F388243

General Info

Members Datasets Scaffolds Average Seq Length
287 211 270 138

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0265066|Ga0501040_0265066_278_760
Length 160
Sequence MAVIVRRQDRGKDSRVRGQRQGFIMRFMIIVKATPDTEAGKRADEELFHDMVACHEEMAKAGVLLGGSGLQPSAKGWRIKHDGNKRIVVDGPFAETKELIAGYTIIQTKSREEAVEWSKRFPNPMGRRERCEIEVRQLYELEDLGGPSTVIERFRDIGIG

Samples

Sample ID Description Type Environment
1 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
2 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
3 2643221570 Acidovorax sp. Root568 Isolate Unclassified
4 2643221652 Acidovorax sp. Root402 Isolate Unclassified
5 2738543024 Aminobacter sp. AP02 Isolate Unclassified
6 2818991452 Burkholderia cepacia 561 Isolate Unclassified
7 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
8 2904564687 Burkholderia sp. 571 Isolate Unclassified
9 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
10 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
11 2928170801 Burkholderia sp. 572 Isolate Unclassified
12 2928536128 Burkholderia sola 565 Isolate Unclassified
13 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
209 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
210 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
211 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.38
Metatranscriptomes 0.7
Isolates 5.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0.35
Rhizoplane 9.41
Rhizosphere 81.88
Stem 0
Stem Tuber 0
Unclassified 8.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001746 3300003203 Bacteria 10222
2 rootH2_10010424 3300003320 Bacteria 7105
3 rootH1_10135344 3300003323 Bacteria 4907
4 rootH1_10285178 3300003323 Bacteria 2697
5 Ga0058859_11241233 3300004798 Bacteria 707
6 Ga0065712_10417691 3300005290 Bacteria 715
7 Ga0070690_100015203 3300005330 Bacteria 4586
8 Ga0070670_100034863 3300005331 Bacteria 4331
9 Ga0070670_100387076 3300005331 Bacteria 1233
10 Ga0068869_100185930 3300005334 Bacteria 1631
11 Ga0068869_100341896 3300005334 Bacteria 1218
12 Ga0070666_10004938 3300005335 Bacteria 8159
13 Ga0070680_100917119 3300005336 Bacteria 756
14 Ga0070689_100103965 3300005340 Bacteria 2251
15 Ga0070689_101182995 3300005340 Bacteria 686
16 Ga0070661_100015991 3300005344 Bacteria 5297
17 Ga0070661_100834241 3300005344 Bacteria 758
18 Ga0070671_100014094 3300005355 Bacteria 6454
19 Ga0070671_101061578 3300005355 Bacteria 711
20 Ga0070674_100057237 3300005356 Bacteria 2706
21 Ga0070673_100214337 3300005364 Bacteria 1664
22 Ga0070673_100322156 3300005364 Bacteria 1365
23 Ga0070659_100497221 3300005366 Bacteria 1039
24 Ga0070667_100030162 3300005367 Bacteria 4522
25 Ga0070667_100273539 3300005367 Bacteria 1515
26 Ga0070709_10746082 3300005434 Bacteria 765
27 Ga0070711_100117831 3300005439 Bacteria 1959
28 Ga0070711_100262722 3300005439 Bacteria 1359
29 Ga0070705_100090165 3300005440 Bacteria 1908
30 Ga0070700_100239002 3300005441 Bacteria 1297
31 Ga0070694_100175462 3300005444 Bacteria 1582
32 Ga0070663_101640461 3300005455 Bacteria 574
33 Ga0070662_100006550 3300005457 Bacteria 7512
34 Ga0070662_100527943 3300005457 Bacteria 987
35 Ga0070685_10207587 3300005466 Bacteria 1277
36 Ga0070706_100085736 3300005467 Bacteria 2918
37 Ga0070707_100940970 3300005468 Bacteria 829
38 Ga0070699_100178927 3300005518 Bacteria 1881
39 Ga0070684_100048498 3300005535 Bacteria 3685
40 Ga0070672_100198037 3300005543 Bacteria 1679
41 Ga0070695_100040396 3300005545 Bacteria 2953
42 Ga0070665_100079166 3300005548 Bacteria 3292
43 Ga0070665_100627564 3300005548 Bacteria 1088
44 Ga0070665_101397804 3300005548 Bacteria 709
45 Ga0068854_100632719 3300005578 Bacteria 917
46 Ga0068856_101032398 3300005614 Bacteria 840
47 Ga0070702_100007342 3300005615 Bacteria 5272
48 Ga0070702_100144204 3300005615 Bacteria 1521
49 Ga0068852_100270231 3300005616 Bacteria 1636
50 Ga0068852_101734933 3300005616 Bacteria 647
51 Ga0068859_100065334 3300005617 Bacteria 3673
52 Ga0068859_100854881 3300005617 Bacteria 996
53 Ga0068864_100052778 3300005618 Bacteria 3505
54 Ga0068861_100366178 3300005719 Bacteria 1269
55 Ga0068851_10038257 3300005834 Bacteria 2406
56 Ga0068858_100023518 3300005842 Bacteria 5739
57 Ga0068858_100212696 3300005842 Bacteria 1830
58 Ga0081539_10000167 3300005985 Bacteria 153726
59 Ga0075432_10152738 3300006058 Bacteria 888
60 Ga0075432_10219979 3300006058 Bacteria 759
61 Ga0070712_100815795 3300006175 Bacteria 801
62 Ga0097621_100252189 3300006237 Bacteria 1545
63 Ga0097621_100468661 3300006237 Bacteria 1137
64 Ga0068871_100069526 3300006358 Bacteria 2892
65 Ga0068871_101836875 3300006358 Bacteria 576
66 Ga0075431_100219784 3300006847 Unclassified 1938
67 Ga0075433_10006639 3300006852 Bacteria 9161
68 Ga0075433_10107975 3300006852 Bacteria 2468
69 Ga0075434_100003017 3300006871 Bacteria 14963
70 Ga0075434_100007530 3300006871 Bacteria 10082
71 Ga0075434_102146331 3300006871 Bacteria 563
72 Ga0075429_100282639 3300006880 Unclassified 1453
73 Ga0068865_100019421 3300006881 Bacteria 4398
74 Ga0075436_100008227 3300006914 Bacteria 7138
75 Ga0075436_101100866 3300006914 Bacteria 598
76 Ga0097620_100065333 3300006931 Bacteria 3673
77 Ga0097620_100854922 3300006931 Bacteria 996
78 Ga0075435_100036442 3300007076 Bacteria 3909
79 Ga0105240_10093384 3300009093 Bacteria 3672
80 Ga0111539_10059869 3300009094 Bacteria 4515
81 Ga0111539_10875863 3300009094 Bacteria 1045
82 Ga0105245_10037616 3300009098 Bacteria 4303
83 Ga0105247_10002393 3300009101 Bacteria 12748
84 Ga0105247_10004306 3300009101 Bacteria 9102
85 Ga0114129_10095768 3300009147 Bacteria 4111
86 Ga0114129_10357639 3300009147 Bacteria 1933
87 Ga0105243_10025442 3300009148 Bacteria 4523
88 Ga0105243_10142336 3300009148 Bacteria 2048
89 Ga0105248_10019344 3300009177 Bacteria 7534
90 Ga0105248_10033222 3300009177 Bacteria 5762
91 Ga0105238_10189192 3300009551 Bacteria 2035
92 Ga0105238_10588074 3300009551 Bacteria 1120
93 Ga0105239_10132715 3300010375 Bacteria 2771
94 Ga0105239_11521855 3300010375 Bacteria 773
95 Ga0105246_10087486 3300011119 Bacteria 2237
96 Ga0105246_10386918 3300011119 Bacteria 1157
97 Ga0157378_10105546 3300013297 Bacteria 2576
98 Ga0157378_10123626 3300013297 Bacteria 2388
99 Ga0163162_10115316 3300013306 Bacteria 2786
100 Ga0157375_10003490 3300013308 Bacteria 13634
101 Ga0157375_10028720 3300013308 Bacteria 5219
102 Ga0163163_10004561 3300014325 Bacteria 11831
103 Ga0157377_10855673 3300014745 Bacteria 676
104 Ga0157379_10024045 3300014968 Bacteria 5407
105 Ga0157379_10197682 3300014968 Bacteria 1817
106 Ga0157376_10002865 3300014969 Bacteria 11811
107 Ga0213872_10040906 3300021361 Bacteria 2115
108 Ga0207710_10008841 3300025900 Bacteria 4241
109 Ga0207710_10008886 3300025900 Bacteria 4227
110 Ga0207680_10357072 3300025903 Bacteria 1027
111 Ga0207699_10228511 3300025906 Bacteria 1273
112 Ga0207684_10038443 3300025910 Bacteria 4060
113 Ga0207654_10713896 3300025911 Bacteria 721
114 Ga0207695_10066569 3300025913 Bacteria 3699
115 Ga0207693_10639590 3300025915 Bacteria 827
116 Ga0207663_10087994 3300025916 Bacteria 2053
117 Ga0207663_10550467 3300025916 Bacteria 902
118 Ga0207649_10098308 3300025920 Bacteria 1931
119 Ga0207650_10145151 3300025925 Bacteria 1868
120 Ga0207700_10053341 3300025928 Bacteria 3029
121 Ga0207644_10645930 3300025931 Bacteria 880
122 Ga0207644_10725556 3300025931 Bacteria 829
123 Ga0207690_10581347 3300025932 Bacteria 913
124 Ga0207706_10001797 3300025933 Bacteria 21093
125 Ga0207709_10079285 3300025935 Bacteria 2111
126 Ga0207709_10338045 3300025935 Bacteria 1132
127 Ga0207670_10909656 3300025936 Bacteria 737
128 Ga0207704_10003444 3300025938 Bacteria 7191
129 Ga0207665_10049704 3300025939 Bacteria 2818
130 Ga0207711_10003107 3300025941 Bacteria 14477
131 Ga0207711_10019960 3300025941 Bacteria 5585
132 Ga0207679_10403248 3300025945 Bacteria 1203
133 Ga0207651_10653364 3300025960 Bacteria 923
134 Ga0207712_10705296 3300025961 Bacteria 881
135 Ga0207668_10115559 3300025972 Bacteria 2022
136 Ga0207668_10942315 3300025972 Bacteria 770
137 Ga0207658_10180230 3300025986 Bacteria 1748
138 Ga0207677_10172119 3300026023 Bacteria 1694
139 Ga0207703_10041833 3300026035 Bacteria 3674
140 Ga0207703_10076632 3300026035 Bacteria 2774
141 Ga0207703_11086196 3300026035 Bacteria 768
142 Ga0207678_10720657 3300026067 Bacteria 878
143 Ga0207702_10320483 3300026078 Bacteria 1476
144 Ga0207676_10051035 3300026095 Bacteria 3227
145 Ga0207675_100517347 3300026118 Bacteria 1189
146 Ga0207683_10389871 3300026121 Bacteria 1281
147 Ga0207698_10318346 3300026142 Bacteria 1456
148 Ga0207698_10603921 3300026142 Bacteria 1082
149 Ga0207698_11904822 3300026142 Bacteria 609
150 Ga0209970_1000173 3300027614 Bacteria 10142
151 Ga0207428_10263585 3300027907 Bacteria 1283
152 Ga0268266_10170851 3300028379 Bacteria 1973
153 Ga0268266_10187441 3300028379 Bacteria 1887
154 Ga0268264_10225804 3300028381 Bacteria 1726
155 Ga0268264_10306941 3300028381 Bacteria 1496
156 Ga0265334_10001877 3300028573 Bacteria 9974
157 Ga0307515_10000284 3300028794 Bacteria 124800
158 Ga0307515_10033526 3300028794 Bacteria 8446
159 Ga0265327_10000419 3300031251 Bacteria 77672
160 Ga0307513_10151776 3300031456 Bacteria 2224
161 Ga0307509_10170432 3300031507 Bacteria 2057
162 Ga0307408_100388244 3300031548 Bacteria 1195
163 Ga0307516_10000116 3300031730 Bacteria 92895
164 Ga0307409_100961853 3300031995 Bacteria 870
165 Ga0307414_11454053 3300032004 Bacteria 637
166 Ga0373952_0091623 3300035092 Bacteria 790
167 Ga0373941_0068891 3300035115 Bacteria 1170
168 Ga0373960_0130934 3300035121 Bacteria 841
169 Ga0373931_0178867 3300035691 Bacteria 1255
170 Ga0395899_0000031 3300037312 Bacteria 322356
171 Ga0395899_0007170 3300037312 Bacteria 8630
172 Ga0395900_0000110 3300037418 Bacteria 145544
173 Ga0395900_0019316 3300037418 Bacteria 6951
174 Ga0395900_0604870 3300037418 Bacteria 1036
175 Ga0395900_0788307 3300037418 Bacteria 879
176 Ga0395898_0000040 3300037466 Bacteria 317329
177 Ga0395898_0011122 3300037466 Bacteria 9370
178 Ga0395905_0382445 3300037471 Bacteria 1301
179 Ga0395905_0785637 3300037471 Bacteria 855
180 Ga0395901_0000113 3300038443 Bacteria 110398
181 Ga0395901_0000558 3300038443 Bacteria 43141
182 Ga0436361_1002899 3300039447 Bacteria 2649
183 Ga0436361_1159595 3300039447 Unclassified 845
184 Ga0451793_0416430 3300041452 Bacteria 1176
185 Ga0451795_0964804 3300041456 Bacteria 689
186 Ga0451577_0009013 3300042876 Bacteria 9635
187 Ga0439440_0006871 3300042993 Bacteria 2302
188 Ga0466969_0007401 3300044656 Bacteria 5834
189 Ga0466972_0077873 3300044658 Bacteria 1579
190 Ga0453683_0131771 3300044673 Bacteria 1576
191 Ga0466965_0037924 3300044683 Bacteria 2366
192 Ga0466966_0011771 3300044684 Bacteria 5796
193 Ga0466961_0094830 3300044693 Bacteria 1882
194 Ga0466961_0213583 3300044693 Bacteria 1190
195 Ga0466963_0205968 3300044694 Bacteria 1376
196 Ga0466964_0014602 3300044706 Bacteria 2986
197 Ga0466957_0004203 3300044842 Bacteria 7984
198 Ga0451576_0161323 3300045051 Bacteria 2340
199 Ga0451576_0674137 3300045051 Bacteria 1086
200 Ga0451576_0769061 3300045051 Bacteria 1012
201 Ga0466958_0047958 3300045836 Bacteria 2579
202 Ga0495590_0071955 3300046457 Bacteria 1214
203 Ga0495643_0391028 3300046522 Bacteria 615
204 Ga0495621_0045571 3300046539 Bacteria 1554
205 Ga0495634_0241400 3300046642 Bacteria 1108
206 Ga0495658_0312718 3300046683 Unclassified 995
207 Ga0495649_0409495 3300046694 Bacteria 680
208 Ga0495674_0219772 3300047319 Bacteria 1571
209 Ga0495672_0002937 3300047320 Bacteria 15044
210 Ga0495676_0537442 3300047321 Unclassified 765
211 Ga0495686_0002611 3300047472 Bacteria 16704
212 Ga0496100_0007141 3300048903 Bacteria 6135
213 Ga0496101_0008414 3300048904 Bacteria 6740
214 Ga0496102_0156871 3300048905 Bacteria 2140
215 Ga0496103_0206409 3300048906 Bacteria 1264
216 Ga0496103_0747668 3300048906 Bacteria 618
217 Ga0496104_0005572 3300048907 Bacteria 11024
218 Ga0496105_0003211 3300048908 Bacteria 12037
219 Ga0496105_0165605 3300048908 Bacteria 1814
220 Ga0496106_0002685 3300048909 Bacteria 13218
221 Ga0496107_0070404 3300048910 Bacteria 2539
222 Ga0496108_0115838 3300048911 Bacteria 2295
223 Ga0496109_0084461 3300048912 Bacteria 2929
224 Ga0496109_1693491 3300048912 Bacteria 566
225 Ga0496110_0030100 3300048913 Bacteria 4678
226 Ga0496110_0520733 3300048913 Bacteria 1082
227 Ga0496111_0377350 3300048914 Bacteria 1049
228 Ga0496112_0084285 3300048915 Bacteria 3143
229 Ga0496112_0142852 3300048915 Bacteria 2362
230 Ga0496112_0624567 3300048915 Bacteria 1008
231 Ga0496113_0390025 3300048916 Bacteria 1118
232 Ga0496114_0003394 3300048917 Bacteria 12233
233 Ga0496114_0014686 3300048917 Bacteria 6293
234 Ga0496115_0002484 3300048918 Bacteria 13253
235 Ga0496115_0502454 3300048918 Unclassified 974
236 Ga0496117_0002840 3300048920 Bacteria 21073
237 Ga0496118_0004010 3300048921 Bacteria 17914
238 Ga0496121_0098073 3300048924 Bacteria 2269
239 Ga0496126_0000232 3300048929 Bacteria 120250
240 Ga0496126_0022006 3300048929 Bacteria 6214
241 Ga0501304_012948 3300049160 Bacteria 757
242 Ga0501036_0650850 3300049572 Bacteria 872
243 Ga0501039_0222395 3300049575 Bacteria 1484
244 Ga0501039_0795095 3300049575 Bacteria 738
245 Ga0501040_0265066 3300049576 Bacteria 1226
246 Ga0501040_0550116 3300049576 Bacteria 833
247 Ga0501071_0895577 3300049587 Bacteria 685
248 Ga0501074_0363359 3300049590 Bacteria 1027
249 Ga0501075_0168199 3300049591 Bacteria 1672
250 Ga0501077_0002939 3300049593 Bacteria 10225
251 Ga0501077_0756641 3300049593 Bacteria 625
252 Ga0501222_005059 3300049662 Bacteria 1786
253 Ga0501080_0233746 3300049742 Bacteria 1680
254 Ga0501081_1384135 3300049743 Bacteria 534
255 Ga0501083_0015033 3300049744 Bacteria 5417
256 nmdc:mga07m45_63281_c1 3300050496 Bacteria 2098
257 nmdc:mga05p37_1432570_c1 3300050507 Bacteria 693
258 nmdc:mga05p37_194485_c1 3300050507 Bacteria 2460
259 nmdc:mga09592_90051_c1 3300050508 Bacteria 2621
260 nmdc:mga0qj67_783287_c1 3300050509 Bacteria 755
261 nmdc:mga06r32_364855_c1 3300050510 Unclassified 1428
262 nmdc:mga08y16_299085_c1 3300050511 Bacteria 1659
263 nmdc:mga0n895_1064682_c1 3300050512 Bacteria 787
264 nmdc:mga0n895_108467_c1 3300050512 Bacteria 2791
265 nmdc:mga0n895_1251684_c1 3300050512 Bacteria 714
266 nmdc:mga0n895_27726_c1 3300050512 Bacteria 5384
267 nmdc:mga08x19_955841_c1 3300050514 Bacteria 609
268 nmdc:mga0a205_23937_c1 3300050515 Bacteria 5797
269 nmdc:mga0a205_6049_c1 3300050515 Bacteria 10918
270 Ga0501084_1190464 3300054114 Bacteria 639

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0409495 Ga0495649_0409495_177_593 123
2 3300046539 Ga0495621_0045571 Ga0495621_0045571_739_1134 128
3 iso_pu_bacteria 2643221570 2643864334 129
4 iso_pu_bacteria 2643221652 2644291971 129
5 iso_pu_bacteria 2990710928 2990714928 129
6 3300049590 Ga0501074_0363359 Ga0501074_0363359_573_974 130
7 3300049742 Ga0501080_0233746 Ga0501080_0233746_827_1228 130
8 3300049743 Ga0501081_1384135 Ga0501081_1384135_88_489 130
9 3300050509 nmdc:mga0qj67_783287_c1 nmdc:mga0qj67_783287_c1_343_744 130
10 3300025972 Ga0207668_10942315 Ga0207668_109423152 131
11 3300027614 Ga0209970_1000173 Ga0209970_10001738 131
12 3300044673 Ga0453683_0131771 Ga0453683_0131771_157_558 131
13 3300047320 Ga0495672_0002937 Ga0495672_0002937_8570_8983 131
14 iso_pu_bacteria 2515154123 2515688052 131
15 iso_pu_bacteria 2919704043 2919706824 131
16 3300005455 Ga0070663_101640461 Ga0070663_1016404611 132
17 3300005467 Ga0070706_100085736 Ga0070706_1000857363 132
18 3300025910 Ga0207684_10038443 Ga0207684_100384434 132
19 3300048924 Ga0496121_0098073 Ga0496121_0098073_1737_2141 132
20 3300050496 nmdc:mga07m45_63281_c1 nmdc:mga07m45_63281_c1_282_686 132
21 iso_pu_bacteria 2599185239 2599735539 132
22 iso_pu_bacteria 2738543024 2739308945 132
23 iso_pu_bacteria 2818991452 2819630434 132
24 iso_pu_bacteria 2863421361 2863428012 132
25 iso_pu_bacteria 2904564687 2904565474 132
26 iso_pu_bacteria 2904571731 2904571830 132
27 iso_pu_bacteria 2928170801 2928174206 132
28 iso_pu_bacteria 2928536128 2928537146 132
29 iso_pu_bacteria 8018845410 8018848898 132
30 iso_pu_bacteria 8020938398 8020941616 132
31 iso_pu_bacteria 8020953355 8020955595 132
32 iso_pu_bacteria 8021120328 8021121029 132
33 3300005548 Ga0070665_101397804 Ga0070665_1013978041 133
34 3300005614 Ga0068856_101032398 Ga0068856_1010323981 133
35 3300009148 Ga0105243_10142336 Ga0105243_101423362 133
36 3300011119 Ga0105246_10087486 Ga0105246_100874863 133
37 3300013297 Ga0157378_10105546 Ga0157378_101055463 133
38 3300013308 Ga0157375_10028720 Ga0157375_100287205 133
39 3300039447 Ga0436361_1159595 Ga0436361_1159595_397_804 133
40 3300045051 Ga0451576_0769061 Ga0451576_0769061_509_916 133
41 3300046642 Ga0495634_0241400 Ga0495634_0241400_467_874 133
42 3300046683 Ga0495658_0312718 Ga0495658_0312718_81_488 133
43 3300047319 Ga0495674_0219772 Ga0495674_0219772_404_811 133
44 3300047321 Ga0495676_0537442 Ga0495676_0537442_39_446 133
45 3300048908 Ga0496105_0165605 Ga0496105_0165605_881_1288 133
46 3300048917 Ga0496114_0014686 Ga0496114_0014686_5187_5594 133
47 3300048918 Ga0496115_0502454 Ga0496115_0502454_149_556 133
48 3300049576 Ga0501040_0265066 Ga0501040_0265066_278_760 133
49 3300050508 nmdc:mga09592_90051_c1 nmdc:mga09592_90051_c1_2063_2470 133
50 3300050510 nmdc:mga06r32_364855_c1 nmdc:mga06r32_364855_c1_901_1308 133
51 3300003323 rootH1_10285178 rootH1_102851782 134
52 3300004798 Ga0058859_11241233 Ga0058859_112412331 134
53 3300005334 Ga0068869_100341896 Ga0068869_1003418962 134
54 3300005336 Ga0070680_100917119 Ga0070680_1009171192 134
55 3300005340 Ga0070689_101182995 Ga0070689_1011829952 134
56 3300005344 Ga0070661_100834241 Ga0070661_1008342411 134
57 3300005355 Ga0070671_101061578 Ga0070671_1010615782 134
58 3300005356 Ga0070674_100057237 Ga0070674_1000572372 134
59 3300005364 Ga0070673_100214337 Ga0070673_1002143372 134
60 3300005366 Ga0070659_100497221 Ga0070659_1004972212 134
61 3300005367 Ga0070667_100273539 Ga0070667_1002735393 134
62 3300005439 Ga0070711_100117831 Ga0070711_1001178313 134
63 3300005441 Ga0070700_100239002 Ga0070700_1002390023 134
64 3300005457 Ga0070662_100527943 Ga0070662_1005279432 134
65 3300005466 Ga0070685_10207587 Ga0070685_102075872 134
66 3300005548 Ga0070665_100627564 Ga0070665_1006275641 134
67 3300005615 Ga0070702_100144204 Ga0070702_1001442042 134
68 3300005616 Ga0068852_101734933 Ga0068852_1017349331 134
69 3300005617 Ga0068859_100854881 Ga0068859_1008548812 134
70 3300005719 Ga0068861_100366178 Ga0068861_1003661782 134
71 3300005842 Ga0068858_100212696 Ga0068858_1002126963 134
72 3300006175 Ga0070712_100815795 Ga0070712_1008157952 134
73 3300006881 Ga0068865_100019421 Ga0068865_1000194212 134
74 3300006931 Ga0097620_100854922 Ga0097620_1008549222 134
75 3300009101 Ga0105247_10004306 Ga0105247_100043065 134
76 3300009148 Ga0105243_10025442 Ga0105243_100254423 134
77 3300009177 Ga0105248_10033222 Ga0105248_100332222 134
78 3300009551 Ga0105238_10588074 Ga0105238_105880741 134
79 3300010375 Ga0105239_11521855 Ga0105239_115218551 134
80 3300011119 Ga0105246_10386918 Ga0105246_103869182 134
81 3300013297 Ga0157378_10123626 Ga0157378_101236264 134
82 3300013308 Ga0157375_10003490 Ga0157375_1000349015 134
83 3300014745 Ga0157377_10855673 Ga0157377_108556732 134
84 3300014968 Ga0157379_10024045 Ga0157379_100240453 134
85 3300014969 Ga0157376_10002865 Ga0157376_1000286511 134
86 3300025900 Ga0207710_10008886 Ga0207710_100088863 134
87 3300025916 Ga0207663_10087994 Ga0207663_100879943 134
88 3300025931 Ga0207644_10725556 Ga0207644_107255562 134
89 3300025932 Ga0207690_10581347 Ga0207690_105813472 134
90 3300025935 Ga0207709_10079285 Ga0207709_100792852 134
91 3300025936 Ga0207670_10909656 Ga0207670_109096562 134
92 3300025938 Ga0207704_10003444 Ga0207704_100034446 134
93 3300025941 Ga0207711_10019960 Ga0207711_100199601 134
94 3300025960 Ga0207651_10653364 Ga0207651_106533642 134
95 3300025986 Ga0207658_10180230 Ga0207658_101802301 134
96 3300026035 Ga0207703_10076632 Ga0207703_100766322 134
97 3300026035 Ga0207703_11086196 Ga0207703_110861962 134
98 3300026067 Ga0207678_10720657 Ga0207678_107206572 134
99 3300026078 Ga0207702_10320483 Ga0207702_103204833 134
100 3300026118 Ga0207675_100517347 Ga0207675_1005173472 134
101 3300026121 Ga0207683_10389871 Ga0207683_103898712 134
102 3300026142 Ga0207698_10603921 Ga0207698_106039212 134
103 3300026142 Ga0207698_11904822 Ga0207698_119048222 134
104 3300028379 Ga0268266_10170851 Ga0268266_101708512 134
105 3300028381 Ga0268264_10306941 Ga0268264_103069411 134
106 3300028794 Ga0307515_10000284 Ga0307515_1000028440 134
107 3300031548 Ga0307408_100388244 Ga0307408_1003882442 134
108 3300031995 Ga0307409_100961853 Ga0307409_1009618532 134
109 3300037418 Ga0395900_0788307 Ga0395900_0788307_170_580 134
110 3300037471 Ga0395905_0382445 Ga0395905_0382445_277_687 134
111 3300037471 Ga0395905_0785637 Ga0395905_0785637_109_519 134
112 3300041456 Ga0451795_0964804 Ga0451795_0964804_42_452 134
113 3300046457 Ga0495590_0071955 Ga0495590_0071955_213_623 134
114 3300048903 Ga0496100_0007141 Ga0496100_0007141_3485_3895 134
115 3300048904 Ga0496101_0008414 Ga0496101_0008414_4210_4620 134
116 3300048906 Ga0496103_0206409 Ga0496103_0206409_286_696 134
117 3300048907 Ga0496104_0005572 Ga0496104_0005572_9457_9867 134
118 3300048908 Ga0496105_0003211 Ga0496105_0003211_8659_9069 134
119 3300048909 Ga0496106_0002685 Ga0496106_0002685_8003_8413 134
120 3300048910 Ga0496107_0070404 Ga0496107_0070404_1960_2370 134
121 3300048911 Ga0496108_0115838 Ga0496108_0115838_944_1354 134
122 3300048912 Ga0496109_0084461 Ga0496109_0084461_25_435 134
123 3300048913 Ga0496110_0030100 Ga0496110_0030100_2679_3089 134
124 3300048914 Ga0496111_0377350 Ga0496111_0377350_340_750 134
125 3300048915 Ga0496112_0142852 Ga0496112_0142852_328_738 134
126 3300048915 Ga0496112_0624567 Ga0496112_0624567_477_887 134
127 3300048916 Ga0496113_0390025 Ga0496113_0390025_101_511 134
128 3300048917 Ga0496114_0003394 Ga0496114_0003394_8327_8737 134
129 3300048918 Ga0496115_0002484 Ga0496115_0002484_8810_9220 134
130 3300003320 rootH2_10010424 rootH2_100104245 135
131 3300003323 rootH1_10135344 rootH1_101353445 135
132 3300005334 Ga0068869_100185930 Ga0068869_1001859302 135
133 3300005440 Ga0070705_100090165 Ga0070705_1000901653 135
134 3300005444 Ga0070694_100175462 Ga0070694_1001754623 135
135 3300005457 Ga0070662_100006550 Ga0070662_1000065504 135
136 3300005468 Ga0070707_100940970 Ga0070707_1009409702 135
137 3300005518 Ga0070699_100178927 Ga0070699_1001789273 135
138 3300005545 Ga0070695_100040396 Ga0070695_1000403963 135
139 3300005616 Ga0068852_100270231 Ga0068852_1002702313 135
140 3300007076 Ga0075435_100036442 Ga0075435_1000364424 135
141 3300009147 Ga0114129_10357639 Ga0114129_103576392 135
142 3300025933 Ga0207706_10001797 Ga0207706_100017974 135
143 3300028794 Ga0307515_10033526 Ga0307515_100335266 135
144 3300031456 Ga0307513_10151776 Ga0307513_101517763 135
145 3300031730 Ga0307516_10000116 Ga0307516_1000011620 135
146 3300032004 Ga0307414_11454053 Ga0307414_114540531 135
147 3300037312 Ga0395899_0000031 Ga0395899_0000031_248876_249382 135
148 3300037312 Ga0395899_0007170 Ga0395899_0007170_1504_1917 135
149 3300037418 Ga0395900_0000110 Ga0395900_0000110_88401_88907 135
150 3300037418 Ga0395900_0019316 Ga0395900_0019316_5263_5676 135
151 3300037418 Ga0395900_0604870 Ga0395900_0604870_233_646 135
152 3300037466 Ga0395898_0000040 Ga0395898_0000040_243883_244389 135
153 3300037466 Ga0395898_0011122 Ga0395898_0011122_482_895 135
154 3300038443 Ga0395901_0000113 Ga0395901_0000113_75419_75832 135
155 3300038443 Ga0395901_0000558 Ga0395901_0000558_9446_9859 135
156 3300041452 Ga0451793_0416430 Ga0451793_0416430_510_932 135
157 3300044656 Ga0466969_0007401 Ga0466969_0007401_315_728 135
158 3300044658 Ga0466972_0077873 Ga0466972_0077873_638_1051 135
159 3300044683 Ga0466965_0037924 Ga0466965_0037924_305_718 135
160 3300044684 Ga0466966_0011771 Ga0466966_0011771_203_616 135
161 3300044693 Ga0466961_0094830 Ga0466961_0094830_1238_1651 135
162 3300044693 Ga0466961_0213583 Ga0466961_0213583_583_999 135
163 3300044694 Ga0466963_0205968 Ga0466963_0205968_399_812 135
164 3300044706 Ga0466964_0014602 Ga0466964_0014602_2050_2463 135
165 3300044842 Ga0466957_0004203 Ga0466957_0004203_1847_2260 135
166 3300045051 Ga0451576_0161323 Ga0451576_0161323_1289_1738 135
167 3300045836 Ga0466958_0047958 Ga0466958_0047958_578_991 135
168 3300047472 Ga0495686_0002611 Ga0495686_0002611_611_1033 135
169 3300048906 Ga0496103_0747668 Ga0496103_0747668_49_486 135
170 3300048920 Ga0496117_0002840 Ga0496117_0002840_989_1426 135
171 3300048921 Ga0496118_0004010 Ga0496118_0004010_13830_14267 135
172 3300048929 Ga0496126_0000232 Ga0496126_0000232_97501_97938 135
173 3300048929 Ga0496126_0022006 Ga0496126_0022006_4003_4422 135
174 3300049160 Ga0501304_012948 Ga0501304_012948_182_595 135
175 3300049572 Ga0501036_0650850 Ga0501036_0650850_246_656 135
176 3300049662 Ga0501222_005059 Ga0501222_005059_904_1317 135
177 3300049744 Ga0501083_0015033 Ga0501083_0015033_153_566 135
178 3300050507 nmdc:mga05p37_194485_c1 nmdc:mga05p37_194485_c1_556_969 135
179 3300050514 nmdc:mga08x19_955841_c1 nmdc:mga08x19_955841_c1_141_554 135
180 3300003203 JGI25406J46586_10001746 JGI25406J46586_1000174615 136
181 3300005290 Ga0065712_10417691 Ga0065712_104176911 136
182 3300005330 Ga0070690_100015203 Ga0070690_1000152037 136
183 3300005331 Ga0070670_100034863 Ga0070670_1000348636 136
184 3300005331 Ga0070670_100387076 Ga0070670_1003870762 136
185 3300005335 Ga0070666_10004938 Ga0070666_100049389 136
186 3300005340 Ga0070689_100103965 Ga0070689_1001039653 136
187 3300005344 Ga0070661_100015991 Ga0070661_1000159915 136
188 3300005355 Ga0070671_100014094 Ga0070671_1000140948 136
189 3300005364 Ga0070673_100322156 Ga0070673_1003221562 136
190 3300005367 Ga0070667_100030162 Ga0070667_1000301623 136
191 3300005434 Ga0070709_10746082 Ga0070709_107460821 136
192 3300005439 Ga0070711_100262722 Ga0070711_1002627222 136
193 3300005535 Ga0070684_100048498 Ga0070684_1000484982 136
194 3300005543 Ga0070672_100198037 Ga0070672_1001980372 136
195 3300005548 Ga0070665_100079166 Ga0070665_1000791662 136
196 3300005578 Ga0068854_100632719 Ga0068854_1006327192 136
197 3300005615 Ga0070702_100007342 Ga0070702_1000073426 136
198 3300005617 Ga0068859_100065334 Ga0068859_1000653344 136
199 3300005618 Ga0068864_100052778 Ga0068864_1000527784 136
200 3300005834 Ga0068851_10038257 Ga0068851_100382573 136
201 3300005842 Ga0068858_100023518 Ga0068858_1000235185 136
202 3300005985 Ga0081539_10000167 Ga0081539_1000016757 136
203 3300006058 Ga0075432_10152738 Ga0075432_101527382 136
204 3300006058 Ga0075432_10219979 Ga0075432_102199791 136
205 3300006237 Ga0097621_100252189 Ga0097621_1002521893 136
206 3300006237 Ga0097621_100468661 Ga0097621_1004686612 136
207 3300006358 Ga0068871_100069526 Ga0068871_1000695262 136
208 3300006358 Ga0068871_101836875 Ga0068871_1018368751 136
209 3300006847 Ga0075431_100219784 Ga0075431_1002197843 136
210 3300006852 Ga0075433_10006639 Ga0075433_100066398 136
211 3300006852 Ga0075433_10107975 Ga0075433_101079754 136
212 3300006871 Ga0075434_100003017 Ga0075434_1000030175 136
213 3300006871 Ga0075434_100007530 Ga0075434_1000075305 136
214 3300006871 Ga0075434_102146331 Ga0075434_1021463311 136
215 3300006880 Ga0075429_100282639 Ga0075429_1002826392 136
216 3300006914 Ga0075436_100008227 Ga0075436_1000082275 136
217 3300006914 Ga0075436_101100866 Ga0075436_1011008662 136
218 3300006931 Ga0097620_100065333 Ga0097620_1000653333 136
219 3300009093 Ga0105240_10093384 Ga0105240_100933843 136
220 3300009094 Ga0111539_10059869 Ga0111539_100598692 136
221 3300009094 Ga0111539_10875863 Ga0111539_108758631 136
222 3300009098 Ga0105245_10037616 Ga0105245_100376165 136
223 3300009101 Ga0105247_10002393 Ga0105247_100023934 136
224 3300009147 Ga0114129_10095768 Ga0114129_100957683 136
225 3300009177 Ga0105248_10019344 Ga0105248_100193444 136
226 3300009551 Ga0105238_10189192 Ga0105238_101891923 136
227 3300010375 Ga0105239_10132715 Ga0105239_101327152 136
228 3300013306 Ga0163162_10115316 Ga0163162_101153163 136
229 3300014325 Ga0163163_10004561 Ga0163163_100045618 136
230 3300014968 Ga0157379_10197682 Ga0157379_101976823 136
231 3300021361 Ga0213872_10040906 Ga0213872_100409063 136
232 3300025900 Ga0207710_10008841 Ga0207710_100088415 136
233 3300025903 Ga0207680_10357072 Ga0207680_103570722 136
234 3300025906 Ga0207699_10228511 Ga0207699_102285112 136
235 3300025911 Ga0207654_10713896 Ga0207654_107138962 136
236 3300025913 Ga0207695_10066569 Ga0207695_100665693 136
237 3300025915 Ga0207693_10639590 Ga0207693_106395901 136
238 3300025916 Ga0207663_10550467 Ga0207663_105504672 136
239 3300025920 Ga0207649_10098308 Ga0207649_100983082 136
240 3300025925 Ga0207650_10145151 Ga0207650_101451512 136
241 3300025928 Ga0207700_10053341 Ga0207700_100533412 136
242 3300025931 Ga0207644_10645930 Ga0207644_106459302 136
243 3300025935 Ga0207709_10338045 Ga0207709_103380452 136
244 3300025939 Ga0207665_10049704 Ga0207665_100497043 136
245 3300025941 Ga0207711_10003107 Ga0207711_1000310713 136
246 3300025945 Ga0207679_10403248 Ga0207679_104032483 136
247 3300025961 Ga0207712_10705296 Ga0207712_107052961 136
248 3300025972 Ga0207668_10115559 Ga0207668_101155593 136
249 3300026023 Ga0207677_10172119 Ga0207677_101721192 136
250 3300026035 Ga0207703_10041833 Ga0207703_100418333 136
251 3300026095 Ga0207676_10051035 Ga0207676_100510353 136
252 3300026142 Ga0207698_10318346 Ga0207698_103183462 136
253 3300027907 Ga0207428_10263585 Ga0207428_102635852 136
254 3300028379 Ga0268266_10187441 Ga0268266_101874413 136
255 3300028381 Ga0268264_10225804 Ga0268264_102258042 136
256 3300028573 Ga0265334_10001877 Ga0265334_100018772 136
257 3300031251 Ga0265327_10000419 Ga0265327_1000041934 136
258 3300031507 Ga0307509_10170432 Ga0307509_101704322 136
259 3300035092 Ga0373952_0091623 Ga0373952_0091623_10_426 136
260 3300035115 Ga0373941_0068891 Ga0373941_0068891_261_677 136
261 3300035121 Ga0373960_0130934 Ga0373960_0130934_229_651 136
262 3300035691 Ga0373931_0178867 Ga0373931_0178867_31_447 136
263 3300039447 Ga0436361_1002899 Ga0436361_1002899_221_760 136
264 3300042876 Ga0451577_0009013 Ga0451577_0009013_7734_8165 136
265 3300042993 Ga0439440_0006871 Ga0439440_0006871_1437_1853 136
266 3300045051 Ga0451576_0674137 Ga0451576_0674137_116_532 136
267 3300046522 Ga0495643_0391028 Ga0495643_0391028_152_568 136
268 3300048905 Ga0496102_0156871 Ga0496102_0156871_1229_1645 136
269 3300048912 Ga0496109_1693491 Ga0496109_1693491_116_532 136
270 3300048913 Ga0496110_0520733 Ga0496110_0520733_651_1067 136
271 3300048915 Ga0496112_0084285 Ga0496112_0084285_964_1380 136
272 3300049575 Ga0501039_0222395 Ga0501039_0222395_135_551 136
273 3300049575 Ga0501039_0795095 Ga0501039_0795095_136_552 136
274 3300049576 Ga0501040_0550116 Ga0501040_0550116_342_758 136
275 3300049587 Ga0501071_0895577 Ga0501071_0895577_221_637 136
276 3300049591 Ga0501075_0168199 Ga0501075_0168199_490_906 136
277 3300049593 Ga0501077_0002939 Ga0501077_0002939_879_1310 136
278 3300049593 Ga0501077_0756641 Ga0501077_0756641_107_532 136
279 3300050507 nmdc:mga05p37_1432570_c1 nmdc:mga05p37_1432570_c1_63_479 136
280 3300050511 nmdc:mga08y16_299085_c1 nmdc:mga08y16_299085_c1_988_1404 136
281 3300050512 nmdc:mga0n895_1064682_c1 nmdc:mga0n895_1064682_c1_293_715 136
282 3300050512 nmdc:mga0n895_108467_c1 nmdc:mga0n895_108467_c1_832_1248 136
283 3300050512 nmdc:mga0n895_1251684_c1 nmdc:mga0n895_1251684_c1_233_655 136
284 3300050512 nmdc:mga0n895_27726_c1 nmdc:mga0n895_27726_c1_2436_2852 136
285 3300050515 nmdc:mga0a205_23937_c1 nmdc:mga0a205_23937_c1_860_1276 136
286 3300050515 nmdc:mga0a205_6049_c1 nmdc:mga0a205_6049_c1_8648_9064 136
287 3300054114 Ga0501084_1190464 Ga0501084_1190464_203_619 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

25

138

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8083 2 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7376 2 114
2pn6-assembly1.cif.gz_A crystal structure of s32a of st1022-gln complex from sulfolobus tokodaii 0.6406 2 114
2zbc-assembly1.cif.gz_C-2 crystal structure of sts042, a stand-alone ram module protein, from hyperthermophilic archaeon sulfolobus tokodaii strain7. 0.6302 1 114
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.6258 2 114
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8083 2 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7375 2 114 3.30.70.1060
3phtA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.6681 2 109 3.30.70.1150
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6599 1 114 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6477 1 114 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A7W1SK36-F1-model_v4 YciI family protein 0.9868 1 130
AF-A0A1S9AF86-F1-model_v4 Dehydrogenase 0.9825 1 129
AF-A0A0E1TWM3-F1-model_v4 deleted 0.9763 2 131
AF-A0A516SH39-F1-model_v4 YciI family protein 0.9761 1 131
AF-A0A7H4GMW1-F1-model_v4 YciI family protein 0.9739 1 131

Feature Viewer

pLDDT pTM Quality
91.9 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map