F388233

General Info

Members Datasets Scaffolds Average Seq Length
287 154 574 397

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0016594|Ga0501031_0016594_2397_3701
Length 434
Sequence MSYLTHLECSACCRRLDPDRPWQLCPDCEQPLLAHYDLDRLGRQASVDDLDRRPPGLWRYRDLLPLRAPDQAISLGEGATPLLQVPRLAERMGVPGLLVKDEGTLPTGTFKARGAAVGTSRAVELGVRTLALPTAGNAGAAWAAYGARAGLEVVVVMPETTPSVIRRATAACGADLYLVPGSIADAGAVVRDGCRRHGWYDASTLKEPYRVEGKKTMGFELVDQLGWRLPEVIVYPTGGGVGLIGMWKGFQELRALGWLPAGSPPPRFVAAQAAGCAPVVRAFAEGAERAAAWEEPVTFAAGLRVPKPLGDALILRALRETAGTAVAVPDETIAATMELAGAAEGMVVCPEGAAALAAAAELRREGWIGEDETVAVFNTGTGLLYEDSLPGRAPRRLRAGEPLPPPGALDDQPSGVGREEPGGSGTAGNQRAWA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.7
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 1.39
Rhizosphere 97.21
Stem 0
Stem Tuber 0.35
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0016594 3300049568 Bacteria 4782
2 Ga0070683_100003655 3300005329 Bacteria 12534
3 Ga0070683_100023019 3300005329 Bacteria 5571
4 Ga0070683_100034238 3300005329 Bacteria 4638
5 Ga0070683_100083220 3300005329 Bacteria 2997
6 Ga0070683_100184666 3300005329 Bacteria 1979
7 Ga0070670_100039310 3300005331 Bacteria 4068
8 Ga0070670_100131502 3300005331 Bacteria 2161
9 Ga0070666_10006525 3300005335 Bacteria 7166
10 Ga0070680_100008115 3300005336 Bacteria 8017
11 Ga0070680_100009208 3300005336 Bacteria 7574
12 Ga0070680_100034520 3300005336 Bacteria 4078
13 Ga0070680_100168654 3300005336 Bacteria 1841
14 Ga0070682_100049078 3300005337 Bacteria 2631
15 Ga0070660_100023409 3300005339 Bacteria 4575
16 Ga0070660_100030548 3300005339 Bacteria 4042
17 Ga0070660_100089876 3300005339 Bacteria 2420
18 Ga0070660_100125850 3300005339 Bacteria 2048
19 Ga0070660_100289080 3300005339 Bacteria 1342
20 Ga0070661_100116971 3300005344 Bacteria 1994
21 Ga0070661_100196582 3300005344 Bacteria 1540
22 Ga0070661_100256270 3300005344 Bacteria 1351
23 Ga0070668_100035846 3300005347 Bacteria 3785
24 Ga0070669_100038149 3300005353 Bacteria 3487
25 Ga0070659_100003592 3300005366 Bacteria 11036
26 Ga0070659_100006577 3300005366 Bacteria 8394
27 Ga0070659_100017826 3300005366 Bacteria 5349
28 Ga0070659_100064984 3300005366 Bacteria 2889
29 Ga0070659_100176379 3300005366 Bacteria 1752
30 Ga0070667_100028758 3300005367 Bacteria 4628
31 Ga0070667_100121277 3300005367 Bacteria 2274
32 Ga0070714_100056770 3300005435 Bacteria 3349
33 Ga0070714_100243097 3300005435 Bacteria 1662
34 Ga0070694_100013248 3300005444 Bacteria 5148
35 Ga0070662_100001023 3300005457 Bacteria 17121
36 Ga0070681_10019232 3300005458 Bacteria 6834
37 Ga0070681_10056998 3300005458 Bacteria 3887
38 Ga0070706_100000881 3300005467 Bacteria 32916
39 Ga0070706_100113489 3300005467 Bacteria 2523
40 Ga0070706_100214435 3300005467 Bacteria 1797
41 Ga0070698_100004172 3300005471 Bacteria 15875
42 Ga0070698_100059429 3300005471 Bacteria 3861
43 Ga0070699_100128953 3300005518 Bacteria 2229
44 Ga0070684_100002373 3300005535 Bacteria 13880
45 Ga0070684_100034616 3300005535 Bacteria 4319
46 Ga0068853_100002834 3300005539 Bacteria 13141
47 Ga0070696_100007519 3300005546 Bacteria 7287
48 Ga0070704_100011006 3300005549 Bacteria 5520
49 Ga0068855_100122698 3300005563 Bacteria 2973
50 Ga0068857_100005235 3300005577 Bacteria 11044
51 Ga0068857_100123294 3300005577 Bacteria 2334
52 Ga0068854_100005034 3300005578 Bacteria 8326
53 Ga0068856_100016677 3300005614 Bacteria 7114
54 Ga0068856_100024850 3300005614 Bacteria 5835
55 Ga0068856_100289966 3300005614 Bacteria 1653
56 Ga0068852_100000691 3300005616 Bacteria 22066
57 Ga0068859_100038372 3300005617 Bacteria 4806
58 Ga0068859_100119463 3300005617 Bacteria 2702
59 Ga0068858_100066237 3300005842 Bacteria 3343
60 Ga0068860_100070567 3300005843 Bacteria 3321
61 Ga0081455_10072617 3300005937 Bacteria 2848
62 Ga0097621_100245337 3300006237 Bacteria 1567
63 Ga0068871_100054175 3300006358 Bacteria 3253
64 Ga0075428_100000724 3300006844 Bacteria 34214
65 Ga0075428_100015080 3300006844 Bacteria 8584
66 Ga0075428_100020889 3300006844 Bacteria 7250
67 Ga0075428_100244538 3300006844 Unclassified 1935
68 Ga0075430_100000005 3300006846 Bacteria 108528
69 Ga0075430_100050368 3300006846 Bacteria 3512
70 Ga0075431_100000188 3300006847 Bacteria 44797
71 Ga0075431_100083321 3300006847 Bacteria 3301
72 Ga0075431_100097697 3300006847 Bacteria 3033
73 Ga0075433_10086072 3300006852 Bacteria 2775
74 Ga0075429_100000077 3300006880 Bacteria 49812
75 Ga0097620_100038372 3300006931 Bacteria 4806
76 Ga0097620_100119476 3300006931 Bacteria 2702
77 Ga0105240_10005422 3300009093 Bacteria 19012
78 Ga0105240_10023780 3300009093 Bacteria 8094
79 Ga0111539_10000225 3300009094 Bacteria 67615
80 Ga0114129_10009728 3300009147 Bacteria 13713
81 Ga0114129_10044233 3300009147 Bacteria 6264
82 Ga0114129_10126213 3300009147 Bacteria 3518
83 Ga0114129_10557069 3300009147 Unclassified 1490
84 Ga0105241_10155644 3300009174 Bacteria 1874
85 Ga0105248_10150174 3300009177 Bacteria 2628
86 Ga0105237_10056543 3300009545 Bacteria 3927
87 Ga0105246_10081810 3300011119 Bacteria 2303
88 Ga0157373_10003366 3300013100 Bacteria 12088
89 Ga0157371_10015947 3300013102 Bacteria 5621
90 Ga0157371_10085341 3300013102 Bacteria 2236
91 Ga0157370_10001129 3300013104 Bacteria 33355
92 Ga0157370_10008585 3300013104 Bacteria 11003
93 Ga0157370_10044231 3300013104 Bacteria 4281
94 Ga0157369_10079562 3300013105 Bacteria 3510
95 Ga0157369_10422810 3300013105 Bacteria 1381
96 Ga0157372_10038097 3300013307 Bacteria 5305
97 Ga0157375_10002721 3300013308 Bacteria 15280
98 Ga0163161_10041965 3300017792 Bacteria 3289
99 Ga0206356_10069298 3300020070 Bacteria 1716
100 Ga0206354_10827474 3300020081 Bacteria 1439
101 Ga0213876_10008014 3300021384 Bacteria 5727
102 Ga0207697_10049499 3300025315 Bacteria 1735
103 Ga0207642_10015354 3300025899 Bacteria 2851
104 Ga0207647_10000429 3300025904 Bacteria 34410
105 Ga0207647_10000595 3300025904 Bacteria 28150
106 Ga0207647_10081077 3300025904 Bacteria 1945
107 Ga0207645_10139022 3300025907 Bacteria 1582
108 Ga0207705_10094242 3300025909 Bacteria 2195
109 Ga0207684_10129067 3300025910 Bacteria 2170
110 Ga0207707_10060394 3300025912 Bacteria 3298
111 Ga0207695_10105972 3300025913 Bacteria 2798
112 Ga0207660_10002244 3300025917 Bacteria 12764
113 Ga0207660_10037172 3300025917 Bacteria 3391
114 Ga0207660_10113249 3300025917 Bacteria 2045
115 Ga0207657_10001587 3300025919 Bacteria 24451
116 Ga0207657_10007286 3300025919 Bacteria 11349
117 Ga0207657_10007347 3300025919 Bacteria 11302
118 Ga0207657_10010348 3300025919 Bacteria 9310
119 Ga0207657_10011885 3300025919 Bacteria 8617
120 Ga0207657_10075755 3300025919 Bacteria 2839
121 Ga0207657_10139508 3300025919 Bacteria 1981
122 Ga0207649_10003670 3300025920 Bacteria 8380
123 Ga0207649_10124071 3300025920 Bacteria 1745
124 Ga0207652_10041511 3300025921 Bacteria 3911
125 Ga0207652_10117782 3300025921 Bacteria 2360
126 Ga0207681_10061757 3300025923 Bacteria 2577
127 Ga0207650_10049142 3300025925 Bacteria 3113
128 Ga0207664_10039514 3300025929 Bacteria 3664
129 Ga0207664_10179914 3300025929 Bacteria 1815
130 Ga0207690_10002257 3300025932 Bacteria 11751
131 Ga0207690_10002893 3300025932 Bacteria 10344
132 Ga0207690_10024292 3300025932 Bacteria 3795
133 Ga0207690_10044670 3300025932 Bacteria 2922
134 Ga0207690_10090572 3300025932 Bacteria 2159
135 Ga0207690_10176425 3300025932 Bacteria 1605
136 Ga0207690_10227643 3300025932 Bacteria 1430
137 Ga0207706_10000378 3300025933 Bacteria 48430
138 Ga0207706_10006666 3300025933 Bacteria 10676
139 Ga0207706_10113371 3300025933 Bacteria 2385
140 Ga0207689_10049451 3300025942 Bacteria 3468
141 Ga0207661_10015747 3300025944 Bacteria 5571
142 Ga0207661_10018654 3300025944 Bacteria 5156
143 Ga0207679_10058191 3300025945 Bacteria 2862
144 Ga0207679_10280517 3300025945 Bacteria 1429
145 Ga0207667_10023306 3300025949 Bacteria 6817
146 Ga0207667_10027008 3300025949 Bacteria 6261
147 Ga0207667_10058558 3300025949 Bacteria 4039
148 Ga0207667_10179097 3300025949 Bacteria 2177
149 Ga0207667_10367205 3300025949 Bacteria 1467
150 Ga0207651_10208127 3300025960 Bacteria 1572
151 Ga0207658_10015867 3300025986 Bacteria 5172
152 Ga0207658_10138430 3300025986 Bacteria 1966
153 Ga0207658_10210635 3300025986 Bacteria 1628
154 Ga0207677_10051820 3300026023 Bacteria 2784
155 Ga0207703_10005590 3300026035 Bacteria 10093
156 Ga0207639_10087528 3300026041 Bacteria 2483
157 Ga0207639_10132623 3300026041 Bacteria 2064
158 Ga0207678_10018512 3300026067 Bacteria 6117
159 Ga0207678_10021168 3300026067 Bacteria 5700
160 Ga0207678_10103166 3300026067 Bacteria 2435
161 Ga0207702_10031062 3300026078 Bacteria 4452
162 Ga0207702_10130718 3300026078 Bacteria 2259
163 Ga0207648_10017487 3300026089 Bacteria 6522
164 Ga0207648_10076916 3300026089 Bacteria 2909
165 Ga0207674_10001045 3300026116 Bacteria 36002
166 Ga0207674_10010980 3300026116 Bacteria 10192
167 Ga0207674_10032615 3300026116 Bacteria 5461
168 Ga0207674_10178364 3300026116 Bacteria 2076
169 Ga0207675_100082288 3300026118 Bacteria 3019
170 Ga0207683_10008132 3300026121 Bacteria 8971
171 Ga0207698_10002094 3300026142 Bacteria 11774
172 Ga0209974_10000170 3300027876 Bacteria 20007
173 Ga0207428_10076539 3300027907 Bacteria 2620
174 Ga0268265_10125170 3300028380 Bacteria 2125
175 Ga0268265_10204538 3300028380 Bacteria 1715
176 Ga0268264_10031955 3300028381 Bacteria 4318
177 Ga0307408_100034094 3300031548 Bacteria 3562
178 Ga0307408_100044302 3300031548 Bacteria 3170
179 Ga0307405_10109071 3300031731 Bacteria 1871
180 Ga0307413_10070897 3300031824 Bacteria 2193
181 Ga0307410_10059611 3300031852 Bacteria 2606
182 Ga0307407_10023434 3300031903 Bacteria 3221
183 Ga0307407_10052269 3300031903 Bacteria 2346
184 Ga0307412_10006861 3300031911 Bacteria 6462
185 Ga0307412_10034250 3300031911 Bacteria 3235
186 Ga0307409_100059520 3300031995 Bacteria 2973
187 Ga0307409_100076538 3300031995 Bacteria 2683
188 Ga0307409_100096147 3300031995 Bacteria 2442
189 Ga0307416_100004257 3300032002 Bacteria 8595
190 Ga0307416_100086249 3300032002 Bacteria 2675
191 Ga0307416_100223917 3300032002 Bacteria 1807
192 Ga0307414_10160710 3300032004 Bacteria 1784
193 Ga0307411_10010870 3300032005 Bacteria 4878
194 Ga0307411_10167161 3300032005 Bacteria 1654
195 Ga0307415_100089401 3300032126 Bacteria 2224
196 Ga0307415_100100813 3300032126 Bacteria 2117
197 Ga0373943_0003479 3300035170 Bacteria 7167
198 Ga0373931_0004693 3300035691 Bacteria 6257
199 Ga0373935_0048770 3300035692 Bacteria 2682
200 Ga0373925_0009605 3300037068 Bacteria 7049
201 Ga0395899_0004663 3300037312 Bacteria 10698
202 Ga0395899_0024337 3300037312 Bacteria 4578
203 Ga0395899_0028259 3300037312 Bacteria 4223
204 Ga0395899_0097689 3300037312 Bacteria 2122
205 Ga0395900_0007276 3300037418 Bacteria 11458
206 Ga0395900_0013525 3300037418 Bacteria 8338
207 Ga0395900_0013743 3300037418 Bacteria 8264
208 Ga0395900_0013981 3300037418 Bacteria 8192
209 Ga0395900_0031245 3300037418 Bacteria 5469
210 Ga0395900_0227401 3300037418 Bacteria 1878
211 Ga0395900_0309104 3300037418 Bacteria 1564
212 Ga0395900_0368048 3300037418 Bacteria 1408
213 Ga0395898_0036094 3300037466 Bacteria 4910
214 Ga0395898_0058842 3300037466 Bacteria 3740
215 Ga0395898_0257610 3300037466 Bacteria 1664
216 Ga0395905_0003412 3300037471 Bacteria 16996
217 Ga0395905_0005762 3300037471 Bacteria 12590
218 Ga0395905_0013020 3300037471 Bacteria 7991
219 Ga0395905_0018147 3300037471 Bacteria 6677
220 Ga0395905_0037710 3300037471 Bacteria 4536
221 Ga0395905_0067490 3300037471 Bacteria 3350
222 Ga0395905_0076046 3300037471 Bacteria 3146
223 Ga0395905_0115055 3300037471 Bacteria 2527
224 Ga0395905_0131321 3300037471 Bacteria 2355
225 Ga0395905_0197523 3300037471 Bacteria 1886
226 Ga0395905_0231520 3300037471 Bacteria 1728
227 Ga0395901_0010989 3300038443 Bacteria 9174
228 Ga0395901_0039131 3300038443 Bacteria 4906
229 Ga0395901_0072747 3300038443 Bacteria 3584
230 Ga0395901_0101227 3300038443 Bacteria 3023
231 Ga0395901_0178289 3300038443 Bacteria 2228
232 Ga0395901_0239792 3300038443 Bacteria 1891
233 Ga0395901_0241866 3300038443 Bacteria 1882
234 Ga0395901_0298810 3300038443 Bacteria 1669
235 Ga0395901_0451530 3300038443 Bacteria 1314
236 Ga0436365_0503355 3300039437 Bacteria 23814
237 Ga0436362_1094259 3300039453 Bacteria 1296
238 Ga0466961_0029639 3300044693 Bacteria 3516
239 Ga0466961_0044822 3300044693 Bacteria 2830
240 Ga0466963_0002442 3300044694 Bacteria 10388
241 Ga0466963_0004930 3300044694 Bacteria 7785
242 Ga0466963_0042376 3300044694 Bacteria 2989
243 Ga0466957_0014614 3300044842 Bacteria 4573
244 Ga0466957_0026925 3300044842 Bacteria 3414
245 Ga0466959_0028108 3300045049 Bacteria 4171
246 Ga0466958_0052622 3300045836 Bacteria 2468
247 Ga0466967_0003430 3300045976 Bacteria 10341
248 Ga0466967_0032441 3300045976 Bacteria 4411
249 Ga0466967_0061765 3300045976 Bacteria 3325
250 Ga0466967_0310805 3300045976 Bacteria 1518
251 Ga0466967_0338743 3300045976 Bacteria 1454
252 Ga0495668_0072611 3300046616 Bacteria 1890
253 Ga0495669_0008239 3300046684 Bacteria 4376
254 Ga0495669_0077513 3300046684 Bacteria 1522
255 Ga0496102_0008643 3300048905 Bacteria 8740
256 Ga0496107_0033421 3300048910 Bacteria 3680
257 Ga0496111_0062983 3300048914 Bacteria 2690
258 Ga0496112_0071028 3300048915 Bacteria 3441
259 Ga0501033_0199479 3300049570 Bacteria 1430
260 Ga0501036_0080249 3300049572 Bacteria 2758
261 Ga0501038_0009368 3300049574 Bacteria 8984
262 Ga0501042_0049001 3300049578 Bacteria 3012
263 Ga0501070_0196117 3300049586 Bacteria 1658
264 Ga0501071_0025574 3300049587 Bacteria 4137
265 Ga0501074_0019876 3300049590 Bacteria 4878
266 Ga0501075_0037842 3300049591 Bacteria 3606
267 Ga0501075_0052403 3300049591 Bacteria 3068
268 Ga0501075_0104207 3300049591 Bacteria 2156
269 Ga0501076_0085588 3300049592 Bacteria 2533
270 Ga0501079_0035723 3300049741 Bacteria 3826
271 Ga0501079_0135078 3300049741 Bacteria 1920
272 Ga0501080_0234937 3300049742 Bacteria 1675
273 Ga0501035_0061402 3300049822 Bacteria 3345
274 Ga0501045_0000568 3300049824 Bacteria 23176
275 nmdc:mga05p37_6423_c1 3300050507 Bacteria 13861
276 nmdc:mga09592_375_c1 3300050508 Bacteria 32667
277 nmdc:mga0qj67_379_c1 3300050509 Bacteria 30645
278 nmdc:mga06r32_1305_c1 3300050510 Bacteria 22500
279 nmdc:mga08y16_15825_c1 3300050511 Bacteria 7930
280 nmdc:mga0n895_113381_c1 3300050512 Bacteria 2728
281 nmdc:mga0a205_1107_c1 3300050515 Bacteria 22328
282 Ga0495612_0035178 3300053078 Bacteria 2030
283 Ga0500658_0000081 3300053134 Bacteria 43923
284 Ga0501084_0042216 3300054114 Bacteria 3814
285 Ga0501082_0003861 3300060353 Bacteria 13092
286 Ga0466962_0106678 3300061719 Bacteria 1347
287 2885428852 2885427238 Bacteria 2291351
288 Ga0501031_0016594
289 Ga0070683_100003655
290 Ga0070683_100023019
291 Ga0070683_100034238
292 Ga0070683_100083220
293 Ga0070683_100184666
294 Ga0070670_100039310
295 Ga0070670_100131502
296 Ga0070666_10006525
297 Ga0070680_100008115
298 Ga0070680_100009208
299 Ga0070680_100034520
300 Ga0070680_100168654
301 Ga0070682_100049078
302 Ga0070660_100023409
303 Ga0070660_100030548
304 Ga0070660_100089876
305 Ga0070660_100125850
306 Ga0070660_100289080
307 Ga0070661_100116971
308 Ga0070661_100196582
309 Ga0070661_100256270
310 Ga0070668_100035846
311 Ga0070669_100038149
312 Ga0070659_100003592
313 Ga0070659_100006577
314 Ga0070659_100017826
315 Ga0070659_100064984
316 Ga0070659_100176379
317 Ga0070667_100028758
318 Ga0070667_100121277
319 Ga0070714_100056770
320 Ga0070714_100243097
321 Ga0070694_100013248
322 Ga0070662_100001023
323 Ga0070681_10019232
324 Ga0070681_10056998
325 Ga0070706_100000881
326 Ga0070706_100113489
327 Ga0070706_100214435
328 Ga0070698_100004172
329 Ga0070698_100059429
330 Ga0070699_100128953
331 Ga0070684_100002373
332 Ga0070684_100034616
333 Ga0068853_100002834
334 Ga0070696_100007519
335 Ga0070704_100011006
336 Ga0068855_100122698
337 Ga0068857_100005235
338 Ga0068857_100123294
339 Ga0068854_100005034
340 Ga0068856_100016677
341 Ga0068856_100024850
342 Ga0068856_100289966
343 Ga0068852_100000691
344 Ga0068859_100038372
345 Ga0068859_100119463
346 Ga0068858_100066237
347 Ga0068860_100070567
348 Ga0081455_10072617
349 Ga0097621_100245337
350 Ga0068871_100054175
351 Ga0075428_100000724
352 Ga0075428_100015080
353 Ga0075428_100020889
354 Ga0075428_100244538
355 Ga0075430_100000005
356 Ga0075430_100050368
357 Ga0075431_100000188
358 Ga0075431_100083321
359 Ga0075431_100097697
360 Ga0075433_10086072
361 Ga0075429_100000077
362 Ga0097620_100038372
363 Ga0097620_100119476
364 Ga0105240_10005422
365 Ga0105240_10023780
366 Ga0111539_10000225
367 Ga0114129_10009728
368 Ga0114129_10044233
369 Ga0114129_10126213
370 Ga0114129_10557069
371 Ga0105241_10155644
372 Ga0105248_10150174
373 Ga0105237_10056543
374 Ga0105246_10081810
375 Ga0157373_10003366
376 Ga0157371_10015947
377 Ga0157371_10085341
378 Ga0157370_10001129
379 Ga0157370_10008585
380 Ga0157370_10044231
381 Ga0157369_10079562
382 Ga0157369_10422810
383 Ga0157372_10038097
384 Ga0157375_10002721
385 Ga0163161_10041965
386 Ga0206356_10069298
387 Ga0206354_10827474
388 Ga0213876_10008014
389 Ga0207697_10049499
390 Ga0207642_10015354
391 Ga0207647_10000429
392 Ga0207647_10000595
393 Ga0207647_10081077
394 Ga0207645_10139022
395 Ga0207705_10094242
396 Ga0207684_10129067
397 Ga0207707_10060394
398 Ga0207695_10105972
399 Ga0207660_10002244
400 Ga0207660_10037172
401 Ga0207660_10113249
402 Ga0207657_10001587
403 Ga0207657_10007286
404 Ga0207657_10007347
405 Ga0207657_10010348
406 Ga0207657_10011885
407 Ga0207657_10075755
408 Ga0207657_10139508
409 Ga0207649_10003670
410 Ga0207649_10124071
411 Ga0207652_10041511
412 Ga0207652_10117782
413 Ga0207681_10061757
414 Ga0207650_10049142
415 Ga0207664_10039514
416 Ga0207664_10179914
417 Ga0207690_10002257
418 Ga0207690_10002893
419 Ga0207690_10024292
420 Ga0207690_10044670
421 Ga0207690_10090572
422 Ga0207690_10176425
423 Ga0207690_10227643
424 Ga0207706_10000378
425 Ga0207706_10006666
426 Ga0207706_10113371
427 Ga0207689_10049451
428 Ga0207661_10015747
429 Ga0207661_10018654
430 Ga0207679_10058191
431 Ga0207679_10280517
432 Ga0207667_10023306
433 Ga0207667_10027008
434 Ga0207667_10058558
435 Ga0207667_10179097
436 Ga0207667_10367205
437 Ga0207651_10208127
438 Ga0207658_10015867
439 Ga0207658_10138430
440 Ga0207658_10210635
441 Ga0207677_10051820
442 Ga0207703_10005590
443 Ga0207639_10087528
444 Ga0207639_10132623
445 Ga0207678_10018512
446 Ga0207678_10021168
447 Ga0207678_10103166
448 Ga0207702_10031062
449 Ga0207702_10130718
450 Ga0207648_10017487
451 Ga0207648_10076916
452 Ga0207674_10001045
453 Ga0207674_10010980
454 Ga0207674_10032615
455 Ga0207674_10178364
456 Ga0207675_100082288
457 Ga0207683_10008132
458 Ga0207698_10002094
459 Ga0209974_10000170
460 Ga0207428_10076539
461 Ga0268265_10125170
462 Ga0268265_10204538
463 Ga0268264_10031955
464 Ga0307408_100034094
465 Ga0307408_100044302
466 Ga0307405_10109071
467 Ga0307413_10070897
468 Ga0307410_10059611
469 Ga0307407_10023434
470 Ga0307407_10052269
471 Ga0307412_10006861
472 Ga0307412_10034250
473 Ga0307409_100059520
474 Ga0307409_100076538
475 Ga0307409_100096147
476 Ga0307416_100004257
477 Ga0307416_100086249
478 Ga0307416_100223917
479 Ga0307414_10160710
480 Ga0307411_10010870
481 Ga0307411_10167161
482 Ga0307415_100089401
483 Ga0307415_100100813
484 Ga0373943_0003479
485 Ga0373931_0004693
486 Ga0373935_0048770
487 Ga0373925_0009605
488 Ga0395899_0004663
489 Ga0395899_0024337
490 Ga0395899_0028259
491 Ga0395899_0097689
492 Ga0395900_0007276
493 Ga0395900_0013525
494 Ga0395900_0013743
495 Ga0395900_0013981
496 Ga0395900_0031245
497 Ga0395900_0227401
498 Ga0395900_0309104
499 Ga0395900_0368048
500 Ga0395898_0036094
501 Ga0395898_0058842
502 Ga0395898_0257610
503 Ga0395905_0003412
504 Ga0395905_0005762
505 Ga0395905_0013020
506 Ga0395905_0018147
507 Ga0395905_0037710
508 Ga0395905_0067490
509 Ga0395905_0076046
510 Ga0395905_0115055
511 Ga0395905_0131321
512 Ga0395905_0197523
513 Ga0395905_0231520
514 Ga0395901_0010989
515 Ga0395901_0039131
516 Ga0395901_0072747
517 Ga0395901_0101227
518 Ga0395901_0178289
519 Ga0395901_0239792
520 Ga0395901_0241866
521 Ga0395901_0298810
522 Ga0395901_0451530
523 Ga0436365_0503355
524 Ga0436362_1094259
525 Ga0466961_0029639
526 Ga0466961_0044822
527 Ga0466963_0002442
528 Ga0466963_0004930
529 Ga0466963_0042376
530 Ga0466957_0014614
531 Ga0466957_0026925
532 Ga0466959_0028108
533 Ga0466958_0052622
534 Ga0466967_0003430
535 Ga0466967_0032441
536 Ga0466967_0061765
537 Ga0466967_0310805
538 Ga0466967_0338743
539 Ga0495668_0072611
540 Ga0495669_0008239
541 Ga0495669_0077513
542 Ga0496102_0008643
543 Ga0496107_0033421
544 Ga0496111_0062983
545 Ga0496112_0071028
546 Ga0501033_0199479
547 Ga0501036_0080249
548 Ga0501038_0009368
549 Ga0501042_0049001
550 Ga0501070_0196117
551 Ga0501071_0025574
552 Ga0501074_0019876
553 Ga0501075_0037842
554 Ga0501075_0052403
555 Ga0501075_0104207
556 Ga0501076_0085588
557 Ga0501079_0035723
558 Ga0501079_0135078
559 Ga0501080_0234937
560 Ga0501035_0061402
561 Ga0501045_0000568
562 nmdc:mga05p37_6423_c1
563 nmdc:mga09592_375_c1
564 nmdc:mga0qj67_379_c1
565 nmdc:mga06r32_1305_c1
566 nmdc:mga08y16_15825_c1
567 nmdc:mga0n895_113381_c1
568 nmdc:mga0a205_1107_c1
569 Ga0495612_0035178
570 Ga0500658_0000081
571 Ga0501084_0042216
572 Ga0501082_0003861
573 Ga0466962_0106678
574 2885428852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

73

380

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cgq-assembly1.cif.gz_B-2 threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.9208 51 374
2c2b-assembly2.cif.gz_C crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine 0.887 1 374
1o58-assembly1.cif.gz_B crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.8817 76 375
2zsj-assembly2.cif.gz_D crystal structure of threonine synthase from aquifex aeolicus vf5 0.8785 51 374
6cgq-assembly1.cif.gz_A threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.8752 54 386
ID Description Score Start End Superfamily
af_A0A1D6M0B0_306_515_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9529 210 372 3.40.50.1100
4d9gB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9194 120 193 3.40.50.1100
af_Q9SSP5_269_516_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9051 172 366 3.40.50.1100
3x44B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9003 103 194 3.40.50.1100
2jc3H02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9003 103 196 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A535BMY9-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9931 211 318
AF-A0A535BMY9-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9841 211 318
AF-A0A7G9KZE0-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9838 1 393 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009097
GO:0030170
AF-A0A1F4XAE0-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9835 266 368
AF-A0A7G9KZE0-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9789 1 393 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009097
GO:0030170

Map