F388183

General Info

Members Datasets Scaffolds Average Seq Length
287 214 574 223

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0003933|Ga0495583_0003933_9085_9849
Length 254
Sequence MSGLTLRSEARKARRGEHHLDRKDCLTMVERVGEQNPDWRAVDDYIADHLLGDDAALNAALAANAAGGLPDIDVSPAQGRMLHLFARMVGARRILEVGTLGGYSTIELARALPADGKLISLEIDPHHADVARANIARAGLGDRAEVRTGAALDTLEAMVAADEGPFDLVFIDADKQNNPAYVRAALAMSRPGTTIIVDNVIREGGVLDAASTDERIQGTRRLFEAVGVEKRLTATAVQTVGVKKWDGFLIAVVD

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
116 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
117 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
200 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
201 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
202 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
203 2619618881 Frankia sp. ACN1ag Isolate Unclassified
204 2619619003 Frankia sp. CpI1-P Isolate Nodule
205 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
206 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
207 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
208 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
209 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
210 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
211 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
212 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
213 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
214 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.12
Metatranscriptomes 0
Isolates 4.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.72
Nodule 1.05
Rhizoplane 5.23
Rhizosphere 63.76
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0003933 3300046506 Bacteria 10993
2 JGI24740J21852_10023592 3300001979 Bacteria 2098
3 JGI24737J22298_10003344 3300001990 Bacteria 5674
4 JGI25153J46596_10000002 3300003215 Bacteria 653569
5 Ga0055525_1000076 3300003759 Bacteria 168820
6 Ga0055542_1000020 3300003762 Bacteria 335745
7 Ga0055529_1000016 3300003763 Bacteria 364775
8 Ga0055536_1001635 3300003781 Bacteria 13333
9 Ga0055536_1008468 3300003781 Bacteria 4412
10 Ga0055534_1013379 3300003784 Bacteria 1579
11 Ga0055530_10000095 3300003791 Bacteria 74707
12 Ga0055531_10002750 3300003794 Bacteria 11546
13 Ga0055531_10004838 3300003794 Bacteria 8035
14 Ga0070658_10003922 3300005327 Bacteria 12198
15 Ga0070670_100049964 3300005331 Bacteria 3595
16 Ga0070682_100232402 3300005337 Bacteria 1319
17 Ga0070660_100006462 3300005339 Bacteria 8128
18 Ga0070661_100002801 3300005344 Bacteria 11966
19 Ga0070668_100003809 3300005347 Bacteria 11142
20 Ga0070668_100163580 3300005347 Bacteria 1807
21 Ga0070668_100708069 3300005347 Bacteria 888
22 Ga0070671_100005425 3300005355 Bacteria 10176
23 Ga0070671_100229021 3300005355 Bacteria 1577
24 Ga0070674_100091557 3300005356 Bacteria 2196
25 Ga0070674_100366003 3300005356 Bacteria 1169
26 Ga0070673_100104716 3300005364 Bacteria 2337
27 Ga0070659_100010099 3300005366 Bacteria 6950
28 Ga0070659_100293278 3300005366 Bacteria 1355
29 Ga0070667_100083997 3300005367 Bacteria 2729
30 Ga0070713_100011348 3300005436 Bacteria 6486
31 Ga0070700_100094073 3300005441 Bacteria 1962
32 Ga0070663_100016590 3300005455 Bacteria 4788
33 Ga0070678_100003133 3300005456 Bacteria 9157
34 Ga0070678_101131154 3300005456 Bacteria 724
35 Ga0070662_100108128 3300005457 Bacteria 2115
36 Ga0068853_100263914 3300005539 Bacteria 1584
37 Ga0068853_100578549 3300005539 Bacteria 1065
38 Ga0070686_100000347 3300005544 Bacteria 29937
39 Ga0070696_100117967 3300005546 Bacteria 1918
40 Ga0070665_100005577 3300005548 Bacteria 12940
41 Ga0070665_100217182 3300005548 Bacteria 1913
42 Ga0068855_100721057 3300005563 Bacteria 1065
43 Ga0068855_100902800 3300005563 Bacteria 933
44 Ga0070664_100139248 3300005564 Bacteria 2136
45 Ga0068857_100212456 3300005577 Bacteria 1766
46 Ga0068857_100243285 3300005577 Bacteria 1648
47 Ga0068854_100028637 3300005578 Bacteria 3851
48 Ga0068852_100271343 3300005616 Bacteria 1632
49 Ga0068852_100372407 3300005616 Bacteria 1399
50 Ga0068864_100008891 3300005618 Bacteria 8280
51 Ga0068866_10299796 3300005718 Bacteria 1003
52 Ga0068851_10028228 3300005834 Bacteria 2771
53 Ga0068863_100010845 3300005841 Bacteria 8837
54 Ga0068860_100270192 3300005843 Bacteria 1659
55 Ga0081539_10046595 3300005985 Bacteria 2483
56 Ga0070717_10000151 3300006028 Bacteria 51773
57 Ga0075366_10222226 3300006195 Bacteria 1151
58 Ga0097621_100170583 3300006237 Bacteria 1875
59 Ga0075370_10009651 3300006353 Bacteria 5022
60 Ga0105240_10354590 3300009093 Bacteria 1663
61 Ga0105247_10067333 3300009101 Bacteria 2231
62 Ga0105243_10000116 3300009148 Bacteria 92035
63 Ga0105241_10006724 3300009174 Bacteria 8460
64 Ga0105237_10025329 3300009545 Bacteria 6067
65 Ga0105246_10058058 3300011119 Bacteria 2680
66 Ga0157373_10218480 3300013100 Bacteria 1344
67 Ga0157371_10000030 3300013102 Bacteria 241585
68 Ga0157370_10178295 3300013104 Bacteria 1975
69 Ga0157378_10350142 3300013297 Bacteria 1443
70 Ga0163162_10451909 3300013306 Bacteria 1417
71 Ga0157372_10078856 3300013307 Bacteria 3722
72 Ga0157379_10002908 3300014968 Bacteria 14458
73 Ga0157376_10209898 3300014969 Bacteria 1797
74 Ga0163161_10185678 3300017792 Bacteria 1596
75 Ga0209563_100019 3300025230 Bacteria 697828
76 Ga0209677_105825 3300025253 Bacteria 3101
77 Ga0209148_1000017 3300025254 Bacteria 787064
78 Ga0209455_1000005 3300025272 Bacteria 1416756
79 Ga0209675_1000025 3300025291 Bacteria 294102
80 Ga0209676_1000362 3300025292 Bacteria 85770
81 Ga0209676_1003189 3300025292 Bacteria 10409
82 Ga0209676_1023122 3300025292 Bacteria 2041
83 Ga0209025_1019137 3300025294 Bacteria 3826
84 Ga0209758_1000001 3300025297 Bacteria 1981790
85 Ga0209050_1000849 3300025298 Bacteria 41596
86 Ga0209050_1003508 3300025298 Bacteria 11474
87 Ga0209257_1000860 3300025304 Bacteria 43237
88 Ga0209257_1001370 3300025304 Bacteria 29369
89 Ga0209257_1003116 3300025304 Bacteria 14836
90 Ga0207656_10000453 3300025321 Bacteria 13722
91 Ga0207710_10353498 3300025900 Bacteria 749
92 Ga0207688_10029110 3300025901 Bacteria 3039
93 Ga0207647_10058462 3300025904 Bacteria 2361
94 Ga0207647_10097931 3300025904 Bacteria 1743
95 Ga0207705_10000412 3300025909 Bacteria 37600
96 Ga0207654_10006403 3300025911 Bacteria 5926
97 Ga0207695_10098010 3300025913 Bacteria 2931
98 Ga0207695_10187037 3300025913 Bacteria 1989
99 Ga0207695_10291139 3300025913 Bacteria 1525
100 Ga0207695_10418153 3300025913 Bacteria 1225
101 Ga0207671_10009910 3300025914 Bacteria 7920
102 Ga0207657_10002115 3300025919 Bacteria 21475
103 Ga0207649_10000351 3300025920 Bacteria 34859
104 Ga0207694_10004475 3300025924 Bacteria 10904
105 Ga0207687_10066807 3300025927 Bacteria 2556
106 Ga0207644_10006086 3300025931 Bacteria 7869
107 Ga0207690_10001129 3300025932 Bacteria 17024
108 Ga0207706_10040507 3300025933 Bacteria 4128
109 Ga0207709_10000031 3300025935 Bacteria 329046
110 Ga0207669_10001898 3300025937 Bacteria 8860
111 Ga0207669_10005682 3300025937 Bacteria 5623
112 Ga0207679_10024474 3300025945 Bacteria 4140
113 Ga0207667_10000004 3300025949 Bacteria 737718
114 Ga0207667_10002872 3300025949 Bacteria 21387
115 Ga0207651_10202710 3300025960 Bacteria 1591
116 Ga0207668_10001597 3300025972 Bacteria 13238
117 Ga0207668_10037247 3300025972 Bacteria 3254
118 Ga0207640_10001085 3300025981 Bacteria 15058
119 Ga0207658_10098920 3300025986 Bacteria 2280
120 Ga0207658_10272283 3300025986 Bacteria 1448
121 Ga0207639_10007426 3300026041 Bacteria 7473
122 Ga0207678_10004754 3300026067 Bacteria 12201
123 Ga0207678_10028582 3300026067 Bacteria 4866
124 Ga0207678_10268143 3300026067 Bacteria 1464
125 Ga0207708_10053720 3300026075 Bacteria 3070
126 Ga0207702_10019446 3300026078 Bacteria 5618
127 Ga0207641_10008778 3300026088 Bacteria 8347
128 Ga0207676_10002794 3300026095 Bacteria 12407
129 Ga0207674_10026579 3300026116 Bacteria 6141
130 Ga0207683_10009111 3300026121 Bacteria 8459
131 Ga0207683_10207185 3300026121 Bacteria 1784
132 Ga0207698_10008604 3300026142 Bacteria 6467
133 Ga0207698_10815247 3300026142 Bacteria 936
134 Ga0268266_10001119 3300028379 Bacteria 33470
135 Ga0268266_10033979 3300028379 Bacteria 4334
136 Ga0265322_10039794 3300028654 Bacteria 1338
137 Ga0307515_10035303 3300028794 Bacteria 8141
138 Ga0307512_10156728 3300030522 Bacteria 1346
139 Ga0307513_10193443 3300031456 Bacteria 1883
140 Ga0307412_10053208 3300031911 Bacteria 2683
141 Ga0307412_10170916 3300031911 Bacteria 1625
142 Ga0307414_10005662 3300032004 Bacteria 6896
143 Ga0307414_10026665 3300032004 Bacteria 3722
144 Ga0307411_10037604 3300032005 Bacteria 3045
145 Ga0307510_10335114 3300033180 Bacteria 966
146 Ga0373937_0748882 3300036401 Bacteria 924
147 Ga0436364_1151686 3300037853 Bacteria 2094
148 Ga0400485_07988 3300038735 Bacteria 1157
149 Ga0400486_12534 3300038742 Bacteria 1695
150 Ga0400487_04817 3300039110 Bacteria 1823
151 Ga0436360_1350079 3300039438 Bacteria 1047
152 Ga0436363_0298286 3300039450 Unclassified 1070
153 Ga0439448_0076484 3300042005 Bacteria 1120
154 Ga0466972_0000773 3300044658 Bacteria 15205
155 Ga0466972_0009569 3300044658 Bacteria 4865
156 Ga0453683_0172166 3300044673 Bacteria 1372
157 Ga0466965_0143089 3300044683 Bacteria 1246
158 Ga0466968_0031091 3300044735 Bacteria 2214
159 Ga0466970_0005503 3300044765 Bacteria 6288
160 Ga0466957_0288337 3300044842 Bacteria 1100
161 Ga0466960_0010185 3300044901 Bacteria 3900
162 Ga0466960_0184177 3300044901 Bacteria 1133
163 Ga0466967_0152111 3300045976 Bacteria 2164
164 Ga0495627_091319 3300046453 Bacteria 875
165 Ga0495638_0069233 3300046460 Bacteria 2163
166 Ga0495641_0000024 3300046461 Bacteria 103783
167 Ga0495650_0001162 3300046471 Bacteria 28180
168 Ga0495650_0188380 3300046471 Bacteria 722
169 Ga0495639_0143687 3300046475 Bacteria 1148
170 Ga0495585_0022284 3300046492 Bacteria 3636
171 Ga0495596_0083766 3300046500 Bacteria 1238
172 Ga0495596_0091010 3300046500 Bacteria 1184
173 Ga0495583_0005111 3300046506 Bacteria 9040
174 Ga0495583_0040518 3300046506 Bacteria 2188
175 Ga0495583_0049656 3300046506 Bacteria 1920
176 Ga0495606_0003156 3300046507 Bacteria 17831
177 Ga0495606_0022839 3300046507 Bacteria 4545
178 Ga0495608_0197075 3300046511 Bacteria 1270
179 Ga0495616_0187214 3300046513 Bacteria 916
180 Ga0495631_0035078 3300046518 Bacteria 2246
181 Ga0495631_0050796 3300046518 Bacteria 1813
182 Ga0495643_0002407 3300046522 Bacteria 14890
183 Ga0495643_0006098 3300046522 Bacteria 8018
184 Ga0495643_0025250 3300046522 Bacteria 3363
185 Ga0495643_0067217 3300046522 Bacteria 1889
186 Ga0495643_0113412 3300046522 Unclassified 1376
187 Ga0495648_0003881 3300046524 Bacteria 12961
188 Ga0495663_0001254 3300046525 Bacteria 8066
189 Ga0495654_0080112 3300046530 Bacteria 1533
190 Ga0495587_0070568 3300046536 Bacteria 2033
191 Ga0495622_0055373 3300046557 Bacteria 1839
192 Ga0495633_0000949 3300046558 Bacteria 24172
193 Ga0495668_0000007 3300046616 Bacteria 552902
194 Ga0495668_0273445 3300046616 Bacteria 925
195 Ga0495625_0000228 3300046660 Bacteria 88607
196 Ga0495625_0000362 3300046660 Bacteria 69497
197 Ga0495625_0017641 3300046660 Bacteria 5586
198 Ga0495625_0053194 3300046660 Bacteria 2897
199 Ga0495625_0057283 3300046660 Bacteria 2772
200 Ga0495625_0129175 3300046660 Bacteria 1713
201 Ga0495658_0006987 3300046683 Bacteria 5568
202 Ga0495669_0000388 3300046684 Bacteria 21895
203 Ga0495649_0093863 3300046694 Bacteria 1597
204 Ga0495600_0007578 3300046809 Bacteria 6645
205 Ga0495660_0117835 3300046810 Bacteria 1347
206 Ga0495683_0035609 3300047323 Bacteria 2530
207 Ga0495683_0069740 3300047323 Bacteria 1727
208 Ga0495687_000224 3300047443 Bacteria 79719
209 Ga0495687_000767 3300047443 Bacteria 34777
210 Ga0495677_0014693 3300047445 Bacteria 2848
211 Ga0495677_0019450 3300047445 Bacteria 2462
212 Ga0495677_0045159 3300047445 Bacteria 1616
213 Ga0495681_0004266 3300047470 Bacteria 9807
214 Ga0495686_0000413 3300047472 Bacteria 67712
215 Ga0495686_0134083 3300047472 Bacteria 1466
216 Ga0496100_0003394 3300048903 Bacteria 8299
217 Ga0496101_0016331 3300048904 Bacteria 5012
218 Ga0496102_0000008 3300048905 Bacteria 417021
219 Ga0496102_0001040 3300048905 Bacteria 25769
220 Ga0496103_0000064 3300048906 Bacteria 128497
221 Ga0496103_0002656 3300048906 Bacteria 11190
222 Ga0496104_0004435 3300048907 Bacteria 12218
223 Ga0496105_0000285 3300048908 Bacteria 33333
224 Ga0496105_0016954 3300048908 Bacteria 5829
225 Ga0496107_0168918 3300048910 Bacteria 1622
226 Ga0496108_0797311 3300048911 Bacteria 815
227 Ga0496110_0062117 3300048913 Bacteria 3299
228 Ga0496111_0246941 3300048914 Bacteria 1325
229 Ga0496115_0000018 3300048918 Bacteria 182523
230 Ga0496115_0042775 3300048918 Bacteria 3610
231 Ga0496116_0000082 3300048919 Bacteria 222607
232 Ga0496116_0024434 3300048919 Bacteria 4470
233 Ga0496117_0000026 3300048920 Bacteria 416644
234 Ga0496117_0001471 3300048920 Bacteria 33868
235 Ga0496118_0000060 3300048921 Bacteria 222621
236 Ga0496118_0001411 3300048921 Bacteria 36227
237 Ga0496119_0000269 3300048922 Bacteria 73880
238 Ga0496119_0010679 3300048922 Bacteria 7694
239 Ga0496120_0006698 3300048923 Bacteria 8772
240 Ga0496120_0029639 3300048923 Bacteria 3338
241 Ga0496121_0000263 3300048924 Bacteria 109553
242 Ga0496121_0012209 3300048924 Bacteria 9412
243 Ga0496122_0121563 3300048925 Bacteria 1682
244 Ga0496123_0026513 3300048926 Bacteria 4338
245 Ga0496124_0000099 3300048927 Bacteria 182007
246 Ga0496124_0022832 3300048927 Bacteria 5728
247 Ga0496125_0001490 3300048928 Bacteria 33616
248 Ga0496126_0000107 3300048929 Bacteria 197579
249 Ga0496126_0001775 3300048929 Bacteria 31900
250 Ga0496126_0201088 3300048929 Bacteria 1683
251 Ga0496126_0819894 3300048929 Bacteria 712
252 nmdc:mga03683_205666_c1 3300050489 Bacteria 904
253 nmdc:mga0k408_65162_c1 3300050493 Bacteria 2120
254 nmdc:mga07m45_60486_c1 3300050496 Bacteria 2144
255 Ga0500610_0000597 3300053079 Bacteria 11055
256 Ga0495595_0305950 3300053084 Bacteria 800
257 Ga0500643_006153 3300053087 Bacteria 5062
258 Ga0500646_0043702 3300053090 Bacteria 1269
259 Ga0500583_0165239 3300053092 Bacteria 1102
260 Ga0500595_006252 3300053119 Bacteria 5075
261 Ga0500595_029138 3300053119 Bacteria 1875
262 Ga0500642_0000649 3300053130 Bacteria 10372
263 Ga0500658_0219746 3300053134 Bacteria 871
264 Ga0500559_0172349 3300053136 Bacteria 1018
265 Ga0500568_0000724 3300053139 Bacteria 23628
266 Ga0500604_0047734 3300053151 Bacteria 1313
267 Ga0500616_0000123 3300053153 Bacteria 140214
268 Ga0500616_0109334 3300053153 Bacteria 1338
269 Ga0500619_034269 3300053154 Bacteria 1567
270 Ga0500622_0019268 3300053156 Bacteria 3624
271 Ga0500636_0108110 3300053177 Bacteria 1574
272 Ga0500645_000009 3300053730 Bacteria 206177
273 Ga0500596_000568 3300053735 Bacteria 7031
274 2552108722 2551306166 Bacteria 9731570
275 2579852673 2579778521 Bacteria 7624758
276 2619853575 2619618881 Bacteria 7521104
277 2620348692 2619619003 Bacteria 7619552
278 2643823309 2643221560 Bacteria 4801179
279 2643835660 2643221563 Bacteria 4726935
280 2644056586 2643221608 Bacteria 4724829
281 2852655215 2852653556 Bacteria 4050083
282 2891330779 2891326441 Bacteria 6439512
283 2915360120 2915358134 Bacteria 6050864
284 8003322645 8003314358 Bacteria 10575343
285 8054472877 8054472261 Bacteria 7464355
286 8054920283 8054913762 Bacteria 7713009
287 8054920999 8054920844 Bacteria 7068637
288 Ga0495583_0003933
289 JGI24740J21852_10023592
290 JGI24737J22298_10003344
291 JGI25153J46596_10000002
292 Ga0055525_1000076
293 Ga0055542_1000020
294 Ga0055529_1000016
295 Ga0055536_1001635
296 Ga0055536_1008468
297 Ga0055534_1013379
298 Ga0055530_10000095
299 Ga0055531_10002750
300 Ga0055531_10004838
301 Ga0070658_10003922
302 Ga0070670_100049964
303 Ga0070682_100232402
304 Ga0070660_100006462
305 Ga0070661_100002801
306 Ga0070668_100003809
307 Ga0070668_100163580
308 Ga0070668_100708069
309 Ga0070671_100005425
310 Ga0070671_100229021
311 Ga0070674_100091557
312 Ga0070674_100366003
313 Ga0070673_100104716
314 Ga0070659_100010099
315 Ga0070659_100293278
316 Ga0070667_100083997
317 Ga0070713_100011348
318 Ga0070700_100094073
319 Ga0070663_100016590
320 Ga0070678_100003133
321 Ga0070678_101131154
322 Ga0070662_100108128
323 Ga0068853_100263914
324 Ga0068853_100578549
325 Ga0070686_100000347
326 Ga0070696_100117967
327 Ga0070665_100005577
328 Ga0070665_100217182
329 Ga0068855_100721057
330 Ga0068855_100902800
331 Ga0070664_100139248
332 Ga0068857_100212456
333 Ga0068857_100243285
334 Ga0068854_100028637
335 Ga0068852_100271343
336 Ga0068852_100372407
337 Ga0068864_100008891
338 Ga0068866_10299796
339 Ga0068851_10028228
340 Ga0068863_100010845
341 Ga0068860_100270192
342 Ga0081539_10046595
343 Ga0070717_10000151
344 Ga0075366_10222226
345 Ga0097621_100170583
346 Ga0075370_10009651
347 Ga0105240_10354590
348 Ga0105247_10067333
349 Ga0105243_10000116
350 Ga0105241_10006724
351 Ga0105237_10025329
352 Ga0105246_10058058
353 Ga0157373_10218480
354 Ga0157371_10000030
355 Ga0157370_10178295
356 Ga0157378_10350142
357 Ga0163162_10451909
358 Ga0157372_10078856
359 Ga0157379_10002908
360 Ga0157376_10209898
361 Ga0163161_10185678
362 Ga0209563_100019
363 Ga0209677_105825
364 Ga0209148_1000017
365 Ga0209455_1000005
366 Ga0209675_1000025
367 Ga0209676_1000362
368 Ga0209676_1003189
369 Ga0209676_1023122
370 Ga0209025_1019137
371 Ga0209758_1000001
372 Ga0209050_1000849
373 Ga0209050_1003508
374 Ga0209257_1000860
375 Ga0209257_1001370
376 Ga0209257_1003116
377 Ga0207656_10000453
378 Ga0207710_10353498
379 Ga0207688_10029110
380 Ga0207647_10058462
381 Ga0207647_10097931
382 Ga0207705_10000412
383 Ga0207654_10006403
384 Ga0207695_10098010
385 Ga0207695_10187037
386 Ga0207695_10291139
387 Ga0207695_10418153
388 Ga0207671_10009910
389 Ga0207657_10002115
390 Ga0207649_10000351
391 Ga0207694_10004475
392 Ga0207687_10066807
393 Ga0207644_10006086
394 Ga0207690_10001129
395 Ga0207706_10040507
396 Ga0207709_10000031
397 Ga0207669_10001898
398 Ga0207669_10005682
399 Ga0207679_10024474
400 Ga0207667_10000004
401 Ga0207667_10002872
402 Ga0207651_10202710
403 Ga0207668_10001597
404 Ga0207668_10037247
405 Ga0207640_10001085
406 Ga0207658_10098920
407 Ga0207658_10272283
408 Ga0207639_10007426
409 Ga0207678_10004754
410 Ga0207678_10028582
411 Ga0207678_10268143
412 Ga0207708_10053720
413 Ga0207702_10019446
414 Ga0207641_10008778
415 Ga0207676_10002794
416 Ga0207674_10026579
417 Ga0207683_10009111
418 Ga0207683_10207185
419 Ga0207698_10008604
420 Ga0207698_10815247
421 Ga0268266_10001119
422 Ga0268266_10033979
423 Ga0265322_10039794
424 Ga0307515_10035303
425 Ga0307512_10156728
426 Ga0307513_10193443
427 Ga0307412_10053208
428 Ga0307412_10170916
429 Ga0307414_10005662
430 Ga0307414_10026665
431 Ga0307411_10037604
432 Ga0307510_10335114
433 Ga0373937_0748882
434 Ga0436364_1151686
435 Ga0400485_07988
436 Ga0400486_12534
437 Ga0400487_04817
438 Ga0436360_1350079
439 Ga0436363_0298286
440 Ga0439448_0076484
441 Ga0466972_0000773
442 Ga0466972_0009569
443 Ga0453683_0172166
444 Ga0466965_0143089
445 Ga0466968_0031091
446 Ga0466970_0005503
447 Ga0466957_0288337
448 Ga0466960_0010185
449 Ga0466960_0184177
450 Ga0466967_0152111
451 Ga0495627_091319
452 Ga0495638_0069233
453 Ga0495641_0000024
454 Ga0495650_0001162
455 Ga0495650_0188380
456 Ga0495639_0143687
457 Ga0495585_0022284
458 Ga0495596_0083766
459 Ga0495596_0091010
460 Ga0495583_0005111
461 Ga0495583_0040518
462 Ga0495583_0049656
463 Ga0495606_0003156
464 Ga0495606_0022839
465 Ga0495608_0197075
466 Ga0495616_0187214
467 Ga0495631_0035078
468 Ga0495631_0050796
469 Ga0495643_0002407
470 Ga0495643_0006098
471 Ga0495643_0025250
472 Ga0495643_0067217
473 Ga0495643_0113412
474 Ga0495648_0003881
475 Ga0495663_0001254
476 Ga0495654_0080112
477 Ga0495587_0070568
478 Ga0495622_0055373
479 Ga0495633_0000949
480 Ga0495668_0000007
481 Ga0495668_0273445
482 Ga0495625_0000228
483 Ga0495625_0000362
484 Ga0495625_0017641
485 Ga0495625_0053194
486 Ga0495625_0057283
487 Ga0495625_0129175
488 Ga0495658_0006987
489 Ga0495669_0000388
490 Ga0495649_0093863
491 Ga0495600_0007578
492 Ga0495660_0117835
493 Ga0495683_0035609
494 Ga0495683_0069740
495 Ga0495687_000224
496 Ga0495687_000767
497 Ga0495677_0014693
498 Ga0495677_0019450
499 Ga0495677_0045159
500 Ga0495681_0004266
501 Ga0495686_0000413
502 Ga0495686_0134083
503 Ga0496100_0003394
504 Ga0496101_0016331
505 Ga0496102_0000008
506 Ga0496102_0001040
507 Ga0496103_0000064
508 Ga0496103_0002656
509 Ga0496104_0004435
510 Ga0496105_0000285
511 Ga0496105_0016954
512 Ga0496107_0168918
513 Ga0496108_0797311
514 Ga0496110_0062117
515 Ga0496111_0246941
516 Ga0496115_0000018
517 Ga0496115_0042775
518 Ga0496116_0000082
519 Ga0496116_0024434
520 Ga0496117_0000026
521 Ga0496117_0001471
522 Ga0496118_0000060
523 Ga0496118_0001411
524 Ga0496119_0000269
525 Ga0496119_0010679
526 Ga0496120_0006698
527 Ga0496120_0029639
528 Ga0496121_0000263
529 Ga0496121_0012209
530 Ga0496122_0121563
531 Ga0496123_0026513
532 Ga0496124_0000099
533 Ga0496124_0022832
534 Ga0496125_0001490
535 Ga0496126_0000107
536 Ga0496126_0001775
537 Ga0496126_0201088
538 Ga0496126_0819894
539 nmdc:mga03683_205666_c1
540 nmdc:mga0k408_65162_c1
541 nmdc:mga07m45_60486_c1
542 Ga0500610_0000597
543 Ga0495595_0305950
544 Ga0500643_006153
545 Ga0500646_0043702
546 Ga0500583_0165239
547 Ga0500595_006252
548 Ga0500595_029138
549 Ga0500642_0000649
550 Ga0500658_0219746
551 Ga0500559_0172349
552 Ga0500568_0000724
553 Ga0500604_0047734
554 Ga0500616_0000123
555 Ga0500616_0109334
556 Ga0500619_034269
557 Ga0500622_0019268
558 Ga0500636_0108110
559 Ga0500645_000009
560 Ga0500596_000568
561 2552108722
562 2579852673
563 2619853575
564 2620348692
565 2643823309
566 2643835660
567 2644056586
568 2852655215
569 2891330779
570 2915360120
571 8003322645
572 8054472877
573 8054920283
574 8054920999

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01596

Methyltransf_3

O-methyltransferase

53

250

0.91

PF13578

Methyltransf_24

Methyltransferase domain

95

200

0.89

PF13847

Methyltransf_31

Methyltransferase domain

89

245

0.83

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

72

197

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3duw-assembly1.cif.gz_B crystal structural analysis of the o-methyltransferase from bacillus cereus in complex sah 0.9892 11 227
3tfw-assembly1.cif.gz_B-2 crystal structure of a putative o-methyltransferase from klebsiella pneumoniae 0.9842 11 227
8c9t-assembly2.cif.gz_B catechol o-methyltransferase from streptomyces avermitilis 0.9799 12 226
7cvv-assembly1.cif.gz_A crystal structure of catechol o-methyl transferase (comt) from niastella koreensis 0.9746 9 227
7cvu-assembly2.cif.gz_B crystal structure of catechol o-methyl transferase (comt) from niastella koreensis 0.9726 9 227
ID Description Score Start End Superfamily
af_O07431_3_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9513 6 227 3.40.50.150
af_O07431_3_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.947 6 227 3.40.50.150
3dulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9319 12 227 3.40.50.150
3dulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.923 12 227 3.40.50.150
af_A0A0R0K566_14_120_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9197 45 133 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2H2YAF9-F1-model_v4 deleted 1 150 226
AF-A0A2L1UDS9-F1-model_v4 Acyl-CoA O-methyltransferase-like protein 0.9946 16 128 GO:0008171
GO:0008757
GO:0032259
AF-A0A2N8EU36-F1-model_v4 deleted 0.9943 154 227
AF-A0A1I2W557-F1-model_v4 deleted 0.9924 12 227
AF-A0A507C032-F1-model_v4 Caffeoyl-CoA O-methyltransferase 0.9922 12 227 GO:0008171
GO:0008757
GO:0032259

Map