215
245 3300005578 Ga0068854_100205683 Ga0068854_1002056832 215
246 3300005614 Ga0068856_100083141 Ga0068856_1000831413 215
247 3300005616 Ga0068852_100004103 Ga0068852_1000041037 215
248 3300005616 Ga0068852_100029691 Ga0068852_1000296912 215
249 3300005616 Ga0068852_100119710 Ga0068852_1001197103 215
250 3300009093 Ga0105240_10259609 Ga0105240_102596092 215
251 3300009551 Ga0105238_10027374 Ga0105238_100273742 215
252 3300013100 Ga0157373_10597411 Ga0157373_105974111 215
253 3300013102 Ga0157371_10130190 Ga0157371_101301902 215
254 3300013102 Ga0157371_10172701 Ga0157371_101727012 215
255 3300013104 Ga0157370_10299652 Ga0157370_102996522 215
256 3300013105 Ga0157369_10651906 Ga0157369_106519062 215
257 3300013297 Ga0157378_10312952 Ga0157378_103129522 215
258 3300013307 Ga0157372_10438505 Ga0157372_104385052 215
259 3300025912 Ga0207707_10104375 Ga0207707_101043753 215
260 3300025917 Ga0207660_10002184 Ga0207660_1000218410 215
261 3300025917 Ga0207660_10002693 Ga0207660_1000269313 215
262 3300025917 Ga0207660_10024640 Ga0207660_100246404 215
263 3300025920 Ga0207649_10562230 Ga0207649_105622302 215
264 3300025924 Ga0207694_10052727 Ga0207694_100527272 215
265 3300025944 Ga0207661_10218962 Ga0207661_102189623 215
266 3300025949 Ga0207667_10058504 Ga0207667_100585044 215
267 3300025949 Ga0207667_10211996 Ga0207667_102119962 215
268 3300025981 Ga0207640_10284261 Ga0207640_102842612 215
269 3300025986 Ga0207658_10224909 Ga0207658_102249093 215
270 3300026142 Ga0207698_10002603 Ga0207698_100026037 215
271 3300026142 Ga0207698_10002949 Ga0207698_1000294910 215
272 3300037471 Ga0395905_0323619 Ga0395905_0323619_384_1031 215
273 3300044684 Ga0466966_0000021 Ga0466966_0000021_25531_26178 215
274 3300044684 Ga0466966_0145634 Ga0466966_0145634_414_1061 215
275 3300044693 Ga0466961_0044795 Ga0466961_0044795_1101_1805 215
276 3300044694 Ga0466963_0445356 Ga0466963_0445356_217_864 215
277 3300044706 Ga0466964_0079649 Ga0466964_0079649_41_688 215
278 3300044706 Ga0466964_0192755 Ga0466964_0192755_32_679 215
279 3300044719 Ga0466971_0103074 Ga0466971_0103074_93_740 215
280 3300044765 Ga0466970_0055286 Ga0466970_0055286_1112_1816 215
281 3300044765 Ga0466970_0080984 Ga0466970_0080984_603_1250 215
282 3300044842 Ga0466957_0135986 Ga0466957_0135986_361_1008 215
283 3300045049 Ga0466959_0365919 Ga0466959_0365919_83_730 215
284 3300045836 Ga0466958_0013070 Ga0466958_0013070_1941_2588 215
285 3300045836 Ga0466958_0077216 Ga0466958_0077216_323_970 215
286 3300045976 Ga0466967_0026526 Ga0466967_0026526_3876_4523 215
287 3300061719 Ga0466962_0292935 Ga0466962_0292935_27_674 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07077

DUF1345

Protein of unknown function (DUF1345)

56

224

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pqd-assembly1.cif.gz_UU cryo-em structure of the dimeric rhodobacter sphaeroides rc-lh1 core complex at 2.9 a: the structural basis for dimerisation 0.8971 14 53
4gx1-assembly1.cif.gz_A crystal structure of the gsuk bound to adp 0.8307 114 212
7adi-assembly1.cif.gz_A-2 kirbac3.1 w46r: role of a highly conserved tryptophan at the membrane-water interface of kir channel 0.8032 111 209
5yke-assembly1.cif.gz_A structure of pancreatic atp-sensitive potassium channel bound with glibenclamide and atpgammas (focused refinement on tm at 4.11a) 0.7884 115 214
6o9t-assembly1.cif.gz_A kirbac3.1 mutant at a resolution of 4.1 angstroms 0.787 112 210
ID Description Score Start End Superfamily
4gx0A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8571 114 205 1.10.287.70
4gx5C01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8532 114 207 1.10.287.70
af_Q55CU6_305_415_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8501 115 213 1.10.287.70
af_I1JJJ2_64_158_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8455 118 212 1.10.287.70
4gx0B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8321 114 212 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A2W6XIU5-F1-model_v4 DUF1345 domain-containing protein 0.9505 7 213 GO:0016020
AF-A0A0M3CB58-F1-model_v4 deleted 0.9489 121 212
AF-A0A6G8G0F1-F1-model_v4 DUF1345 domain-containing protein 0.9414 113 212 GO:0016020
AF-A0A537MK23-F1-model_v4 DUF1345 domain-containing protein 0.9363 4 211 GO:0016020
AF-A0A4Q9G6L2-F1-model_v4 DUF1345 domain-containing protein 0.9335 10 211 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.74 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map