F388226

General Info

Members Datasets Scaffolds Average Seq Length
287 227 574 555

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0062015|Ga0496117_0062015_170_2101
Length 610
Sequence LISLFVIGFTIRKSKDLSPIKKSGVRAPATAPFPESNQQAARSETWRLTASGRSSAGIDYQXLKFEYRPRAARAAGDDAVIHPVIVVGAGPVGLSAAIDLAQQGVPVVLLDDDDTLSTGSRAICFAKRTLEIFDRLGCGERFVEKGVSWHVGKVFLQDEQLYAFDLLPEEGHARPAFINLQQYYVEGYLAERAFELPNLEIRWKHKVTGVAQSAEHAALTVETPEGIETLHARYVIAADGSRSPMRAAMGLESRGRTFKDRFLIADVKMKAEFPTERWFWFDPPFHRNQSVLLHRQPDNVWRIDFQLGWDADPVAEKQPERVIPRVRALLGADVEFELEWVSVYTFRCQRMDTFRHGRVLFAGDSAHGVSPFGARGANSGVQDADNLAWKLKLVLDGRADDRLLDTYASEREFAADENIRNSTRSTDFITPKSAVSRVFRDATLKLARDCEFARKLVNSGRLSVPAVLADSPLNTPDRNGDAFACAMRPGAAAADAPVREQGASGWLLQHLGDGFAGVLFGLPADAAALVQALDGLALPVRPVLIVPAGHAQPVAGVDVVEDVDGFAAQRYDAQPGTFYLLRPDQHVCARMRTLERQAIADALARATCAR

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
108 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
125 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
126 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
166 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
167 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
168 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
169 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
170 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
171 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
176 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
177 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
178 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
179 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
180 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
181 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
182 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
183 2519103095 Burkholderia sp. KJ006 Isolate Nodule
184 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
185 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
186 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
187 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
188 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
189 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
190 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
191 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
192 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
193 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
194 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
195 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
196 2818991452 Burkholderia cepacia 561 Isolate Unclassified
197 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
198 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
199 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
200 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
201 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
202 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
203 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
204 2904564687 Burkholderia sp. 571 Isolate Unclassified
205 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
206 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
207 2928163908 Burkholderia sp. 567 Isolate Unclassified
208 2928170801 Burkholderia sp. 572 Isolate Unclassified
209 2928536128 Burkholderia sola 565 Isolate Unclassified
210 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
211 2929520902 Variovorax beijingensis 502 Isolate Unclassified
212 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
213 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
214 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
215 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
216 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
217 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
218 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
219 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
220 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
221 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
222 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
223 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
224 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
225 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
226 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
227 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.53
Metatranscriptomes 0
Isolates 18.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.21
Nodule 3.14
Rhizoplane 2.09
Rhizosphere 54.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0062015 3300048920 Bacteria 2565
2 JGI24739J22299_10013501 3300001989 Bacteria 2982
3 JGI25156J39149_1000064 3300002705 Bacteria 83982
4 JGI25157J39369_1000083 3300002741 Bacteria 84002
5 JGI25150J39212_1002560 3300002774 Bacteria 4482
6 JGI25406J46586_10003630 3300003203 Bacteria 7240
7 Ga0055532_1001472 3300003758 Bacteria 6531
8 Ga0055532_1002905 3300003758 Bacteria 3243
9 Ga0055532_1003276 3300003758 Bacteria 2862
10 Ga0055527_1000988 3300003760 Bacteria 6923
11 Ga0055535_1000632 3300003761 Bacteria 28125
12 Ga0055535_1002309 3300003761 Bacteria 6974
13 Ga0055535_1002319 3300003761 Bacteria 6923
14 Ga0055542_1002195 3300003762 Bacteria 6974
15 Ga0055529_1001056 3300003763 Bacteria 12764
16 Ga0055529_1001109 3300003763 Bacteria 11958
17 Ga0055529_1001176 3300003763 Bacteria 10681
18 Ga0055537_1000024 3300003773 Bacteria 111410
19 Ga0055534_1000032 3300003784 Bacteria 118890
20 Ga0055528_1003131 3300003790 Bacteria 8487
21 Ga0055528_1004537 3300003790 Bacteria 6663
22 Ga0058692_1000957 3300003856 Bacteria 11362
23 Ga0065714_10065020 3300005288 Bacteria 13888
24 Ga0068869_100047384 3300005334 Bacteria 3104
25 Ga0070660_100000008 3300005339 Bacteria 155650
26 Ga0070674_100002745 3300005356 Bacteria 9731
27 Ga0070659_100000087 3300005366 Bacteria 69724
28 Ga0070667_100030341 3300005367 Bacteria 4509
29 Ga0070709_10048599 3300005434 Bacteria 2648
30 Ga0070714_100015999 3300005435 Bacteria 6048
31 Ga0070713_100043244 3300005436 Bacteria 3682
32 Ga0068867_100013402 3300005459 Bacteria 5809
33 Ga0068867_100111547 3300005459 Bacteria 2102
34 Ga0070706_100122615 3300005467 Bacteria 2423
35 Ga0070672_100049062 3300005543 Bacteria 3283
36 Ga0070665_100004978 3300005548 Bacteria 13778
37 Ga0070665_100068262 3300005548 Bacteria 3565
38 Ga0070665_100083845 3300005548 Bacteria 3192
39 Ga0068855_100104939 3300005563 Bacteria 3250
40 Ga0068857_100008364 3300005577 Bacteria 8940
41 Ga0068856_100000510 3300005614 Bacteria 42987
42 Ga0068859_100082703 3300005617 Bacteria 3253
43 Ga0068862_100044132 3300005844 Bacteria 3803
44 Ga0081539_10001256 3300005985 Bacteria 45022
45 Ga0070716_100002620 3300006173 Bacteria 8313
46 Ga0075362_10034863 3300006177 Bacteria 2195
47 Ga0075366_10001796 3300006195 Bacteria 10840
48 Ga0075370_10000553 3300006353 Bacteria 14337
49 Ga0075431_100201296 3300006847 Bacteria 2037
50 Ga0097620_100082706 3300006931 Bacteria 3253
51 Ga0099826_10000060 3300006948 Bacteria 63334
52 Ga0099826_10051062 3300006948 Bacteria 2776
53 Ga0105250_10008182 3300009092 Bacteria 4453
54 Ga0105240_10006071 3300009093 Bacteria 17841
55 Ga0105240_10009840 3300009093 Bacteria 13495
56 Ga0105240_10118787 3300009093 Bacteria 3186
57 Ga0114129_10007104 3300009147 Bacteria 15933
58 Ga0114129_10027130 3300009147 Bacteria 8108
59 Ga0114129_10138998 3300009147 Bacteria 3331
60 Ga0105243_10066528 3300009148 Bacteria 2898
61 Ga0105249_10032533 3300009553 Bacteria 4719
62 Ga0157369_10028943 3300013105 Bacteria 6127
63 Ga0157378_10003514 3300013297 Bacteria 13898
64 Ga0157375_10043774 3300013308 Bacteria 4344
65 Ga0157380_10016567 3300014326 Bacteria 5438
66 Ga0182008_10004794 3300014497 Bacteria 7822
67 Ga0157379_10024806 3300014968 Bacteria 5323
68 Ga0182006_1002898 3300015261 Bacteria 9111
69 Ga0182007_10002911 3300015262 Bacteria 8318
70 Ga0182007_10015991 3300015262 Bacteria 2780
71 Ga0182005_1009511 3300015265 Bacteria 2828
72 Ga0209566_100170 3300025225 Bacteria 70792
73 Ga0209672_100028 3300025228 Bacteria 341962
74 Ga0209672_100038 3300025228 Bacteria 286731
75 Ga0209672_101689 3300025228 Bacteria 7136
76 Ga0209147_100112 3300025229 Bacteria 145046
77 Ga0209147_100117 3300025229 Bacteria 143852
78 Ga0209147_100488 3300025229 Bacteria 23706
79 Ga0209258_100109 3300025242 Bacteria 203881
80 Ga0209258_100112 3300025242 Bacteria 192884
81 Ga0209258_100424 3300025242 Bacteria 49640
82 Ga0209258_100453 3300025242 Bacteria 45277
83 Ga0207425_1000125 3300025245 Bacteria 72177
84 Ga0209646_1000129 3300025246 Bacteria 129401
85 Ga0209026_1000059 3300025250 Bacteria 226652
86 Ga0209677_100126 3300025253 Bacteria 78655
87 Ga0209148_1001535 3300025254 Bacteria 11240
88 Ga0209148_1002458 3300025254 Bacteria 6366
89 Ga0209759_1000081 3300025256 Bacteria 169943
90 Ga0209759_1001564 3300025256 Bacteria 12493
91 Ga0209565_1000039 3300025263 Bacteria 278026
92 Ga0209455_1000050 3300025272 Bacteria 373239
93 Ga0209455_1000157 3300025272 Bacteria 119719
94 Ga0209455_1000534 3300025272 Bacteria 26400
95 Ga0209455_1000752 3300025272 Bacteria 18442
96 Ga0209673_1000038 3300025273 Bacteria 312957
97 Ga0209673_1000284 3300025273 Bacteria 94932
98 Ga0209675_1000030 3300025291 Bacteria 278026
99 Ga0209675_1002245 3300025291 Bacteria 10094
100 Ga0209025_1002265 3300025294 Bacteria 21074
101 Ga0209758_1000679 3300025297 Bacteria 50729
102 Ga0207696_1008997 3300025711 Bacteria 3754
103 Ga0207688_10029398 3300025901 Bacteria 3025
104 Ga0207647_10019558 3300025904 Bacteria 4553
105 Ga0207705_10051380 3300025909 Bacteria 2967
106 Ga0207695_10001729 3300025913 Bacteria 34817
107 Ga0207695_10005596 3300025913 Bacteria 16596
108 Ga0207695_10021168 3300025913 Bacteria 7427
109 Ga0207695_10075687 3300025913 Bacteria 3424
110 Ga0207657_10000337 3300025919 Bacteria 49613
111 Ga0207694_10006796 3300025924 Bacteria 8683
112 Ga0207659_10005559 3300025926 Bacteria 7649
113 Ga0207700_10000004 3300025928 Bacteria 443409
114 Ga0207700_10002510 3300025928 Bacteria 10523
115 Ga0207700_10031817 3300025928 Bacteria 3753
116 Ga0207664_10001046 3300025929 Bacteria 18542
117 Ga0207690_10000006 3300025932 Bacteria 433880
118 Ga0207706_10000544 3300025933 Bacteria 39990
119 Ga0207709_10047873 3300025935 Bacteria 2602
120 Ga0207669_10041860 3300025937 Bacteria 2670
121 Ga0207665_10009860 3300025939 Bacteria 6268
122 Ga0207691_10008195 3300025940 Bacteria 10037
123 Ga0207689_10062171 3300025942 Bacteria 3070
124 Ga0207667_10026684 3300025949 Bacteria 6305
125 Ga0207667_10199998 3300025949 Bacteria 2050
126 Ga0207712_10032586 3300025961 Bacteria 3518
127 Ga0207639_10013039 3300026041 Bacteria 5803
128 Ga0207678_10000228 3300026067 Bacteria 49958
129 Ga0207702_10001084 3300026078 Bacteria 27885
130 Ga0207648_10000190 3300026089 Bacteria 64762
131 Ga0207648_10025808 3300026089 Bacteria 5228
132 Ga0207674_10004452 3300026116 Bacteria 16839
133 Ga0207675_100002430 3300026118 Bacteria 18452
134 Ga0209371_1000090 3300027312 Bacteria 173119
135 Ga0209282_1000200 3300027666 Bacteria 32028
136 Ga0209974_10007194 3300027876 Bacteria 3844
137 Ga0268266_10048942 3300028379 Bacteria 3623
138 Ga0268265_10044695 3300028380 Bacteria 3300
139 Ga0268264_10037631 3300028381 Bacteria 3989
140 Ga0265336_10000008 3300028666 Bacteria 336082
141 Ga0307515_10000332 3300028794 Bacteria 116126
142 Ga0307515_10003326 3300028794 Bacteria 33975
143 Ga0307515_10012210 3300028794 Bacteria 16189
144 Ga0307515_10028818 3300028794 Bacteria 9418
145 Ga0307515_10059888 3300028794 Bacteria 5446
146 Ga0265338_10002854 3300028800 Bacteria 25255
147 Ga0265324_10000871 3300029957 Bacteria 19320
148 Ga0268256_1000115 3300030500 Bacteria 116918
149 Ga0307512_10051189 3300030522 Bacteria 3307
150 Ga0307512_10054292 3300030522 Bacteria 3175
151 Ga0307513_10047156 3300031456 Bacteria 4689
152 Ga0307513_10116318 3300031456 Bacteria 2654
153 Ga0307509_10008176 3300031507 Bacteria 13398
154 Ga0307509_10044322 3300031507 Bacteria 4808
155 Ga0307509_10063084 3300031507 Bacteria 3903
156 Ga0307509_10070293 3300031507 Bacteria 3656
157 Ga0307508_10005499 3300031616 Bacteria 12042
158 Ga0307508_10083604 3300031616 Bacteria 2774
159 Ga0307514_10003838 3300031649 Bacteria 14140
160 Ga0307516_10004749 3300031730 Bacteria 16588
161 Ga0307412_10063732 3300031911 Bacteria 2488
162 Ga0307409_100098727 3300031995 Bacteria 2416
163 Ga0307507_10063668 3300033179 Bacteria 3411
164 Ga0307510_10005618 3300033180 Bacteria 14948
165 Ga0307510_10072136 3300033180 Bacteria 3432
166 Ga0307510_10106099 3300033180 Bacteria 2574
167 Ga0316584_0017152 3300036712 Bacteria 5201
168 Ga0373925_0004630 3300037068 Bacteria 10383
169 Ga0395900_0004048 3300037418 Bacteria 15637
170 Ga0395900_0022924 3300037418 Bacteria 6388
171 Ga0395905_0004949 3300037471 Bacteria 13728
172 Ga0395905_0035033 3300037471 Bacteria 4713
173 Ga0395901_0000043 3300038443 Bacteria 197397
174 Ga0395901_0004563 3300038443 Bacteria 13982
175 Ga0395901_0009297 3300038443 Bacteria 9962
176 Ga0451793_0623531 3300041452 Bacteria 2831
177 Ga0450920_003841 3300042122 Bacteria 2616
178 Ga0450921_000236 3300042123 Bacteria 2302
179 Ga0450906_004325 3300042145 Bacteria 2981
180 Ga0450908_001230 3300042184 Bacteria 4963
181 Ga0466972_0001691 3300044658 Bacteria 10798
182 Ga0466966_0000063 3300044684 Bacteria 74180
183 Ga0466966_0000475 3300044684 Bacteria 25816
184 Ga0466961_0001093 3300044693 Bacteria 16671
185 Ga0466961_0056892 3300044693 Bacteria 2491
186 Ga0466963_0034517 3300044694 Bacteria 3291
187 Ga0466971_0003234 3300044719 Bacteria 6954
188 Ga0466958_0004267 3300045836 Bacteria 7520
189 Ga0495592_0004544 3300046454 Bacteria 10162
190 Ga0495651_0000657 3300046462 Bacteria 26772
191 Ga0495580_0004669 3300046472 Bacteria 11492
192 Ga0495580_0016167 3300046472 Bacteria 5608
193 Ga0495608_0006214 3300046511 Bacteria 8479
194 Ga0495620_0010426 3300046515 Bacteria 4905
195 Ga0495628_0000037 3300046516 Bacteria 109854
196 Ga0495643_0023982 3300046522 Bacteria 3463
197 Ga0495652_0005170 3300046529 Bacteria 12339
198 Ga0495625_0000224 3300046660 Bacteria 89521
199 Ga0495623_0003620 3300046679 Bacteria 10214
200 Ga0495674_0005290 3300047319 Bacteria 12378
201 Ga0495686_0001817 3300047472 Bacteria 21551
202 Ga0495602_0004236 3300048088 Bacteria 14924
203 Ga0496102_0143982 3300048905 Bacteria 2236
204 Ga0496116_0002163 3300048919 Bacteria 20930
205 Ga0496117_0002723 3300048920 Bacteria 21716
206 Ga0496118_0016171 3300048921 Bacteria 6859
207 Ga0496121_0092740 3300048924 Bacteria 2353
208 Ga0496124_0000013 3300048927 Bacteria 484884
209 Ga0496126_0000061 3300048929 Bacteria 261515
210 Ga0501031_0000893 3300049568 Bacteria 17996
211 Ga0501033_0034804 3300049570 Bacteria 3776
212 Ga0501034_0031483 3300049571 Bacteria 5387
213 Ga0501036_0019367 3300049572 Bacteria 5712
214 Ga0501038_0017358 3300049574 Bacteria 6505
215 Ga0501070_0006960 3300049586 Bacteria 9619
216 Ga0501083_0056155 3300049744 Bacteria 2639
217 Ga0501035_0223851 3300049822 Bacteria 1605
218 Ga0501044_0000185 3300049823 Bacteria 77663
219 Ga0501044_0033166 3300049823 Bacteria 5427
220 nmdc:mga0k408_10331_c1 3300050493 Bacteria 5048
221 nmdc:mga0k408_18870_c1 3300050493 Bacteria 3850
222 nmdc:mga0k408_26627_c1 3300050493 Bacteria 3280
223 nmdc:mga07m45_3895_c1 3300050496 Bacteria 7247
224 nmdc:mga05p37_20944_c1 3300050507 Bacteria 7914
225 Ga0500610_0000021 3300053079 Bacteria 66361
226 Ga0500635_0000029 3300053080 Bacteria 100914
227 Ga0500646_0000088 3300053090 Bacteria 26075
228 Ga0500651_0000136 3300053093 Bacteria 45911
229 Ga0500593_000411 3300053117 Bacteria 16935
230 Ga0500607_000674 3300053121 Bacteria 32958
231 Ga0500559_0000019 3300053136 Bacteria 134862
232 Ga0500627_0000237 3300053158 Bacteria 15710
233 Ga0500634_0041907 3300053161 Bacteria 2485
234 Ga0466962_0003474 3300061719 Bacteria 7513
235 2501083685 2501025502 Bacteria 9641094
236 2501413234 2501025504 Bacteria 8008976
237 2510248812 2510065045 Bacteria 7761063
238 2511087485 2510917013 Bacteria 9951648
239 2511100323 2510917014 Bacteria 8296963
240 2511106012 2510917015 Bacteria 7950052
241 2513551925 2513237082 Bacteria 8640282
242 2513563305 2513237083 Bacteria 8410967
243 2519457943 2519103095 Bacteria 6629912
244 2585295240 2582581311 Bacteria 6763856
245 2587757583 2585428062 Bacteria 6842168
246 2599737114 2599185239 Bacteria 8686614
247 2599742808 2599185240 Bacteria 7968121
248 2600204926 2599185355 Bacteria 7968906
249 2644159032 2643221628 Bacteria 5745828
250 2644301293 2643221654 Bacteria 5273570
251 2676741915 2675903129 Bacteria 7964495
252 2719642762 2718217991 Bacteria 7829542
253 2817260117 2816332253 Bacteria 6764532
254 2817277781 2816332256 Bacteria 6891714
255 2817455825 2816332286 Bacteria 6853759
256 2819632610 2818991452 Bacteria 8442785
257 2834643566 2834641062 Bacteria 5559922
258 2857543009 2857542790 Bacteria 5326616
259 2858699208 2858688981 Bacteria 8184122
260 2863421640 2863421361 Bacteria 7300805
261 2870072411 2870068957 Bacteria 8925310
262 2881102477 2881101125 Bacteria 4590519
263 2883090855 2883087390 Bacteria 9532701
264 2904565805 2904564687 Bacteria 7609577
265 2904572848 2904571731 Bacteria 7608790
266 2928159778 2928157003 Bacteria 7522202
267 2928164164 2928163908 Bacteria 7561269
268 2928173282 2928170801 Bacteria 8785406
269 2928538628 2928536128 Bacteria 7657547
270 2929202803 2929199973 Bacteria 7260745
271 2929524922 2929520902 Bacteria 6765052
272 2935394951 2935390628 Bacteria 7043367
273 2945947547 2945945610 Bacteria 5951079
274 2945989044 2945984333 Bacteria 7358892
275 2981994223 2981990288 Bacteria 7590678
276 8003403639 8003400568 Bacteria 5535898
277 8003957092 8003955200 Bacteria 8601927
278 8018849065 8018845410 Bacteria 8933938
279 8020810470 8020807995 Bacteria 6801506
280 8020944794 8020938398 Bacteria 7472757
281 8020949661 8020945358 Bacteria 8467355
282 8020959871 8020953355 Bacteria 7439080
283 8021126644 8021120328 Bacteria 8782274
284 8039099259 8039098773 Bacteria 6602928
285 8040171771 8040167225 Bacteria 6542727
286 8040176284 8040173305 Bacteria 6827067
287 8055912095 8055909800 Bacteria 7278581
288 Ga0496117_0062015
289 JGI24739J22299_10013501
290 JGI25156J39149_1000064
291 JGI25157J39369_1000083
292 JGI25150J39212_1002560
293 JGI25406J46586_10003630
294 Ga0055532_1001472
295 Ga0055532_1002905
296 Ga0055532_1003276
297 Ga0055527_1000988
298 Ga0055535_1000632
299 Ga0055535_1002309
300 Ga0055535_1002319
301 Ga0055542_1002195
302 Ga0055529_1001056
303 Ga0055529_1001109
304 Ga0055529_1001176
305 Ga0055537_1000024
306 Ga0055534_1000032
307 Ga0055528_1003131
308 Ga0055528_1004537
309 Ga0058692_1000957
310 Ga0065714_10065020
311 Ga0068869_100047384
312 Ga0070660_100000008
313 Ga0070674_100002745
314 Ga0070659_100000087
315 Ga0070667_100030341
316 Ga0070709_10048599
317 Ga0070714_100015999
318 Ga0070713_100043244
319 Ga0068867_100013402
320 Ga0068867_100111547
321 Ga0070706_100122615
322 Ga0070672_100049062
323 Ga0070665_100004978
324 Ga0070665_100068262
325 Ga0070665_100083845
326 Ga0068855_100104939
327 Ga0068857_100008364
328 Ga0068856_100000510
329 Ga0068859_100082703
330 Ga0068862_100044132
331 Ga0081539_10001256
332 Ga0070716_100002620
333 Ga0075362_10034863
334 Ga0075366_10001796
335 Ga0075370_10000553
336 Ga0075431_100201296
337 Ga0097620_100082706
338 Ga0099826_10000060
339 Ga0099826_10051062
340 Ga0105250_10008182
341 Ga0105240_10006071
342 Ga0105240_10009840
343 Ga0105240_10118787
344 Ga0114129_10007104
345 Ga0114129_10027130
346 Ga0114129_10138998
347 Ga0105243_10066528
348 Ga0105249_10032533
349 Ga0157369_10028943
350 Ga0157378_10003514
351 Ga0157375_10043774
352 Ga0157380_10016567
353 Ga0182008_10004794
354 Ga0157379_10024806
355 Ga0182006_1002898
356 Ga0182007_10002911
357 Ga0182007_10015991
358 Ga0182005_1009511
359 Ga0209566_100170
360 Ga0209672_100028
361 Ga0209672_100038
362 Ga0209672_101689
363 Ga0209147_100112
364 Ga0209147_100117
365 Ga0209147_100488
366 Ga0209258_100109
367 Ga0209258_100112
368 Ga0209258_100424
369 Ga0209258_100453
370 Ga0207425_1000125
371 Ga0209646_1000129
372 Ga0209026_1000059
373 Ga0209677_100126
374 Ga0209148_1001535
375 Ga0209148_1002458
376 Ga0209759_1000081
377 Ga0209759_1001564
378 Ga0209565_1000039
379 Ga0209455_1000050
380 Ga0209455_1000157
381 Ga0209455_1000534
382 Ga0209455_1000752
383 Ga0209673_1000038
384 Ga0209673_1000284
385 Ga0209675_1000030
386 Ga0209675_1002245
387 Ga0209025_1002265
388 Ga0209758_1000679
389 Ga0207696_1008997
390 Ga0207688_10029398
391 Ga0207647_10019558
392 Ga0207705_10051380
393 Ga0207695_10001729
394 Ga0207695_10005596
395 Ga0207695_10021168
396 Ga0207695_10075687
397 Ga0207657_10000337
398 Ga0207694_10006796
399 Ga0207659_10005559
400 Ga0207700_10000004
401 Ga0207700_10002510
402 Ga0207700_10031817
403 Ga0207664_10001046
404 Ga0207690_10000006
405 Ga0207706_10000544
406 Ga0207709_10047873
407 Ga0207669_10041860
408 Ga0207665_10009860
409 Ga0207691_10008195
410 Ga0207689_10062171
411 Ga0207667_10026684
412 Ga0207667_10199998
413 Ga0207712_10032586
414 Ga0207639_10013039
415 Ga0207678_10000228
416 Ga0207702_10001084
417 Ga0207648_10000190
418 Ga0207648_10025808
419 Ga0207674_10004452
420 Ga0207675_100002430
421 Ga0209371_1000090
422 Ga0209282_1000200
423 Ga0209974_10007194
424 Ga0268266_10048942
425 Ga0268265_10044695
426 Ga0268264_10037631
427 Ga0265336_10000008
428 Ga0307515_10000332
429 Ga0307515_10003326
430 Ga0307515_10012210
431 Ga0307515_10028818
432 Ga0307515_10059888
433 Ga0265338_10002854
434 Ga0265324_10000871
435 Ga0268256_1000115
436 Ga0307512_10051189
437 Ga0307512_10054292
438 Ga0307513_10047156
439 Ga0307513_10116318
440 Ga0307509_10008176
441 Ga0307509_10044322
442 Ga0307509_10063084
443 Ga0307509_10070293
444 Ga0307508_10005499
445 Ga0307508_10083604
446 Ga0307514_10003838
447 Ga0307516_10004749
448 Ga0307412_10063732
449 Ga0307409_100098727
450 Ga0307507_10063668
451 Ga0307510_10005618
452 Ga0307510_10072136
453 Ga0307510_10106099
454 Ga0316584_0017152
455 Ga0373925_0004630
456 Ga0395900_0004048
457 Ga0395900_0022924
458 Ga0395905_0004949
459 Ga0395905_0035033
460 Ga0395901_0000043
461 Ga0395901_0004563
462 Ga0395901_0009297
463 Ga0451793_0623531
464 Ga0450920_003841
465 Ga0450921_000236
466 Ga0450906_004325
467 Ga0450908_001230
468 Ga0466972_0001691
469 Ga0466966_0000063
470 Ga0466966_0000475
471 Ga0466961_0001093
472 Ga0466961_0056892
473 Ga0466963_0034517
474 Ga0466971_0003234
475 Ga0466958_0004267
476 Ga0495592_0004544
477 Ga0495651_0000657
478 Ga0495580_0004669
479 Ga0495580_0016167
480 Ga0495608_0006214
481 Ga0495620_0010426
482 Ga0495628_0000037
483 Ga0495643_0023982
484 Ga0495652_0005170
485 Ga0495625_0000224
486 Ga0495623_0003620
487 Ga0495674_0005290
488 Ga0495686_0001817
489 Ga0495602_0004236
490 Ga0496102_0143982
491 Ga0496116_0002163
492 Ga0496117_0002723
493 Ga0496118_0016171
494 Ga0496121_0092740
495 Ga0496124_0000013
496 Ga0496126_0000061
497 Ga0501031_0000893
498 Ga0501033_0034804
499 Ga0501034_0031483
500 Ga0501036_0019367
501 Ga0501038_0017358
502 Ga0501070_0006960
503 Ga0501083_0056155
504 Ga0501035_0223851
505 Ga0501044_0000185
506 Ga0501044_0033166
507 nmdc:mga0k408_10331_c1
508 nmdc:mga0k408_18870_c1
509 nmdc:mga0k408_26627_c1
510 nmdc:mga07m45_3895_c1
511 nmdc:mga05p37_20944_c1
512 Ga0500610_0000021
513 Ga0500635_0000029
514 Ga0500646_0000088
515 Ga0500651_0000136
516 Ga0500593_000411
517 Ga0500607_000674
518 Ga0500559_0000019
519 Ga0500627_0000237
520 Ga0500634_0041907
521 Ga0466962_0003474
522 2501083685
523 2501413234
524 2510248812
525 2511087485
526 2511100323
527 2511106012
528 2513551925
529 2513563305
530 2519457943
531 2585295240
532 2587757583
533 2599737114
534 2599742808
535 2600204926
536 2644159032
537 2644301293
538 2676741915
539 2719642762
540 2817260117
541 2817277781
542 2817455825
543 2819632610
544 2834643566
545 2857543009
546 2858699208
547 2863421640
548 2870072411
549 2881102477
550 2883090855
551 2904565805
552 2904572848
553 2928159778
554 2928164164
555 2928173282
556 2928538628
557 2929202803
558 2929524922
559 2935394951
560 2945947547
561 2945989044
562 2981994223
563 8003403639
564 8003957092
565 8018849065
566 8020810470
567 8020944794
568 8020949661
569 8020959871
570 8021126644
571 8039099259
572 8040171771
573 8040176284
574 8055912095

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

83

122

0.92

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

86

135

0.92

PF01494

FAD_binding_3

FAD binding domain

82

422

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eod-assembly3.cif.gz_C structure of reductive aminase from aspergillus terreus in complex with nadph 0.9584 27 56
8bj5-assembly2.cif.gz_C imine reductase ir007 from amycolatopsis azurea 0.9571 29 56
3l6d-assembly1.cif.gz_A crystal structure of putative oxidoreductase from pseudomonas putida kt2440 0.9463 27 56
5a9s-assembly1.cif.gz_B nadph complex of imine reductase from amycolatopsis orientalis 0.9386 28 56
8c79-assembly1.cif.gz_B crystal structure of leishmania donovani 6-phosphogluconate dehydrogenase complexed with nadph 0.9338 27 56
ID Description Score Start End Superfamily
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9831 29 55 3.50.50.60
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9708 28 56 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9662 28 56 3.40.50.720
af_C0VXV5_2_190_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9645 28 58 3.40.50.720
1yonA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9556 29 56 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3M1CDN8-F1-model_v4 FAD-dependent oxidoreductase 0.9702 1 409 GO:0008688
GO:0019622
GO:0071949
AF-A0A2N2SAA5-F1-model_v4 FAD-dependent oxidoreductase 0.9697 70 553 GO:0016709
GO:0071949
AF-A0A442GX02-F1-model_v4 FAD-dependent oxidoreductase 0.9652 5 553 GO:0016709
GO:0071949
AF-L2EHU1-F1-model_v4 deleted 0.9638 1 513
AF-A0A2N2SAA5-F1-model_v4 FAD-dependent oxidoreductase 0.9619 70 553 GO:0016709
GO:0071949

Map