F388169

General Info

Members Datasets Scaffolds Average Seq Length
287 184 272 274

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0070247|Ga0495592_0070247_686_1621
Length 311
Sequence LSARSALPLPSGGGSAAVWSGRLTGEAGMVPGVHGAEASAMTAEQSVREGNLDEGLRQLQSQVRSDPSKAAHRVFLFQLLAVLGQWDRALTQLNVVGDLDAASLPMVQAYRDALQCEVFRNDVFTGKRAPVVFGEPAPWLGLLIEALRLDAEANFAAAAASREAAFDAAPATRGTIDGTPFEWIADADSRLGPTLEAVVNGRYYWIPFARIAKIAIEAPVDLRDRVWTPATFTWANEGQAAGFIPSRYAGTAPSTDSALLLARRTEWIEYGAGGEQASARAIGQRMFATDANEYALLDVRSIELEVAADHG

Samples

Sample ID Description Type Environment
1 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
2 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
3 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738543018 Massilia sp. GV045 Isolate Unclassified
9 2738543030 Massilia sp. GV097 Isolate Unclassified
10 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
11 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
12 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
13 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
14 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
15 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
88 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
89 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
97 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
102 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.03
Metatranscriptomes 1.74
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 1.39
Rhizoplane 5.92
Rhizosphere 81.53
Stem 0
Stem Tuber 0
Unclassified 7.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055529_1002954 3300003763 Bacteria 3011
2 Ga0055524_1000182 3300003775 Bacteria 70730
3 Ga0055530_10005247 3300003791 Bacteria 6257
4 Ga0055540_1003124 3300003792 Bacteria 8208
5 Ga0055531_10010129 3300003794 Bacteria 4731
6 Ga0070690_100149498 3300005330 Bacteria 1592
7 Ga0070680_100032524 3300005336 Bacteria 4199
8 Ga0068868_100085949 3300005338 Bacteria 2528
9 Ga0068868_100108326 3300005338 Bacteria 2255
10 Ga0070660_100080062 3300005339 Bacteria 2563
11 Ga0070689_100604341 3300005340 Bacteria 950
12 Ga0070691_10014223 3300005341 Bacteria 3650
13 Ga0070687_100005019 3300005343 Bacteria 5331
14 Ga0070671_100062532 3300005355 Bacteria 3100
15 Ga0070671_100115636 3300005355 Unclassified 2255
16 Ga0070673_100110357 3300005364 Unclassified 2280
17 Ga0070667_100477545 3300005367 Bacteria 1141
18 Ga0070701_10082414 3300005438 Unclassified 1744
19 Ga0070705_100116116 3300005440 Bacteria 1720
20 Ga0070700_100408991 3300005441 Bacteria 1022
21 Ga0070694_100003219 3300005444 Bacteria 9747
22 Ga0070694_100028158 3300005444 Unclassified 3653
23 Ga0070694_100072781 3300005444 Bacteria 2372
24 Ga0070681_10062886 3300005458 Bacteria 3684
25 Ga0070681_10288547 3300005458 Unclassified 1551
26 Ga0070707_100046385 3300005468 Bacteria 4159
27 Ga0070698_100042489 3300005471 Bacteria 4663
28 Ga0070684_100744862 3300005535 Bacteria 914
29 Ga0070695_100070435 3300005545 Bacteria 2287
30 Ga0070693_100269239 3300005547 Bacteria 1136
31 Ga0070704_100004626 3300005549 Bacteria 7963
32 Ga0070704_100026854 3300005549 Bacteria 3810
33 Ga0070704_100156124 3300005549 Bacteria 1800
34 Ga0068855_100139225 3300005563 Bacteria 2768
35 Ga0068856_100135527 3300005614 Bacteria 2467
36 Ga0068859_100640142 3300005617 Bacteria 1155
37 Ga0068859_100977239 3300005617 Unclassified 929
38 Ga0068864_100138783 3300005618 Unclassified 2191
39 Ga0068858_100060298 3300005842 Bacteria 3507
40 Ga0068871_100161131 3300006358 Bacteria 1919
41 Ga0075428_100058110 3300006844 Bacteria 4234
42 Ga0075431_100000901 3300006847 Bacteria 26166
43 Ga0075434_100506345 3300006871 Bacteria 1228
44 Ga0075436_100000215 3300006914 Bacteria 35586
45 Ga0097620_100640113 3300006931 Bacteria 1155
46 Ga0079104_1000333 3300006946 Bacteria 57718
47 Ga0075435_100007075 3300007076 Bacteria 7966
48 Ga0075435_100213797 3300007076 Bacteria 1636
49 Ga0105240_10099328 3300009093 Bacteria 3543
50 Ga0105245_10350351 3300009098 Bacteria 1463
51 Ga0105247_10075286 3300009101 Bacteria 2118
52 Ga0105246_10179905 3300011119 Unclassified 1627
53 Ga0163163_10057228 3300014325 Bacteria 3854
54 Ga0163163_10313544 3300014325 Bacteria 1622
55 Ga0157380_10666052 3300014326 Bacteria 1041
56 Ga0182006_1011770 3300015261 Bacteria 3838
57 Ga0206353_10640822 3300020082 Unclassified 1533
58 Ga0213872_10000019 3300021361 Bacteria 172803
59 Ga0213872_10021920 3300021361 Bacteria 2941
60 Ga0209050_1001069 3300025298 Bacteria 33615
61 Ga0209050_1014421 3300025298 Bacteria 3405
62 Ga0209256_1000024 3300025299 Bacteria 448909
63 Ga0209051_1000155 3300025303 Bacteria 129560
64 Ga0209257_1000236 3300025304 Bacteria 129543
65 Ga0207645_10004844 3300025907 Bacteria 9883
66 Ga0207646_10057279 3300025922 Bacteria 3482
67 Ga0207644_10086554 3300025931 Bacteria 2327
68 Ga0207667_10102431 3300025949 Bacteria 2953
69 Ga0207651_10077827 3300025960 Bacteria 2376
70 Ga0207677_10178930 3300026023 Unclassified 1666
71 Ga0207708_10149152 3300026075 Bacteria 1839
72 Ga0207702_10212666 3300026078 Unclassified 1798
73 Ga0207648_10023034 3300026089 Bacteria 5585
74 Ga0207676_10021947 3300026095 Bacteria 4690
75 Ga0209281_1000322 3300027111 Bacteria 84374
76 Ga0265318_10068466 3300028577 Bacteria 1317
77 Ga0265338_10037683 3300028800 Bacteria 4596
78 Ga0307408_100003126 3300031548 Bacteria 11407
79 Ga0307408_100003799 3300031548 Bacteria 10291
80 Ga0316575_10002218 3300031665 Bacteria 6482
81 Ga0316576_10017304 3300031727 Bacteria 4893
82 Ga0316576_10024025 3300031727 Bacteria 4253
83 Ga0316576_10084692 3300031727 Bacteria 2356
84 Ga0316578_10033641 3300031728 Bacteria 2938
85 Ga0307405_10221339 3300031731 Bacteria 1389
86 Ga0316577_10015853 3300031733 Bacteria 4148
87 Ga0316585_10026373 3300032137 Bacteria 1807
88 Ga0316580_10058836 3300032139 Bacteria 1180
89 Ga0316593_10000655 3300032168 Bacteria 6657
90 Ga0316592_1001006 3300033524 Bacteria 4353
91 Ga0316596_1001923 3300033541 Bacteria 4353
92 Ga0316596_1021207 3300033541 Bacteria 1655
93 Ga0316574_0000694 3300035398 Bacteria 14321
94 Ga0316574_0001014 3300035398 Bacteria 12677
95 Ga0316574_0004903 3300035398 Bacteria 7088
96 Ga0316574_0014571 3300035398 Bacteria 4545
97 Ga0316582_0004722 3300036647 Bacteria 6934
98 Ga0316584_0020559 3300036712 Bacteria 4787
99 Ga0316584_0033858 3300036712 Bacteria 3785
100 Ga0316584_0050937 3300036712 Bacteria 3096
101 Ga0316584_0198312 3300036712 Unclassified 1482
102 Ga0436364_0245816 3300037853 Bacteria 19569
103 Ga0400490_22380 3300038726 Bacteria 8491
104 Ga0400490_47679 3300038726 Bacteria 119204
105 Ga0400488_14941 3300038741 Bacteria 2543
106 Ga0400488_61051 3300038741 Unclassified 1710
107 Ga0400483_124784 3300039062 Bacteria 2680
108 Ga0400483_153369 3300039062 Bacteria 2539
109 Ga0400483_174450 3300039062 Bacteria 9080
110 Ga0400483_258798 3300039062 Bacteria 1021
111 Ga0436365_1919168 3300039437 Bacteria 4151
112 Ga0436361_0565150 3300039447 Bacteria 81523
113 Ga0436361_0878228 3300039447 Bacteria 3103
114 Ga0436361_1110927 3300039447 Bacteria 1370
115 Ga0439444_0006730 3300042437 Bacteria 1745
116 Ga0439459_0000751 3300042438 Bacteria 4455
117 Ga0466965_0018727 3300044683 Bacteria 3322
118 Ga0453684_0000230 3300044712 Bacteria 241327
119 Ga0466968_0016680 3300044735 Bacteria 2927
120 Ga0451576_0022344 3300045051 Bacteria 6861
121 Ga0495617_003150 3300046452 Bacteria 6280
122 Ga0495627_016290 3300046453 Bacteria 2547
123 Ga0495592_0070247 3300046454 Bacteria 2552
124 Ga0495603_0006809 3300046455 Bacteria 6853
125 Ga0495590_0018358 3300046457 Bacteria 2505
126 Ga0495590_0044393 3300046457 Bacteria 1550
127 Ga0495638_0000063 3300046460 Bacteria 185733
128 Ga0495638_0022859 3300046460 Bacteria 4099
129 Ga0495650_0000044 3300046471 Bacteria 355139
130 Ga0495650_0065424 3300046471 Bacteria 1443
131 Ga0495605_0002822 3300046474 Bacteria 10561
132 Ga0495605_0020326 3300046474 Bacteria 3529
133 Ga0495605_0022747 3300046474 Bacteria 3305
134 Ga0495584_0006457 3300046491 Bacteria 6135
135 Ga0495584_0007338 3300046491 Bacteria 5749
136 Ga0495584_0100243 3300046491 Bacteria 1464
137 Ga0495584_0157721 3300046491 Bacteria 1153
138 Ga0495585_0007064 3300046492 Bacteria 6903
139 Ga0495585_0008855 3300046492 Bacteria 6074
140 Ga0495585_0047139 3300046492 Bacteria 2400
141 Ga0495596_0002314 3300046500 Bacteria 10343
142 Ga0495596_0011242 3300046500 Bacteria 3867
143 Ga0495596_0068018 3300046500 Bacteria 1384
144 Ga0495607_0004227 3300046501 Bacteria 10651
145 Ga0495607_0036115 3300046501 Bacteria 2981
146 Ga0495607_0066201 3300046501 Bacteria 2034
147 Ga0495607_0116749 3300046501 Bacteria 1407
148 Ga0495583_0000292 3300046506 Bacteria 79152
149 Ga0495583_0001027 3300046506 Bacteria 31725
150 Ga0495583_0008266 3300046506 Bacteria 6380
151 Ga0495583_0021082 3300046506 Bacteria 3357
152 Ga0495583_0057262 3300046506 Bacteria 1753
153 Ga0495606_0005261 3300046507 Bacteria 12484
154 Ga0495606_0011232 3300046507 Bacteria 7328
155 Ga0495606_0081363 3300046507 Bacteria 2013
156 Ga0495616_0000691 3300046513 Bacteria 24963
157 Ga0495616_0006571 3300046513 Bacteria 7023
158 Ga0495616_0056896 3300046513 Bacteria 1930
159 Ga0495616_0086556 3300046513 Bacteria 1490
160 Ga0495616_0173842 3300046513 Bacteria 961
161 Ga0495631_0006024 3300046518 Bacteria 6303
162 Ga0495632_0008348 3300046519 Bacteria 6368
163 Ga0495632_0157711 3300046519 Bacteria 1046
164 Ga0495643_0011215 3300046522 Bacteria 5475
165 Ga0495643_0030537 3300046522 Bacteria 3008
166 Ga0495644_0016813 3300046523 Bacteria 2799
167 Ga0495644_0041521 3300046523 Bacteria 1732
168 Ga0495644_0073380 3300046523 Bacteria 1287
169 Ga0495648_0000057 3300046524 Bacteria 157446
170 Ga0495648_0000823 3300046524 Bacteria 32734
171 Ga0495648_0013232 3300046524 Bacteria 6113
172 Ga0495648_0029284 3300046524 Bacteria 3656
173 Ga0495663_0008556 3300046525 Bacteria 2837
174 Ga0495663_0035059 3300046525 Bacteria 1505
175 Ga0495666_0021612 3300046526 Bacteria 3185
176 Ga0495642_0013873 3300046528 Bacteria 3120
177 Ga0495642_0033571 3300046528 Bacteria 2063
178 Ga0495642_0036081 3300046528 Bacteria 1997
179 Ga0495642_0071468 3300046528 Bacteria 1452
180 Ga0495654_0064921 3300046530 Bacteria 1744
181 Ga0495609_0006370 3300046538 Bacteria 6024
182 Ga0495609_0010343 3300046538 Bacteria 4479
183 Ga0495609_0017273 3300046538 Bacteria 3351
184 Ga0495609_0034002 3300046538 Bacteria 2312
185 Ga0495621_0002725 3300046539 Bacteria 4790
186 Ga0495621_0106127 3300046539 Bacteria 1073
187 Ga0495597_0000836 3300046542 Bacteria 24212
188 Ga0495645_0273292 3300046543 Bacteria 1114
189 Ga0495633_0003065 3300046558 Bacteria 11373
190 Ga0495633_0022816 3300046558 Bacteria 3108
191 Ga0495633_0029680 3300046558 Bacteria 2659
192 Ga0495633_0060824 3300046558 Bacteria 1769
193 Ga0495656_0066177 3300046615 Bacteria 1591
194 Ga0495668_0000028 3300046616 Bacteria 286629
195 Ga0495668_0019098 3300046616 Bacteria 3955
196 Ga0495668_0051235 3300046616 Bacteria 2286
197 Ga0495668_0061211 3300046616 Bacteria 2076
198 Ga0495611_0002727 3300046648 Bacteria 7947
199 Ga0495625_0080168 3300046660 Bacteria 2274
200 Ga0495659_0027229 3300046664 Bacteria 1970
201 Ga0495661_0011552 3300046665 Bacteria 5988
202 Ga0495661_0036497 3300046665 Bacteria 3077
203 Ga0495661_0108311 3300046665 Bacteria 1552
204 Ga0495623_0248502 3300046679 Bacteria 1001
205 Ga0495646_0184707 3300046680 Bacteria 1142
206 Ga0495669_0016007 3300046684 Bacteria 3211
207 Ga0495669_0046944 3300046684 Bacteria 1928
208 Ga0495669_0113432 3300046684 Bacteria 1267
209 Ga0495613_0013215 3300046689 Bacteria 6135
210 Ga0495670_0010619 3300046691 Bacteria 4524
211 Ga0495649_0001718 3300046694 Bacteria 16209
212 Ga0495589_0035874 3300046794 Bacteria 2486
213 Ga0495589_0041729 3300046794 Bacteria 2288
214 Ga0495660_0014365 3300046810 Bacteria 4583
215 Ga0495660_0025861 3300046810 Bacteria 3331
216 Ga0495604_0123135 3300047317 Bacteria 1874
217 Ga0495674_0058945 3300047319 Bacteria 3354
218 Ga0495674_0243026 3300047319 Bacteria 1483
219 Ga0495672_0197958 3300047320 Bacteria 1006
220 Ga0495683_0000128 3300047323 Bacteria 75740
221 Ga0495683_0007365 3300047323 Bacteria 5963
222 Ga0495683_0077025 3300047323 Bacteria 1630
223 Ga0495683_0112770 3300047323 Bacteria 1296
224 Ga0495687_032029 3300047443 Bacteria 2406
225 Ga0495687_055785 3300047443 Bacteria 1650
226 Ga0495677_0009973 3300047445 Bacteria 3495
227 Ga0495677_0013029 3300047445 Bacteria 3027
228 Ga0495677_0015261 3300047445 Bacteria 2792
229 Ga0495677_0023057 3300047445 Bacteria 2259
230 Ga0495679_075966 3300047446 Bacteria 960
231 Ga0495685_054932 3300047447 Bacteria 1347
232 Ga0495673_0000193 3300047469 Bacteria 96057
233 Ga0495673_0016914 3300047469 Bacteria 3717
234 Ga0495673_0020212 3300047469 Bacteria 3320
235 Ga0495681_0011411 3300047470 Bacteria 5292
236 Ga0495686_0044843 3300047472 Bacteria 2799
237 Ga0495686_0063405 3300047472 Bacteria 2290
238 Ga0495626_0008255 3300048091 Bacteria 5728
239 Ga0495626_0013802 3300048091 Bacteria 4189
240 Ga0495626_0055776 3300048091 Bacteria 1810
241 Ga0495626_0058965 3300048091 Bacteria 1752
242 Ga0495626_0131651 3300048091 Bacteria 1067
243 Ga0495626_0135165 3300048091 Bacteria 1049
244 Ga0496100_0148081 3300048903 Bacteria 1671
245 Ga0496101_0121202 3300048904 Bacteria 1977
246 Ga0496102_0000071 3300048905 Bacteria 154320
247 Ga0496102_0238223 3300048905 Bacteria 1716
248 Ga0496102_0526511 3300048905 Bacteria 1104
249 Ga0496103_0113902 3300048906 Bacteria 1719
250 Ga0496104_0072645 3300048907 Bacteria 3272
251 Ga0496104_0132587 3300048907 Bacteria 2393
252 Ga0496105_0053799 3300048908 Bacteria 3324
253 Ga0496107_0256792 3300048910 Bacteria 1301
254 Ga0496109_0211514 3300048912 Bacteria 1824
255 Ga0496112_0110993 3300048915 Bacteria 2712
256 Ga0496112_0121395 3300048915 Bacteria 2583
257 Ga0496113_0001998 3300048916 Bacteria 11687
258 Ga0496114_0012808 3300048917 Bacteria 6715
259 Ga0496115_0129215 3300048918 Bacteria 2082
260 Ga0496115_0318302 3300048918 Bacteria 1273
261 Ga0496119_0061547 3300048922 Bacteria 2241
262 Ga0496121_0006768 3300048924 Bacteria 14062
263 Ga0496122_0144790 3300048925 Bacteria 1479
264 Ga0495678_000022 3300049459 Bacteria 237031
265 Ga0495678_019188 3300049459 Bacteria 3056
266 Ga0501070_0354796 3300049586 Bacteria 1190
267 Ga0501225_0050014 3300049705 Bacteria 1163
268 nmdc:mga09592_26422_c1 3300050508 Bacteria 4809
269 nmdc:mga06r32_160870_c1 3300050510 Bacteria 2228
270 nmdc:mga0n895_648071_c1 3300050512 Bacteria 1055
271 nmdc:mga0rr50_251831_c1 3300050513 Bacteria 1467
272 nmdc:mga0a205_47763_c1 3300050515 Bacteria 4131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10288547 Ga0070681_102885472 243
2 3300005563 Ga0068855_100139225 Ga0068855_1001392254 243
3 3300005614 Ga0068856_100135527 Ga0068856_1001355272 243
4 3300009093 Ga0105240_10099328 Ga0105240_100993284 243
5 3300025949 Ga0207667_10102431 Ga0207667_101024312 243
6 3300026078 Ga0207702_10212666 Ga0207702_102126663 243
7 3300046526 Ga0495666_0021612 Ga0495666_0021612_1374_2171 244
8 3300046679 Ga0495623_0248502 Ga0495623_0248502_83_880 244
9 3300047317 Ga0495604_0123135 Ga0495604_0123135_25_822 244
10 3300046474 Ga0495605_0020326 Ga0495605_0020326_1914_2726 247
11 3300015261 Ga0182006_1011770 Ga0182006_10117704 250
12 3300005438 Ga0070701_10082414 Ga0070701_100824142 252
13 3300005617 Ga0068859_100977239 Ga0068859_1009772391 252
14 iso_pu_bacteria 2738541300 2738842297 252
15 iso_pu_bacteria 2738543018 2739273998 252
16 iso_pu_bacteria 2738543030 2739343042 252
17 3300046471 Ga0495650_0065424 Ga0495650_0065424_153_992 254
18 3300046524 Ga0495648_0000057 Ga0495648_0000057_3309_4097 254
19 3300046542 Ga0495597_0000836 Ga0495597_0000836_1654_2442 254
20 3300048091 Ga0495626_0008255 Ga0495626_0008255_888_1676 254
21 iso_pu_bacteria 2643221664 2644354762 254
22 iso_pu_bacteria 2643221645 2644251059 255
23 iso_pu_bacteria 2808606418 2809145477 255
24 3300021361 Ga0213872_10021920 Ga0213872_100219202 256
25 3300039447 Ga0436361_0878228 Ga0436361_0878228_1744_2523 256
26 3300039447 Ga0436361_1110927 Ga0436361_1110927_57_836 256
27 3300044683 Ga0466965_0018727 Ga0466965_0018727_2500_3294 256
28 3300044735 Ga0466968_0016680 Ga0466968_0016680_1143_1937 256
29 3300047443 Ga0495687_055785 Ga0495687_055785_31_825 256
30 3300046474 Ga0495605_0002822 Ga0495605_0002822_9628_10449 257
31 3300046491 Ga0495584_0100243 Ga0495584_0100243_336_1160 257
32 3300046501 Ga0495607_0004227 Ga0495607_0004227_9608_10429 257
33 3300046513 Ga0495616_0056896 Ga0495616_0056896_137_934 257
34 3300046523 Ga0495644_0073380 Ga0495644_0073380_155_970 257
35 3300046524 Ga0495648_0000823 Ga0495648_0000823_20569_21390 257
36 3300046665 Ga0495661_0011552 Ga0495661_0011552_4467_5264 257
37 3300046810 Ga0495660_0014365 Ga0495660_0014365_3633_4454 257
38 3300048091 Ga0495626_0013802 Ga0495626_0013802_1880_2701 257
39 3300048906 Ga0496103_0113902 Ga0496103_0113902_247_1095 257
40 3300049459 Ga0495678_000022 Ga0495678_000022_18740_19561 257
41 iso_pu_bacteria 2894510363 2894512331 257
42 3300032168 Ga0316593_10000655 Ga0316593_100006553 258
43 3300033524 Ga0316592_1001006 Ga0316592_10010062 258
44 3300033541 Ga0316596_1021207 Ga0316596_10212072 258
45 3300037853 Ga0436364_0245816 Ga0436364_0245816_15321_16121 258
46 3300039437 Ga0436365_1919168 Ga0436365_1919168_924_1724 258
47 3300046500 Ga0495596_0011242 Ga0495596_0011242_1149_1964 258
48 3300046501 Ga0495607_0066201 Ga0495607_0066201_938_1747 258
49 3300046513 Ga0495616_0173842 Ga0495616_0173842_56_871 258
50 3300046518 Ga0495631_0006024 Ga0495631_0006024_1147_1962 258
51 3300046519 Ga0495632_0157711 Ga0495632_0157711_207_1022 258
52 3300046528 Ga0495642_0013873 Ga0495642_0013873_26_841 258
53 3300046530 Ga0495654_0064921 Ga0495654_0064921_591_1400 258
54 3300046538 Ga0495609_0017273 Ga0495609_0017273_468_1283 258
55 3300046616 Ga0495668_0051235 Ga0495668_0051235_1412_2227 258
56 3300046689 Ga0495613_0013215 Ga0495613_0013215_4472_5281 258
57 3300047323 Ga0495683_0112770 Ga0495683_0112770_237_1052 258
58 3300048091 Ga0495626_0131651 Ga0495626_0131651_199_1014 258
59 3300031548 Ga0307408_100003126 Ga0307408_1000031265 259
60 3300046471 Ga0495650_0000044 Ga0495650_0000044_76701_77531 259
61 3300046501 Ga0495607_0036115 Ga0495607_0036115_2099_2908 259
62 3300046507 Ga0495606_0011232 Ga0495606_0011232_4615_5445 259
63 3300046528 Ga0495642_0071468 Ga0495642_0071468_80_910 259
64 3300046615 Ga0495656_0066177 Ga0495656_0066177_740_1549 259
65 3300047320 Ga0495672_0197958 Ga0495672_0197958_28_843 259
66 3300047446 Ga0495679_075966 Ga0495679_075966_61_870 259
67 3300047472 Ga0495686_0063405 Ga0495686_0063405_995_1831 259
68 3300049705 Ga0501225_0050014 Ga0501225_0050014_115_936 259
69 iso_pu_bacteria 2513237166 2514053249 259
70 iso_pu_bacteria 2562617112 2563059819 259
71 iso_pu_bacteria 2643221577 2643896948 259
72 iso_pu_bacteria 2711768613 2713480472 259
73 iso_pu_bacteria 2791355137 2792832864 259
74 iso_pu_bacteria 2840878972 2840881405 259
75 iso_pu_bacteria 2904615490 2904622699 259
76 iso_pu_bacteria 2921643360 2921644304 259
77 3300005341 Ga0070691_10014223 Ga0070691_100142234 260
78 3300005444 Ga0070694_100003219 Ga0070694_1000032197 260
79 3300005471 Ga0070698_100042489 Ga0070698_1000424894 260
80 3300005549 Ga0070704_100004626 Ga0070704_1000046266 260
81 3300006844 Ga0075428_100058110 Ga0075428_1000581103 260
82 3300011119 Ga0105246_10179905 Ga0105246_101799052 260
83 3300028577 Ga0265318_10068466 Ga0265318_100684662 260
84 3300035398 Ga0316574_0000694 Ga0316574_0000694_5918_6742 260
85 3300036712 Ga0316584_0033858 Ga0316584_0033858_2112_2936 260
86 3300039062 Ga0400483_124784 Ga0400483_124784_993_1808 260
87 3300039062 Ga0400483_153369 Ga0400483_153369_962_1777 260
88 3300042437 Ga0439444_0006730 Ga0439444_0006730_357_1181 260
89 3300046454 Ga0495592_0070247 Ga0495592_0070247_686_1621 260
90 3300046491 Ga0495584_0007338 Ga0495584_0007338_1046_1855 260
91 3300046506 Ga0495583_0008266 Ga0495583_0008266_1041_1850 260
92 3300046522 Ga0495643_0011215 Ga0495643_0011215_1364_2215 260
93 3300046522 Ga0495643_0030537 Ga0495643_0030537_1046_1849 260
94 3300046525 Ga0495663_0035059 Ga0495663_0035059_417_1223 260
95 3300046538 Ga0495609_0034002 Ga0495609_0034002_1131_1982 260
96 3300046539 Ga0495621_0002725 Ga0495621_0002725_1597_2403 260
97 3300046543 Ga0495645_0273292 Ga0495645_0273292_218_1033 260
98 3300046664 Ga0495659_0027229 Ga0495659_0027229_694_1500 260
99 3300046680 Ga0495646_0184707 Ga0495646_0184707_23_958 260
100 3300046684 Ga0495669_0016007 Ga0495669_0016007_2372_3181 260
101 3300046684 Ga0495669_0113432 Ga0495669_0113432_345_1151 260
102 3300046694 Ga0495649_0001718 Ga0495649_0001718_15320_16123 260
103 3300046810 Ga0495660_0025861 Ga0495660_0025861_1534_2343 260
104 3300047319 Ga0495674_0243026 Ga0495674_0243026_295_1089 260
105 3300047447 Ga0495685_054932 Ga0495685_054932_291_1097 260
106 3300047469 Ga0495673_0000193 Ga0495673_0000193_38404_39225 260
107 3300048091 Ga0495626_0058965 Ga0495626_0058965_794_1597 260
108 3300048091 Ga0495626_0135165 Ga0495626_0135165_42_845 260
109 3300048907 Ga0496104_0072645 Ga0496104_0072645_2248_3087 260
110 3300048918 Ga0496115_0318302 Ga0496115_0318302_202_999 260
111 3300050508 nmdc:mga09592_26422_c1 nmdc:mga09592_26422_c1_3937_4761 260
112 3300050515 nmdc:mga0a205_47763_c1 nmdc:mga0a205_47763_c1_2772_3578 260
113 3300006914 Ga0075436_100000215 Ga0075436_10000021513 261
114 3300007076 Ga0075435_100213797 Ga0075435_1002137972 261
115 3300036712 Ga0316584_0050937 Ga0316584_0050937_268_1098 261
116 3300039062 Ga0400483_258798 Ga0400483_258798_175_987 261
117 3300047445 Ga0495677_0023057 Ga0495677_0023057_1049_1855 261
118 3300050513 nmdc:mga0rr50_251831_c1 nmdc:mga0rr50_251831_c1_328_1161 261
119 3300005330 Ga0070690_100149498 Ga0070690_1001494982 262
120 3300005336 Ga0070680_100032524 Ga0070680_1000325242 262
121 3300005339 Ga0070660_100080062 Ga0070660_1000800622 262
122 3300005355 Ga0070671_100062532 Ga0070671_1000625322 262
123 3300020082 Ga0206353_10640822 Ga0206353_106408221 262
124 3300025931 Ga0207644_10086554 Ga0207644_100865543 262
125 3300046506 Ga0495583_0000292 Ga0495583_0000292_76830_77642 262
126 3300046616 Ga0495668_0000028 Ga0495668_0000028_164969_165775 262
127 3300049459 Ga0495678_019188 Ga0495678_019188_668_1474 262
128 3300003763 Ga0055529_1002954 Ga0055529_10029543 263
129 3300003775 Ga0055524_1000182 Ga0055524_100018213 263
130 3300003791 Ga0055530_10005247 Ga0055530_100052475 263
131 3300003792 Ga0055540_1003124 Ga0055540_10031244 263
132 3300003794 Ga0055531_10010129 Ga0055531_100101292 263
133 3300005338 Ga0068868_100085949 Ga0068868_1000859492 263
134 3300005338 Ga0068868_100108326 Ga0068868_1001083262 263
135 3300005340 Ga0070689_100604341 Ga0070689_1006043411 263
136 3300005343 Ga0070687_100005019 Ga0070687_1000050194 263
137 3300005355 Ga0070671_100115636 Ga0070671_1001156362 263
138 3300005364 Ga0070673_100110357 Ga0070673_1001103573 263
139 3300005367 Ga0070667_100477545 Ga0070667_1004775451 263
140 3300005440 Ga0070705_100116116 Ga0070705_1001161162 263
141 3300005441 Ga0070700_100408991 Ga0070700_1004089911 263
142 3300005444 Ga0070694_100028158 Ga0070694_1000281582 263
143 3300005444 Ga0070694_100072781 Ga0070694_1000727812 263
144 3300005458 Ga0070681_10062886 Ga0070681_100628863 263
145 3300005468 Ga0070707_100046385 Ga0070707_1000463853 263
146 3300005535 Ga0070684_100744862 Ga0070684_1007448621 263
147 3300005545 Ga0070695_100070435 Ga0070695_1000704353 263
148 3300005547 Ga0070693_100269239 Ga0070693_1002692391 263
149 3300005549 Ga0070704_100026854 Ga0070704_1000268543 263
150 3300005549 Ga0070704_100156124 Ga0070704_1001561241 263
151 3300005617 Ga0068859_100640142 Ga0068859_1006401421 263
152 3300005618 Ga0068864_100138783 Ga0068864_1001387833 263
153 3300005842 Ga0068858_100060298 Ga0068858_1000602983 263
154 3300006358 Ga0068871_100161131 Ga0068871_1001611313 263
155 3300006847 Ga0075431_100000901 Ga0075431_1000009014 263
156 3300006871 Ga0075434_100506345 Ga0075434_1005063452 263
157 3300006931 Ga0097620_100640113 Ga0097620_1006401131 263
158 3300006946 Ga0079104_1000333 Ga0079104_100033351 263
159 3300007076 Ga0075435_100007075 Ga0075435_1000070756 263
160 3300009098 Ga0105245_10350351 Ga0105245_103503512 263
161 3300009101 Ga0105247_10075286 Ga0105247_100752862 263
162 3300014325 Ga0163163_10057228 Ga0163163_100572282 263
163 3300014325 Ga0163163_10313544 Ga0163163_103135442 263
164 3300014326 Ga0157380_10666052 Ga0157380_106660521 263
165 3300021361 Ga0213872_10000019 Ga0213872_1000001990 263
166 3300025298 Ga0209050_1001069 Ga0209050_100106920 263
167 3300025298 Ga0209050_1014421 Ga0209050_10144212 263
168 3300025299 Ga0209256_1000024 Ga0209256_1000024394 263
169 3300025303 Ga0209051_1000155 Ga0209051_100015552 263
170 3300025304 Ga0209257_1000236 Ga0209257_100023652 263
171 3300025907 Ga0207645_10004844 Ga0207645_100048443 263
172 3300025922 Ga0207646_10057279 Ga0207646_100572793 263
173 3300025960 Ga0207651_10077827 Ga0207651_100778273 263
174 3300026023 Ga0207677_10178930 Ga0207677_101789302 263
175 3300026075 Ga0207708_10149152 Ga0207708_101491522 263
176 3300026089 Ga0207648_10023034 Ga0207648_100230347 263
177 3300026095 Ga0207676_10021947 Ga0207676_100219473 263
178 3300027111 Ga0209281_1000322 Ga0209281_100032250 263
179 3300028800 Ga0265338_10037683 Ga0265338_100376833 263
180 3300031548 Ga0307408_100003799 Ga0307408_1000037997 263
181 3300031665 Ga0316575_10002218 Ga0316575_100022184 263
182 3300031727 Ga0316576_10017304 Ga0316576_100173043 263
183 3300031727 Ga0316576_10024025 Ga0316576_100240254 263
184 3300031727 Ga0316576_10084692 Ga0316576_100846922 263
185 3300031728 Ga0316578_10033641 Ga0316578_100336413 263
186 3300031731 Ga0307405_10221339 Ga0307405_102213392 263
187 3300031733 Ga0316577_10015853 Ga0316577_100158533 263
188 3300032137 Ga0316585_10026373 Ga0316585_100263733 263
189 3300032139 Ga0316580_10058836 Ga0316580_100588362 263
190 3300033541 Ga0316596_1001923 Ga0316596_10019234 263
191 3300035398 Ga0316574_0001014 Ga0316574_0001014_6770_7588 263
192 3300035398 Ga0316574_0004903 Ga0316574_0004903_4728_5582 263
193 3300035398 Ga0316574_0014571 Ga0316574_0014571_1098_1919 263
194 3300036647 Ga0316582_0004722 Ga0316582_0004722_1806_2660 263
195 3300036712 Ga0316584_0020559 Ga0316584_0020559_142_996 263
196 3300036712 Ga0316584_0198312 Ga0316584_0198312_362_1180 263
197 3300038726 Ga0400490_22380 Ga0400490_22380_6530_7339 263
198 3300038726 Ga0400490_47679 Ga0400490_47679_51291_52100 263
199 3300038741 Ga0400488_14941 Ga0400488_14941_1222_2031 263
200 3300038741 Ga0400488_61051 Ga0400488_61051_684_1496 263
201 3300039062 Ga0400483_174450 Ga0400483_174450_4144_4956 263
202 3300039447 Ga0436361_0565150 Ga0436361_0565150_46680_47489 263
203 3300042438 Ga0439459_0000751 Ga0439459_0000751_1354_2181 263
204 3300044712 Ga0453684_0000230 Ga0453684_0000230_186826_187662 263
205 3300045051 Ga0451576_0022344 Ga0451576_0022344_905_1744 263
206 3300046452 Ga0495617_003150 Ga0495617_003150_1155_1988 263
207 3300046453 Ga0495627_016290 Ga0495627_016290_746_1579 263
208 3300046455 Ga0495603_0006809 Ga0495603_0006809_5057_5896 263
209 3300046457 Ga0495590_0018358 Ga0495590_0018358_372_1211 263
210 3300046457 Ga0495590_0044393 Ga0495590_0044393_397_1230 263
211 3300046460 Ga0495638_0000063 Ga0495638_0000063_152197_153024 263
212 3300046460 Ga0495638_0022859 Ga0495638_0022859_1248_2081 263
213 3300046474 Ga0495605_0022747 Ga0495605_0022747_1203_2042 263
214 3300046491 Ga0495584_0006457 Ga0495584_0006457_4374_5210 263
215 3300046491 Ga0495584_0157721 Ga0495584_0157721_66_905 263
216 3300046492 Ga0495585_0007064 Ga0495585_0007064_1659_2492 263
217 3300046492 Ga0495585_0008855 Ga0495585_0008855_4315_5151 263
218 3300046492 Ga0495585_0047139 Ga0495585_0047139_779_1612 263
219 3300046500 Ga0495596_0002314 Ga0495596_0002314_4173_5006 263
220 3300046500 Ga0495596_0068018 Ga0495596_0068018_296_1129 263
221 3300046501 Ga0495607_0116749 Ga0495607_0116749_413_1246 263
222 3300046506 Ga0495583_0001027 Ga0495583_0001027_1798_2631 263
223 3300046506 Ga0495583_0021082 Ga0495583_0021082_2201_3034 263
224 3300046506 Ga0495583_0057262 Ga0495583_0057262_308_1141 263
225 3300046507 Ga0495606_0005261 Ga0495606_0005261_37_870 263
226 3300046507 Ga0495606_0081363 Ga0495606_0081363_1101_1934 263
227 3300046513 Ga0495616_0000691 Ga0495616_0000691_19890_20723 263
228 3300046513 Ga0495616_0006571 Ga0495616_0006571_2918_3751 263
229 3300046513 Ga0495616_0086556 Ga0495616_0086556_429_1268 263
230 3300046519 Ga0495632_0008348 Ga0495632_0008348_5183_6016 263
231 3300046523 Ga0495644_0016813 Ga0495644_0016813_281_1114 263
232 3300046523 Ga0495644_0041521 Ga0495644_0041521_452_1303 263
233 3300046524 Ga0495648_0013232 Ga0495648_0013232_1127_1960 263
234 3300046524 Ga0495648_0029284 Ga0495648_0029284_1269_2108 263
235 3300046525 Ga0495663_0008556 Ga0495663_0008556_582_1415 263
236 3300046528 Ga0495642_0033571 Ga0495642_0033571_884_1717 263
237 3300046528 Ga0495642_0036081 Ga0495642_0036081_527_1366 263
238 3300046538 Ga0495609_0006370 Ga0495609_0006370_1070_1906 263
239 3300046538 Ga0495609_0010343 Ga0495609_0010343_3162_3995 263
240 3300046539 Ga0495621_0106127 Ga0495621_0106127_140_988 263
241 3300046558 Ga0495633_0003065 Ga0495633_0003065_10072_10908 263
242 3300046558 Ga0495633_0022816 Ga0495633_0022816_678_1511 263
243 3300046558 Ga0495633_0029680 Ga0495633_0029680_898_1731 263
244 3300046558 Ga0495633_0060824 Ga0495633_0060824_835_1668 263
245 3300046616 Ga0495668_0019098 Ga0495668_0019098_2123_2956 263
246 3300046616 Ga0495668_0061211 Ga0495668_0061211_300_1133 263
247 3300046648 Ga0495611_0002727 Ga0495611_0002727_5263_6096 263
248 3300046660 Ga0495625_0080168 Ga0495625_0080168_113_946 263
249 3300046665 Ga0495661_0036497 Ga0495661_0036497_1309_2142 263
250 3300046665 Ga0495661_0108311 Ga0495661_0108311_665_1498 263
251 3300046684 Ga0495669_0046944 Ga0495669_0046944_966_1799 263
252 3300046691 Ga0495670_0010619 Ga0495670_0010619_2725_3558 263
253 3300046794 Ga0495589_0035874 Ga0495589_0035874_1203_2042 263
254 3300046794 Ga0495589_0041729 Ga0495589_0041729_1156_1989 263
255 3300047319 Ga0495674_0058945 Ga0495674_0058945_918_1757 263
256 3300047323 Ga0495683_0000128 Ga0495683_0000128_30400_31236 263
257 3300047323 Ga0495683_0007365 Ga0495683_0007365_4071_4904 263
258 3300047323 Ga0495683_0077025 Ga0495683_0077025_372_1211 263
259 3300047443 Ga0495687_032029 Ga0495687_032029_1095_1928 263
260 3300047445 Ga0495677_0009973 Ga0495677_0009973_210_1043 263
261 3300047445 Ga0495677_0013029 Ga0495677_0013029_1003_1854 263
262 3300047445 Ga0495677_0015261 Ga0495677_0015261_799_1638 263
263 3300047469 Ga0495673_0016914 Ga0495673_0016914_1560_2411 263
264 3300047469 Ga0495673_0020212 Ga0495673_0020212_1203_2042 263
265 3300047470 Ga0495681_0011411 Ga0495681_0011411_711_1544 263
266 3300047472 Ga0495686_0044843 Ga0495686_0044843_322_1155 263
267 3300048091 Ga0495626_0055776 Ga0495626_0055776_182_1015 263
268 3300048903 Ga0496100_0148081 Ga0496100_0148081_787_1626 263
269 3300048904 Ga0496101_0121202 Ga0496101_0121202_904_1743 263
270 3300048905 Ga0496102_0000071 Ga0496102_0000071_120417_121271 263
271 3300048905 Ga0496102_0238223 Ga0496102_0238223_173_1012 263
272 3300048905 Ga0496102_0526511 Ga0496102_0526511_46_894 263
273 3300048907 Ga0496104_0132587 Ga0496104_0132587_717_1556 263
274 3300048908 Ga0496105_0053799 Ga0496105_0053799_279_1118 263
275 3300048910 Ga0496107_0256792 Ga0496107_0256792_410_1258 263
276 3300048912 Ga0496109_0211514 Ga0496109_0211514_60_908 263
277 3300048915 Ga0496112_0110993 Ga0496112_0110993_964_1803 263
278 3300048915 Ga0496112_0121395 Ga0496112_0121395_424_1266 263
279 3300048916 Ga0496113_0001998 Ga0496113_0001998_1109_1948 263
280 3300048917 Ga0496114_0012808 Ga0496114_0012808_4181_5026 263
281 3300048918 Ga0496115_0129215 Ga0496115_0129215_831_1670 263
282 3300048922 Ga0496119_0061547 Ga0496119_0061547_302_1141 263
283 3300048924 Ga0496121_0006768 Ga0496121_0006768_1100_1939 263
284 3300048925 Ga0496122_0144790 Ga0496122_0144790_517_1356 263
285 3300049586 Ga0501070_0354796 Ga0501070_0354796_101_892 263
286 3300050510 nmdc:mga06r32_160870_c1 nmdc:mga06r32_160870_c1_1231_2079 263
287 3300050512 nmdc:mga0n895_648071_c1 nmdc:mga0n895_648071_c1_81_917 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07024

ImpE

ImpE protein

178

303

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uqy-assembly1.cif.gz_A coevolution of the atpase clpv, the tssb-tssc sheath and the accessory hsie protein distinguishes two type vi secretion classes 0.9669 3 261
4uqy-assembly1.cif.gz_A coevolution of the atpase clpv, the tssb-tssc sheath and the accessory hsie protein distinguishes two type vi secretion classes 0.9559 3 261
4z29-assembly2.cif.gz_B crystal structure of the magnetobacterial protein mtxa c-terminal domain 0.9303 3 59
1zbp-assembly1.cif.gz_A x-ray crystal structure of protein vpa1032 from vibrio parahaemolyticus. northeast structural genomics consortium target vpr44 0.9201 3 261
1zbp-assembly1.cif.gz_A x-ray crystal structure of protein vpa1032 from vibrio parahaemolyticus. northeast structural genomics consortium target vpr44 0.9001 3 261
ID Description Score Start End Superfamily
af_E7EXH4_169_241_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9846 3 61 1.25.40.10
4uqzA01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9779 3 85 1.25.40.10
4uqyA01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9707 3 85 1.25.40.10
4uqxA01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9688 3 85 1.25.40.10
af_Q5CZ52_184_270_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9556 3 61 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A3D4RVU9-F1-model_v4 Virulence protein SciE type 0.9913 1 263
AF-A0A1Y3A1G5-F1-model_v4 Virulence protein SciE type 0.9904 2 263
AF-A0A3D4RVU9-F1-model_v4 Virulence protein SciE type 0.9876 1 263
AF-X1STN6-F1-model_v4 Uncharacterized protein 0.9875 1 80
AF-A0A4Q3ZIP4-F1-model_v4 Virulence protein SciE type 0.9874 3 263

Feature Viewer

pLDDT pTM Quality
95.42 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map