F388228

General Info

Members Datasets Scaffolds Average Seq Length
287 201 574 245

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0004244|Ga0496119_0004244_4458_5279
Length 273
Sequence MAFPERGFSVTDEKLQLDAQLAQRIATAAGELLLSLQRSGLYSGKELGKAGDHVANAFIMQTLRTHRPDDGILSEEEAGDPARLGKRRVWIVDPLDGTREYGEYPRVDWAVHIGLAIDGLPRAGAVSLPALSLTLCSDAPIAVAPPGSGALRMLVSRTRPAAEAVDVARLLGAELVPMGSAGAKAMAVLRNEADIYLHSGGQYEWDSCAPVAVAQAAGLHVSRIDGSALRYNCENPYLPDLLICRKEHAQEVLRLIQKVRAAPPRPLEKGVNS

Samples

Sample ID Description Type Environment
1 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
99 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
100 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
110 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
111 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 2508501039 Frankia saprophytica CN3 Isolate Nodule
187 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
188 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
189 2547132424 Nocardia nova SH22a Isolate Unclassified
190 2671180195 Frankia sp. CcI49 Isolate Nodule
191 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
192 2687453737 Frankia sp. BMG5.36 Isolate Nodule
193 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
194 2773857922 Frankia sp. CcI49 Isolate Nodule
195 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
196 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
197 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
198 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
199 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
200 8002784119 Frankia sp. AgB1.9 Isolate Nodule
201 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.33
Metatranscriptomes 0
Isolates 7.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 4.18
Rhizoplane 4.88
Rhizosphere 74.22
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496119_0004244 3300048922 Bacteria 14370
2 Ga0070658_10032432 3300005327 Bacteria 4198
3 Ga0070683_100168318 3300005329 Bacteria 2080
4 Ga0070683_100360062 3300005329 Bacteria 1385
5 Ga0070666_10021923 3300005335 Bacteria 4143
6 Ga0070666_10086890 3300005335 Bacteria 2143
7 Ga0070666_10153314 3300005335 Bacteria 1608
8 Ga0070680_100011864 3300005336 Bacteria 6758
9 Ga0068868_100006720 3300005338 Bacteria 8164
10 Ga0070661_100002127 3300005344 Bacteria 13656
11 Ga0070661_100090059 3300005344 Bacteria 2272
12 Ga0070668_100004329 3300005347 Bacteria 10530
13 Ga0070669_100642457 3300005353 Bacteria 892
14 Ga0070671_100049705 3300005355 Bacteria 3488
15 Ga0070673_100106196 3300005364 Bacteria 2321
16 Ga0070673_100309863 3300005364 Bacteria 1392
17 Ga0070667_100005747 3300005367 Bacteria 10364
18 Ga0070667_100014320 3300005367 Bacteria 6554
19 Ga0070714_100755668 3300005435 Bacteria 940
20 Ga0070662_100002184 3300005457 Bacteria 11991
21 Ga0070662_100012726 3300005457 Bacteria 5584
22 Ga0070662_100313357 3300005457 Bacteria 1278
23 Ga0070681_10009625 3300005458 Bacteria 9503
24 Ga0070679_100040899 3300005530 Bacteria 4613
25 Ga0070684_100049219 3300005535 Bacteria 3657
26 Ga0070665_100005712 3300005548 Bacteria 12771
27 Ga0068855_100012222 3300005563 Bacteria 10376
28 Ga0068855_100014908 3300005563 Bacteria 9363
29 Ga0070664_100020279 3300005564 Bacteria 5474
30 Ga0068854_100023131 3300005578 Bacteria 4242
31 Ga0068854_100705737 3300005578 Bacteria 871
32 Ga0068859_100001743 3300005617 Bacteria 22161
33 Ga0068859_100005689 3300005617 Bacteria 12685
34 Ga0068859_100030090 3300005617 Bacteria 5448
35 Ga0068859_100074361 3300005617 Bacteria 3437
36 Ga0068864_100019578 3300005618 Bacteria 5661
37 Ga0068863_100156701 3300005841 Bacteria 2180
38 Ga0068858_100001695 3300005842 Bacteria 22530
39 Ga0068858_100070362 3300005842 Bacteria 3243
40 Ga0068858_100313222 3300005842 Bacteria 1499
41 Ga0068860_100000382 3300005843 Bacteria 58081
42 Ga0068860_100008642 3300005843 Bacteria 10149
43 Ga0068862_100000066 3300005844 Bacteria 124095
44 Ga0068862_100004369 3300005844 Bacteria 11962
45 Ga0068862_100006074 3300005844 Bacteria 10055
46 Ga0075365_10076278 3300006038 Bacteria 2263
47 Ga0075365_10326013 3300006038 Bacteria 1082
48 Ga0075363_100001213 3300006048 Bacteria 9522
49 Ga0075363_100133940 3300006048 Bacteria 1391
50 Ga0075363_100260464 3300006048 Bacteria 1000
51 Ga0075432_10035632 3300006058 Bacteria 1729
52 Ga0075369_10108368 3300006186 Bacteria 1251
53 Ga0097621_100004696 3300006237 Bacteria 9544
54 Ga0075370_10013826 3300006353 Bacteria 4295
55 Ga0068865_100578382 3300006881 Bacteria 947
56 Ga0097620_100001743 3300006931 Bacteria 22161
57 Ga0097620_100005689 3300006931 Bacteria 12685
58 Ga0097620_100030090 3300006931 Bacteria 5448
59 Ga0097620_100074364 3300006931 Bacteria 3437
60 Ga0105240_10000854 3300009093 Bacteria 54945
61 Ga0105247_10001423 3300009101 Bacteria 17370
62 Ga0105247_10056328 3300009101 Bacteria 2428
63 Ga0105241_10059466 3300009174 Bacteria 2938
64 Ga0105248_10005754 3300009177 Bacteria 13620
65 Ga0105248_10007917 3300009177 Bacteria 11679
66 Ga0105248_10036696 3300009177 Bacteria 5482
67 Ga0105238_10066388 3300009551 Bacteria 3609
68 Ga0105249_10002922 3300009553 Bacteria 14737
69 Ga0105239_10174195 3300010375 Bacteria 2407
70 Ga0105246_10000032 3300011119 Bacteria 51397
71 Ga0157373_10027995 3300013100 Bacteria 4066
72 Ga0157373_10029602 3300013100 Bacteria 3943
73 Ga0157371_10012870 3300013102 Bacteria 6371
74 Ga0157370_10061912 3300013104 Bacteria 3551
75 Ga0157370_10124760 3300013104 Bacteria 2404
76 Ga0157369_10007697 3300013105 Bacteria 12396
77 Ga0157369_10024942 3300013105 Bacteria 6643
78 Ga0157374_10019901 3300013296 Bacteria 5949
79 Ga0157378_10017452 3300013297 Bacteria 6300
80 Ga0163162_10113949 3300013306 Bacteria 2803
81 Ga0157372_10606633 3300013307 Bacteria 1276
82 Ga0163163_10002708 3300014325 Bacteria 14962
83 Ga0157377_10095201 3300014745 Bacteria 1765
84 Ga0157379_10001026 3300014968 Bacteria 22704
85 Ga0157379_10003362 3300014968 Bacteria 13542
86 Ga0157376_10011857 3300014969 Bacteria 6444
87 Ga0213876_10000185 3300021384 Bacteria 64516
88 Ga0207710_10000545 3300025900 Bacteria 22636
89 Ga0207710_10000556 3300025900 Bacteria 22299
90 Ga0207710_10000571 3300025900 Bacteria 22034
91 Ga0207680_10018201 3300025903 Bacteria 3728
92 Ga0207680_10046508 3300025903 Bacteria 2566
93 Ga0207680_10071022 3300025903 Bacteria 2157
94 Ga0207705_10487041 3300025909 Bacteria 957
95 Ga0207707_10072127 3300025912 Bacteria 3010
96 Ga0207695_10045503 3300025913 Bacteria 4658
97 Ga0207660_10065967 3300025917 Bacteria 2617
98 Ga0207657_10005883 3300025919 Bacteria 12777
99 Ga0207649_10073166 3300025920 Bacteria 2195
100 Ga0207652_10032334 3300025921 Bacteria 4397
101 Ga0207694_10099484 3300025924 Bacteria 2303
102 Ga0207694_10202123 3300025924 Bacteria 1617
103 Ga0207659_10421168 3300025926 Bacteria 1120
104 Ga0207664_10660541 3300025929 Bacteria 940
105 Ga0207644_10498565 3300025931 Bacteria 1004
106 Ga0207690_10002354 3300025932 Bacteria 11476
107 Ga0207706_10002856 3300025933 Bacteria 16769
108 Ga0207706_10005439 3300025933 Bacteria 11866
109 Ga0207706_10063198 3300025933 Bacteria 3260
110 Ga0207711_10000365 3300025941 Bacteria 47940
111 Ga0207711_10005445 3300025941 Bacteria 10760
112 Ga0207711_10073208 3300025941 Bacteria 2977
113 Ga0207661_10174278 3300025944 Bacteria 1874
114 Ga0207679_10239209 3300025945 Bacteria 1537
115 Ga0207667_10106717 3300025949 Bacteria 2889
116 Ga0207651_10221305 3300025960 Bacteria 1530
117 Ga0207651_10378675 3300025960 Bacteria 1199
118 Ga0207712_10009683 3300025961 Bacteria 6108
119 Ga0207668_10233724 3300025972 Bacteria 1483
120 Ga0207668_10354087 3300025972 Unclassified 1228
121 Ga0207658_10041528 3300025986 Bacteria 3331
122 Ga0207677_10364934 3300026023 Bacteria 1214
123 Ga0207703_10000071 3300026035 Bacteria 121299
124 Ga0207703_10001291 3300026035 Bacteria 23198
125 Ga0207703_10018192 3300026035 Bacteria 5488
126 Ga0207639_10008247 3300026041 Bacteria 7135
127 Ga0207678_10094616 3300026067 Bacteria 2553
128 Ga0207641_10466285 3300026088 Bacteria 1222
129 Ga0207648_10271496 3300026089 Bacteria 1515
130 Ga0207676_10009299 3300026095 Bacteria 6993
131 Ga0207676_10260956 3300026095 Bacteria 1564
132 Ga0207674_10169937 3300026116 Bacteria 2134
133 Ga0207675_100010006 3300026118 Bacteria 8885
134 Ga0268265_10000062 3300028380 Bacteria 148317
135 Ga0268265_10006091 3300028380 Bacteria 8189
136 Ga0268265_10012049 3300028380 Bacteria 5854
137 Ga0268264_10000008 3300028381 Bacteria 773387
138 Ga0268264_10013433 3300028381 Bacteria 6743
139 Ga0268264_10130834 3300028381 Bacteria 2224
140 Ga0265327_10000252 3300031251 Bacteria 106339
141 Ga0316578_10260916 3300031728 Bacteria 1039
142 Ga0307516_10000937 3300031730 Bacteria 40227
143 Ga0307405_10240027 3300031731 Bacteria 1342
144 Ga0307413_10203557 3300031824 Bacteria 1431
145 Ga0307518_10104329 3300031838 Bacteria 2026
146 Ga0307414_10064299 3300032004 Bacteria 2611
147 Ga0316583_10004355 3300032133 Bacteria 5050
148 Ga0373929_0001099 3300035085 Bacteria 5256
149 Ga0373932_0000943 3300035112 Bacteria 8518
150 Ga0373931_0000029 3300035691 Bacteria 116290
151 Ga0316582_0037897 3300036647 Bacteria 2992
152 Ga0316584_0126565 3300036712 Bacteria 1908
153 Ga0436364_0986343 3300037853 Bacteria 1240
154 Ga0400483_028153 3300039062 Bacteria 36990
155 Ga0400483_086606 3300039062 Bacteria 2852
156 Ga0400483_143208 3300039062 Bacteria 16664
157 Ga0400483_205722 3300039062 Bacteria 12693
158 Ga0400483_216221 3300039062 Bacteria 3834
159 Ga0436365_0321092 3300039437 Bacteria 982
160 Ga0436365_0820464 3300039437 Bacteria 3195
161 Ga0439447_000181 3300041407 Bacteria 22248
162 Ga0439447_003501 3300041407 Bacteria 5571
163 Ga0439466_0001981 3300041411 Bacteria 8027
164 Ga0439466_0032802 3300041411 Bacteria 1768
165 Ga0439452_000097 3300042010 Bacteria 74034
166 Ga0450911_006907 3300042115 Bacteria 1669
167 Ga0450902_000305 3300042137 Bacteria 5899
168 Ga0451577_0794438 3300042876 Bacteria 855
169 Ga0466969_0042021 3300044656 Bacteria 2284
170 Ga0466966_0052761 3300044684 Bacteria 2581
171 Ga0466961_0093497 3300044693 Bacteria 1897
172 Ga0466970_0011935 3300044765 Bacteria 4434
173 Ga0466957_0021721 3300044842 Bacteria 3782
174 Ga0466959_0394876 3300045049 Bacteria 940
175 Ga0466958_0431686 3300045836 Bacteria 852
176 Ga0495617_004369 3300046452 Bacteria 5150
177 Ga0495603_0071559 3300046455 Bacteria 2038
178 Ga0495638_0000277 3300046460 Bacteria 69421
179 Ga0495638_0032629 3300046460 Bacteria 3337
180 Ga0495653_0086563 3300046463 Bacteria 2303
181 Ga0495594_0050431 3300046499 Bacteria 2289
182 Ga0495618_0035059 3300046514 Bacteria 3149
183 Ga0495632_0011496 3300046519 Bacteria 5161
184 Ga0495648_0000199 3300046524 Bacteria 69421
185 Ga0495654_0212077 3300046530 Bacteria 823
186 Ga0495622_0033325 3300046557 Bacteria 2404
187 Ga0495633_0002978 3300046558 Bacteria 11579
188 Ga0495633_0030855 3300046558 Bacteria 2601
189 Ga0495625_0004331 3300046660 Bacteria 13476
190 Ga0495625_0124248 3300046660 Bacteria 1753
191 Ga0495657_0148936 3300046675 Bacteria 1454
192 Ga0495669_0000002 3300046684 Bacteria 282777
193 Ga0495669_0000115 3300046684 Bacteria 51909
194 Ga0495649_0022543 3300046694 Bacteria 3523
195 Ga0495589_0025614 3300046794 Bacteria 2993
196 Ga0495600_0293448 3300046809 Bacteria 1027
197 Ga0495672_0002160 3300047320 Bacteria 18349
198 Ga0495680_0104522 3300047322 Bacteria 2107
199 Ga0495677_0015137 3300047445 Bacteria 2802
200 Ga0496101_0565090 3300048904 Bacteria 899
201 Ga0496102_0400401 3300048905 Bacteria 1291
202 Ga0496104_0005276 3300048907 Bacteria 11295
203 Ga0496104_0046712 3300048907 Bacteria 4079
204 Ga0496104_0495807 3300048907 Bacteria 1132
205 Ga0496105_0002923 3300048908 Bacteria 12535
206 Ga0496105_0159436 3300048908 Bacteria 1852
207 Ga0496106_0107153 3300048909 Bacteria 2173
208 Ga0496106_0331500 3300048909 Bacteria 1222
209 Ga0496108_0018112 3300048911 Bacteria 5762
210 Ga0496109_0004753 3300048912 Bacteria 11342
211 Ga0496110_0016664 3300048913 Bacteria 6138
212 Ga0496111_0012894 3300048914 Bacteria 5671
213 Ga0496114_0169717 3300048917 Bacteria 1901
214 Ga0496116_0000479 3300048919 Bacteria 55101
215 Ga0496117_0017041 3300048920 Bacteria 6085
216 Ga0496119_0002316 3300048922 Bacteria 21003
217 Ga0496119_0014048 3300048922 Bacteria 6306
218 Ga0496119_0014935 3300048922 Bacteria 6033
219 Ga0496120_0000197 3300048923 Bacteria 103378
220 Ga0496120_0000394 3300048923 Bacteria 70310
221 Ga0496121_0022884 3300048924 Bacteria 6040
222 Ga0496121_0032902 3300048924 Bacteria 4704
223 Ga0501031_0121477 3300049568 Bacteria 1707
224 Ga0501032_0013814 3300049569 Bacteria 5729
225 Ga0501033_0005558 3300049570 Bacteria 9969
226 Ga0501033_0154323 3300049570 Bacteria 1655
227 Ga0501034_0001731 3300049571 Bacteria 28080
228 Ga0501034_0007907 3300049571 Bacteria 11297
229 Ga0501034_0037207 3300049571 Bacteria 4928
230 Ga0501034_0043911 3300049571 Bacteria 4521
231 Ga0501037_0004967 3300049573 Bacteria 9671
232 Ga0501038_0029319 3300049574 Bacteria 4878
233 Ga0501038_0222909 3300049574 Bacteria 1504
234 Ga0501040_0151364 3300049576 Bacteria 1637
235 Ga0501042_0206027 3300049578 Bacteria 1418
236 Ga0501047_0049337 3300049581 Bacteria 4065
237 Ga0501047_0058462 3300049581 Bacteria 3725
238 Ga0501068_0017368 3300049584 Bacteria 4161
239 Ga0501069_0026732 3300049585 Bacteria 3161
240 Ga0501070_0003070 3300049586 Bacteria 14540
241 Ga0501070_0061119 3300049586 Bacteria 3122
242 Ga0501074_0100166 3300049590 Bacteria 2074
243 Ga0501079_0200800 3300049741 Bacteria 1557
244 Ga0501080_0023143 3300049742 Bacteria 5762
245 Ga0501080_0231726 3300049742 Bacteria 1688
246 Ga0501035_0102309 3300049822 Bacteria 2513
247 Ga0501035_0195447 3300049822 Bacteria 1738
248 Ga0501044_0003233 3300049823 Bacteria 18345
249 Ga0501044_0004139 3300049823 Bacteria 16285
250 Ga0501044_0295628 3300049823 Bacteria 1550
251 nmdc:mga03683_41159_c1 3300050489 Bacteria 1897
252 nmdc:mga00v17_45158_c2 3300050491 Bacteria 2106
253 nmdc:mga0yw44_61496_c1 3300050492 Bacteria 2304
254 nmdc:mga04h51_61386_c1 3300050495 Bacteria 1289
255 nmdc:mga07m45_38278_c1 3300050496 Bacteria 2676
256 nmdc:mga0sz30_45552_c1 3300050516 Bacteria 1850
257 Ga0500644_0002517 3300053088 Bacteria 4575
258 Ga0500566_0001099 3300053094 Bacteria 15666
259 Ga0500562_006063 3300053108 Bacteria 3043
260 Ga0500618_001815 3300053125 Bacteria 8952
261 Ga0500655_013205 3300053133 Bacteria 1506
262 Ga0500573_0105511 3300053140 Bacteria 1582
263 Ga0500616_0080025 3300053153 Bacteria 1644
264 Ga0500637_0018830 3300053178 Bacteria 3715
265 Ga0501082_0164849 3300060353 Bacteria 1926
266 2508673112 2508501039 Bacteria 9978592
267 2510246990 2510065045 Bacteria 7761063
268 2515681239 2515154122 Bacteria 8609520
269 2548696586 2547132424 Bacteria 8348532
270 2671836569 2671180195 Bacteria 9757215
271 2686537410 2684623035 Bacteria 8032739
272 2686539594 2684623035 Bacteria 8032739
273 2689955808 2687453737 Bacteria 11203906
274 2719637988 2718217991 Bacteria 7829542
275 2774854725 2773857922 Bacteria 9757215
276 2774854766 2773857922 Bacteria 9757215
277 2842890794 2842888712 Bacteria 4279094
278 2895881608 2895880812 Bacteria 11255272
279 2895883380 2895880812 Bacteria 11255272
280 2895884723 2895880812 Bacteria 11255272
281 2902686315 2902682994 Bacteria 8951596
282 2919713521 2919713450 Bacteria 7431245
283 3000867684 3000865235 Bacteria 3106258
284 8002787727 8002784119 Bacteria 9788632
285 8002789483 8002784119 Bacteria 9788632
286 8002791106 8002784119 Bacteria 9788632
287 8055273041 8055266321 Bacteria 7999742
288 Ga0496119_0004244
289 Ga0070658_10032432
290 Ga0070683_100168318
291 Ga0070683_100360062
292 Ga0070666_10021923
293 Ga0070666_10086890
294 Ga0070666_10153314
295 Ga0070680_100011864
296 Ga0068868_100006720
297 Ga0070661_100002127
298 Ga0070661_100090059
299 Ga0070668_100004329
300 Ga0070669_100642457
301 Ga0070671_100049705
302 Ga0070673_100106196
303 Ga0070673_100309863
304 Ga0070667_100005747
305 Ga0070667_100014320
306 Ga0070714_100755668
307 Ga0070662_100002184
308 Ga0070662_100012726
309 Ga0070662_100313357
310 Ga0070681_10009625
311 Ga0070679_100040899
312 Ga0070684_100049219
313 Ga0070665_100005712
314 Ga0068855_100012222
315 Ga0068855_100014908
316 Ga0070664_100020279
317 Ga0068854_100023131
318 Ga0068854_100705737
319 Ga0068859_100001743
320 Ga0068859_100005689
321 Ga0068859_100030090
322 Ga0068859_100074361
323 Ga0068864_100019578
324 Ga0068863_100156701
325 Ga0068858_100001695
326 Ga0068858_100070362
327 Ga0068858_100313222
328 Ga0068860_100000382
329 Ga0068860_100008642
330 Ga0068862_100000066
331 Ga0068862_100004369
332 Ga0068862_100006074
333 Ga0075365_10076278
334 Ga0075365_10326013
335 Ga0075363_100001213
336 Ga0075363_100133940
337 Ga0075363_100260464
338 Ga0075432_10035632
339 Ga0075369_10108368
340 Ga0097621_100004696
341 Ga0075370_10013826
342 Ga0068865_100578382
343 Ga0097620_100001743
344 Ga0097620_100005689
345 Ga0097620_100030090
346 Ga0097620_100074364
347 Ga0105240_10000854
348 Ga0105247_10001423
349 Ga0105247_10056328
350 Ga0105241_10059466
351 Ga0105248_10005754
352 Ga0105248_10007917
353 Ga0105248_10036696
354 Ga0105238_10066388
355 Ga0105249_10002922
356 Ga0105239_10174195
357 Ga0105246_10000032
358 Ga0157373_10027995
359 Ga0157373_10029602
360 Ga0157371_10012870
361 Ga0157370_10061912
362 Ga0157370_10124760
363 Ga0157369_10007697
364 Ga0157369_10024942
365 Ga0157374_10019901
366 Ga0157378_10017452
367 Ga0163162_10113949
368 Ga0157372_10606633
369 Ga0163163_10002708
370 Ga0157377_10095201
371 Ga0157379_10001026
372 Ga0157379_10003362
373 Ga0157376_10011857
374 Ga0213876_10000185
375 Ga0207710_10000545
376 Ga0207710_10000556
377 Ga0207710_10000571
378 Ga0207680_10018201
379 Ga0207680_10046508
380 Ga0207680_10071022
381 Ga0207705_10487041
382 Ga0207707_10072127
383 Ga0207695_10045503
384 Ga0207660_10065967
385 Ga0207657_10005883
386 Ga0207649_10073166
387 Ga0207652_10032334
388 Ga0207694_10099484
389 Ga0207694_10202123
390 Ga0207659_10421168
391 Ga0207664_10660541
392 Ga0207644_10498565
393 Ga0207690_10002354
394 Ga0207706_10002856
395 Ga0207706_10005439
396 Ga0207706_10063198
397 Ga0207711_10000365
398 Ga0207711_10005445
399 Ga0207711_10073208
400 Ga0207661_10174278
401 Ga0207679_10239209
402 Ga0207667_10106717
403 Ga0207651_10221305
404 Ga0207651_10378675
405 Ga0207712_10009683
406 Ga0207668_10233724
407 Ga0207668_10354087
408 Ga0207658_10041528
409 Ga0207677_10364934
410 Ga0207703_10000071
411 Ga0207703_10001291
412 Ga0207703_10018192
413 Ga0207639_10008247
414 Ga0207678_10094616
415 Ga0207641_10466285
416 Ga0207648_10271496
417 Ga0207676_10009299
418 Ga0207676_10260956
419 Ga0207674_10169937
420 Ga0207675_100010006
421 Ga0268265_10000062
422 Ga0268265_10006091
423 Ga0268265_10012049
424 Ga0268264_10000008
425 Ga0268264_10013433
426 Ga0268264_10130834
427 Ga0265327_10000252
428 Ga0316578_10260916
429 Ga0307516_10000937
430 Ga0307405_10240027
431 Ga0307413_10203557
432 Ga0307518_10104329
433 Ga0307414_10064299
434 Ga0316583_10004355
435 Ga0373929_0001099
436 Ga0373932_0000943
437 Ga0373931_0000029
438 Ga0316582_0037897
439 Ga0316584_0126565
440 Ga0436364_0986343
441 Ga0400483_028153
442 Ga0400483_086606
443 Ga0400483_143208
444 Ga0400483_205722
445 Ga0400483_216221
446 Ga0436365_0321092
447 Ga0436365_0820464
448 Ga0439447_000181
449 Ga0439447_003501
450 Ga0439466_0001981
451 Ga0439466_0032802
452 Ga0439452_000097
453 Ga0450911_006907
454 Ga0450902_000305
455 Ga0451577_0794438
456 Ga0466969_0042021
457 Ga0466966_0052761
458 Ga0466961_0093497
459 Ga0466970_0011935
460 Ga0466957_0021721
461 Ga0466959_0394876
462 Ga0466958_0431686
463 Ga0495617_004369
464 Ga0495603_0071559
465 Ga0495638_0000277
466 Ga0495638_0032629
467 Ga0495653_0086563
468 Ga0495594_0050431
469 Ga0495618_0035059
470 Ga0495632_0011496
471 Ga0495648_0000199
472 Ga0495654_0212077
473 Ga0495622_0033325
474 Ga0495633_0002978
475 Ga0495633_0030855
476 Ga0495625_0004331
477 Ga0495625_0124248
478 Ga0495657_0148936
479 Ga0495669_0000002
480 Ga0495669_0000115
481 Ga0495649_0022543
482 Ga0495589_0025614
483 Ga0495600_0293448
484 Ga0495672_0002160
485 Ga0495680_0104522
486 Ga0495677_0015137
487 Ga0496101_0565090
488 Ga0496102_0400401
489 Ga0496104_0005276
490 Ga0496104_0046712
491 Ga0496104_0495807
492 Ga0496105_0002923
493 Ga0496105_0159436
494 Ga0496106_0107153
495 Ga0496106_0331500
496 Ga0496108_0018112
497 Ga0496109_0004753
498 Ga0496110_0016664
499 Ga0496111_0012894
500 Ga0496114_0169717
501 Ga0496116_0000479
502 Ga0496117_0017041
503 Ga0496119_0002316
504 Ga0496119_0014048
505 Ga0496119_0014935
506 Ga0496120_0000197
507 Ga0496120_0000394
508 Ga0496121_0022884
509 Ga0496121_0032902
510 Ga0501031_0121477
511 Ga0501032_0013814
512 Ga0501033_0005558
513 Ga0501033_0154323
514 Ga0501034_0001731
515 Ga0501034_0007907
516 Ga0501034_0037207
517 Ga0501034_0043911
518 Ga0501037_0004967
519 Ga0501038_0029319
520 Ga0501038_0222909
521 Ga0501040_0151364
522 Ga0501042_0206027
523 Ga0501047_0049337
524 Ga0501047_0058462
525 Ga0501068_0017368
526 Ga0501069_0026732
527 Ga0501070_0003070
528 Ga0501070_0061119
529 Ga0501074_0100166
530 Ga0501079_0200800
531 Ga0501080_0023143
532 Ga0501080_0231726
533 Ga0501035_0102309
534 Ga0501035_0195447
535 Ga0501044_0003233
536 Ga0501044_0004139
537 Ga0501044_0295628
538 nmdc:mga03683_41159_c1
539 nmdc:mga00v17_45158_c2
540 nmdc:mga0yw44_61496_c1
541 nmdc:mga04h51_61386_c1
542 nmdc:mga07m45_38278_c1
543 nmdc:mga0sz30_45552_c1
544 Ga0500644_0002517
545 Ga0500566_0001099
546 Ga0500562_006063
547 Ga0500618_001815
548 Ga0500655_013205
549 Ga0500573_0105511
550 Ga0500616_0080025
551 Ga0500637_0018830
552 Ga0501082_0164849
553 2508673112
554 2510246990
555 2515681239
556 2548696586
557 2671836569
558 2686537410
559 2686539594
560 2689955808
561 2719637988
562 2774854725
563 2774854766
564 2842890794
565 2895881608
566 2895883380
567 2895884723
568 2902686315
569 2919713521
570 3000867684
571 8002787727
572 8002789483
573 8002791106
574 8055273041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

9

261

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5djk-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with po4 and 2ca bound 0.944 1 243
5djg-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with pap, mg, and li bound 0.9425 1 243
5dji-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with amp, po4, and 2mg bound 0.9417 1 243
5djh-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with amp, po4, and 3mg bound 0.9349 1 243
5djf-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase - ligand-free structure 0.9349 1 243
ID Description Score Start End Superfamily
af_P9WKJ1_154_255_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9398 133 232 3.40.190.80
af_P9WKJ1_12_146_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9346 1 124 3.30.540.10
2q74C01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9142 4 114 3.30.540.10
af_P9WKJ1_154_255_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9136 133 232 3.40.190.80
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9074 4 122 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A2D4XZT0-F1-model_v4 deleted 1.005 1 97
AF-A0A1Q3MEU1-F1-model_v4 deleted 0.9922 3 243
AF-A0A2Z6ALE3-F1-model_v4 3'(2'), 5'-bisphosphate nucleotidase 0.9901 1 247 GO:0000103
GO:0008441
GO:0046872
GO:0050427
AF-A0A165PIH6-F1-model_v4 deleted 0.9894 1 243
AF-A0A1M3P914-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9891 1 245 GO:0000103
GO:0008441
GO:0046872
GO:0050427

Map