F388243
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 211 | 270 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0265066|Ga0501040_0265066_278_760 |
| Length | 160 |
| Sequence | MAVIVRRQDRGKDSRVRGQRQGFIMRFMIIVKATPDTEAGKRADEELFHDMVACHEEMAKAGVLLGGSGLQPSAKGWRIKHDGNKRIVVDGPFAETKELIAGYTIIQTKSREEAVEWSKRFPNPMGRRERCEIEVRQLYELEDLGGPSTVIERFRDIGIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 2 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 3 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 4 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 5 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 6 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 7 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 8 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 9 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 10 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 11 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 12 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 13 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 132 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 134 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 141 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 143 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 144 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 145 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 146 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 147 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 170 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 171 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 172 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 173 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 183 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 184 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 185 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 186 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 195 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 199 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 209 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 210 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 211 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.38 |
| Metatranscriptomes | 0.7 |
| Isolates | 5.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0.35 |
| Rhizoplane | 9.41 |
| Rhizosphere | 81.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001746 | 3300003203 | Bacteria | 10222 |
| 2 | rootH2_10010424 | 3300003320 | Bacteria | 7105 |
| 3 | rootH1_10135344 | 3300003323 | Bacteria | 4907 |
| 4 | rootH1_10285178 | 3300003323 | Bacteria | 2697 |
| 5 | Ga0058859_11241233 | 3300004798 | Bacteria | 707 |
| 6 | Ga0065712_10417691 | 3300005290 | Bacteria | 715 |
| 7 | Ga0070690_100015203 | 3300005330 | Bacteria | 4586 |
| 8 | Ga0070670_100034863 | 3300005331 | Bacteria | 4331 |
| 9 | Ga0070670_100387076 | 3300005331 | Bacteria | 1233 |
| 10 | Ga0068869_100185930 | 3300005334 | Bacteria | 1631 |
| 11 | Ga0068869_100341896 | 3300005334 | Bacteria | 1218 |
| 12 | Ga0070666_10004938 | 3300005335 | Bacteria | 8159 |
| 13 | Ga0070680_100917119 | 3300005336 | Bacteria | 756 |
| 14 | Ga0070689_100103965 | 3300005340 | Bacteria | 2251 |
| 15 | Ga0070689_101182995 | 3300005340 | Bacteria | 686 |
| 16 | Ga0070661_100015991 | 3300005344 | Bacteria | 5297 |
| 17 | Ga0070661_100834241 | 3300005344 | Bacteria | 758 |
| 18 | Ga0070671_100014094 | 3300005355 | Bacteria | 6454 |
| 19 | Ga0070671_101061578 | 3300005355 | Bacteria | 711 |
| 20 | Ga0070674_100057237 | 3300005356 | Bacteria | 2706 |
| 21 | Ga0070673_100214337 | 3300005364 | Bacteria | 1664 |
| 22 | Ga0070673_100322156 | 3300005364 | Bacteria | 1365 |
| 23 | Ga0070659_100497221 | 3300005366 | Bacteria | 1039 |
| 24 | Ga0070667_100030162 | 3300005367 | Bacteria | 4522 |
| 25 | Ga0070667_100273539 | 3300005367 | Bacteria | 1515 |
| 26 | Ga0070709_10746082 | 3300005434 | Bacteria | 765 |
| 27 | Ga0070711_100117831 | 3300005439 | Bacteria | 1959 |
| 28 | Ga0070711_100262722 | 3300005439 | Bacteria | 1359 |
| 29 | Ga0070705_100090165 | 3300005440 | Bacteria | 1908 |
| 30 | Ga0070700_100239002 | 3300005441 | Bacteria | 1297 |
| 31 | Ga0070694_100175462 | 3300005444 | Bacteria | 1582 |
| 32 | Ga0070663_101640461 | 3300005455 | Bacteria | 574 |
| 33 | Ga0070662_100006550 | 3300005457 | Bacteria | 7512 |
| 34 | Ga0070662_100527943 | 3300005457 | Bacteria | 987 |
| 35 | Ga0070685_10207587 | 3300005466 | Bacteria | 1277 |
| 36 | Ga0070706_100085736 | 3300005467 | Bacteria | 2918 |
| 37 | Ga0070707_100940970 | 3300005468 | Bacteria | 829 |
| 38 | Ga0070699_100178927 | 3300005518 | Bacteria | 1881 |
| 39 | Ga0070684_100048498 | 3300005535 | Bacteria | 3685 |
| 40 | Ga0070672_100198037 | 3300005543 | Bacteria | 1679 |
| 41 | Ga0070695_100040396 | 3300005545 | Bacteria | 2953 |
| 42 | Ga0070665_100079166 | 3300005548 | Bacteria | 3292 |
| 43 | Ga0070665_100627564 | 3300005548 | Bacteria | 1088 |
| 44 | Ga0070665_101397804 | 3300005548 | Bacteria | 709 |
| 45 | Ga0068854_100632719 | 3300005578 | Bacteria | 917 |
| 46 | Ga0068856_101032398 | 3300005614 | Bacteria | 840 |
| 47 | Ga0070702_100007342 | 3300005615 | Bacteria | 5272 |
| 48 | Ga0070702_100144204 | 3300005615 | Bacteria | 1521 |
| 49 | Ga0068852_100270231 | 3300005616 | Bacteria | 1636 |
| 50 | Ga0068852_101734933 | 3300005616 | Bacteria | 647 |
| 51 | Ga0068859_100065334 | 3300005617 | Bacteria | 3673 |
| 52 | Ga0068859_100854881 | 3300005617 | Bacteria | 996 |
| 53 | Ga0068864_100052778 | 3300005618 | Bacteria | 3505 |
| 54 | Ga0068861_100366178 | 3300005719 | Bacteria | 1269 |
| 55 | Ga0068851_10038257 | 3300005834 | Bacteria | 2406 |
| 56 | Ga0068858_100023518 | 3300005842 | Bacteria | 5739 |
| 57 | Ga0068858_100212696 | 3300005842 | Bacteria | 1830 |
| 58 | Ga0081539_10000167 | 3300005985 | Bacteria | 153726 |
| 59 | Ga0075432_10152738 | 3300006058 | Bacteria | 888 |
| 60 | Ga0075432_10219979 | 3300006058 | Bacteria | 759 |
| 61 | Ga0070712_100815795 | 3300006175 | Bacteria | 801 |
| 62 | Ga0097621_100252189 | 3300006237 | Bacteria | 1545 |
| 63 | Ga0097621_100468661 | 3300006237 | Bacteria | 1137 |
| 64 | Ga0068871_100069526 | 3300006358 | Bacteria | 2892 |
| 65 | Ga0068871_101836875 | 3300006358 | Bacteria | 576 |
| 66 | Ga0075431_100219784 | 3300006847 | Unclassified | 1938 |
| 67 | Ga0075433_10006639 | 3300006852 | Bacteria | 9161 |
| 68 | Ga0075433_10107975 | 3300006852 | Bacteria | 2468 |
| 69 | Ga0075434_100003017 | 3300006871 | Bacteria | 14963 |
| 70 | Ga0075434_100007530 | 3300006871 | Bacteria | 10082 |
| 71 | Ga0075434_102146331 | 3300006871 | Bacteria | 563 |
| 72 | Ga0075429_100282639 | 3300006880 | Unclassified | 1453 |
| 73 | Ga0068865_100019421 | 3300006881 | Bacteria | 4398 |
| 74 | Ga0075436_100008227 | 3300006914 | Bacteria | 7138 |
| 75 | Ga0075436_101100866 | 3300006914 | Bacteria | 598 |
| 76 | Ga0097620_100065333 | 3300006931 | Bacteria | 3673 |
| 77 | Ga0097620_100854922 | 3300006931 | Bacteria | 996 |
| 78 | Ga0075435_100036442 | 3300007076 | Bacteria | 3909 |
| 79 | Ga0105240_10093384 | 3300009093 | Bacteria | 3672 |
| 80 | Ga0111539_10059869 | 3300009094 | Bacteria | 4515 |
| 81 | Ga0111539_10875863 | 3300009094 | Bacteria | 1045 |
| 82 | Ga0105245_10037616 | 3300009098 | Bacteria | 4303 |
| 83 | Ga0105247_10002393 | 3300009101 | Bacteria | 12748 |
| 84 | Ga0105247_10004306 | 3300009101 | Bacteria | 9102 |
| 85 | Ga0114129_10095768 | 3300009147 | Bacteria | 4111 |
| 86 | Ga0114129_10357639 | 3300009147 | Bacteria | 1933 |
| 87 | Ga0105243_10025442 | 3300009148 | Bacteria | 4523 |
| 88 | Ga0105243_10142336 | 3300009148 | Bacteria | 2048 |
| 89 | Ga0105248_10019344 | 3300009177 | Bacteria | 7534 |
| 90 | Ga0105248_10033222 | 3300009177 | Bacteria | 5762 |
| 91 | Ga0105238_10189192 | 3300009551 | Bacteria | 2035 |
| 92 | Ga0105238_10588074 | 3300009551 | Bacteria | 1120 |
| 93 | Ga0105239_10132715 | 3300010375 | Bacteria | 2771 |
| 94 | Ga0105239_11521855 | 3300010375 | Bacteria | 773 |
| 95 | Ga0105246_10087486 | 3300011119 | Bacteria | 2237 |
| 96 | Ga0105246_10386918 | 3300011119 | Bacteria | 1157 |
| 97 | Ga0157378_10105546 | 3300013297 | Bacteria | 2576 |
| 98 | Ga0157378_10123626 | 3300013297 | Bacteria | 2388 |
| 99 | Ga0163162_10115316 | 3300013306 | Bacteria | 2786 |
| 100 | Ga0157375_10003490 | 3300013308 | Bacteria | 13634 |
| 101 | Ga0157375_10028720 | 3300013308 | Bacteria | 5219 |
| 102 | Ga0163163_10004561 | 3300014325 | Bacteria | 11831 |
| 103 | Ga0157377_10855673 | 3300014745 | Bacteria | 676 |
| 104 | Ga0157379_10024045 | 3300014968 | Bacteria | 5407 |
| 105 | Ga0157379_10197682 | 3300014968 | Bacteria | 1817 |
| 106 | Ga0157376_10002865 | 3300014969 | Bacteria | 11811 |
| 107 | Ga0213872_10040906 | 3300021361 | Bacteria | 2115 |
| 108 | Ga0207710_10008841 | 3300025900 | Bacteria | 4241 |
| 109 | Ga0207710_10008886 | 3300025900 | Bacteria | 4227 |
| 110 | Ga0207680_10357072 | 3300025903 | Bacteria | 1027 |
| 111 | Ga0207699_10228511 | 3300025906 | Bacteria | 1273 |
| 112 | Ga0207684_10038443 | 3300025910 | Bacteria | 4060 |
| 113 | Ga0207654_10713896 | 3300025911 | Bacteria | 721 |
| 114 | Ga0207695_10066569 | 3300025913 | Bacteria | 3699 |
| 115 | Ga0207693_10639590 | 3300025915 | Bacteria | 827 |
| 116 | Ga0207663_10087994 | 3300025916 | Bacteria | 2053 |
| 117 | Ga0207663_10550467 | 3300025916 | Bacteria | 902 |
| 118 | Ga0207649_10098308 | 3300025920 | Bacteria | 1931 |
| 119 | Ga0207650_10145151 | 3300025925 | Bacteria | 1868 |
| 120 | Ga0207700_10053341 | 3300025928 | Bacteria | 3029 |
| 121 | Ga0207644_10645930 | 3300025931 | Bacteria | 880 |
| 122 | Ga0207644_10725556 | 3300025931 | Bacteria | 829 |
| 123 | Ga0207690_10581347 | 3300025932 | Bacteria | 913 |
| 124 | Ga0207706_10001797 | 3300025933 | Bacteria | 21093 |
| 125 | Ga0207709_10079285 | 3300025935 | Bacteria | 2111 |
| 126 | Ga0207709_10338045 | 3300025935 | Bacteria | 1132 |
| 127 | Ga0207670_10909656 | 3300025936 | Bacteria | 737 |
| 128 | Ga0207704_10003444 | 3300025938 | Bacteria | 7191 |
| 129 | Ga0207665_10049704 | 3300025939 | Bacteria | 2818 |
| 130 | Ga0207711_10003107 | 3300025941 | Bacteria | 14477 |
| 131 | Ga0207711_10019960 | 3300025941 | Bacteria | 5585 |
| 132 | Ga0207679_10403248 | 3300025945 | Bacteria | 1203 |
| 133 | Ga0207651_10653364 | 3300025960 | Bacteria | 923 |
| 134 | Ga0207712_10705296 | 3300025961 | Bacteria | 881 |
| 135 | Ga0207668_10115559 | 3300025972 | Bacteria | 2022 |
| 136 | Ga0207668_10942315 | 3300025972 | Bacteria | 770 |
| 137 | Ga0207658_10180230 | 3300025986 | Bacteria | 1748 |
| 138 | Ga0207677_10172119 | 3300026023 | Bacteria | 1694 |
| 139 | Ga0207703_10041833 | 3300026035 | Bacteria | 3674 |
| 140 | Ga0207703_10076632 | 3300026035 | Bacteria | 2774 |
| 141 | Ga0207703_11086196 | 3300026035 | Bacteria | 768 |
| 142 | Ga0207678_10720657 | 3300026067 | Bacteria | 878 |
| 143 | Ga0207702_10320483 | 3300026078 | Bacteria | 1476 |
| 144 | Ga0207676_10051035 | 3300026095 | Bacteria | 3227 |
| 145 | Ga0207675_100517347 | 3300026118 | Bacteria | 1189 |
| 146 | Ga0207683_10389871 | 3300026121 | Bacteria | 1281 |
| 147 | Ga0207698_10318346 | 3300026142 | Bacteria | 1456 |
| 148 | Ga0207698_10603921 | 3300026142 | Bacteria | 1082 |
| 149 | Ga0207698_11904822 | 3300026142 | Bacteria | 609 |
| 150 | Ga0209970_1000173 | 3300027614 | Bacteria | 10142 |
| 151 | Ga0207428_10263585 | 3300027907 | Bacteria | 1283 |
| 152 | Ga0268266_10170851 | 3300028379 | Bacteria | 1973 |
| 153 | Ga0268266_10187441 | 3300028379 | Bacteria | 1887 |
| 154 | Ga0268264_10225804 | 3300028381 | Bacteria | 1726 |
| 155 | Ga0268264_10306941 | 3300028381 | Bacteria | 1496 |
| 156 | Ga0265334_10001877 | 3300028573 | Bacteria | 9974 |
| 157 | Ga0307515_10000284 | 3300028794 | Bacteria | 124800 |
| 158 | Ga0307515_10033526 | 3300028794 | Bacteria | 8446 |
| 159 | Ga0265327_10000419 | 3300031251 | Bacteria | 77672 |
| 160 | Ga0307513_10151776 | 3300031456 | Bacteria | 2224 |
| 161 | Ga0307509_10170432 | 3300031507 | Bacteria | 2057 |
| 162 | Ga0307408_100388244 | 3300031548 | Bacteria | 1195 |
| 163 | Ga0307516_10000116 | 3300031730 | Bacteria | 92895 |
| 164 | Ga0307409_100961853 | 3300031995 | Bacteria | 870 |
| 165 | Ga0307414_11454053 | 3300032004 | Bacteria | 637 |
| 166 | Ga0373952_0091623 | 3300035092 | Bacteria | 790 |
| 167 | Ga0373941_0068891 | 3300035115 | Bacteria | 1170 |
| 168 | Ga0373960_0130934 | 3300035121 | Bacteria | 841 |
| 169 | Ga0373931_0178867 | 3300035691 | Bacteria | 1255 |
| 170 | Ga0395899_0000031 | 3300037312 | Bacteria | 322356 |
| 171 | Ga0395899_0007170 | 3300037312 | Bacteria | 8630 |
| 172 | Ga0395900_0000110 | 3300037418 | Bacteria | 145544 |
| 173 | Ga0395900_0019316 | 3300037418 | Bacteria | 6951 |
| 174 | Ga0395900_0604870 | 3300037418 | Bacteria | 1036 |
| 175 | Ga0395900_0788307 | 3300037418 | Bacteria | 879 |
| 176 | Ga0395898_0000040 | 3300037466 | Bacteria | 317329 |
| 177 | Ga0395898_0011122 | 3300037466 | Bacteria | 9370 |
| 178 | Ga0395905_0382445 | 3300037471 | Bacteria | 1301 |
| 179 | Ga0395905_0785637 | 3300037471 | Bacteria | 855 |
| 180 | Ga0395901_0000113 | 3300038443 | Bacteria | 110398 |
| 181 | Ga0395901_0000558 | 3300038443 | Bacteria | 43141 |
| 182 | Ga0436361_1002899 | 3300039447 | Bacteria | 2649 |
| 183 | Ga0436361_1159595 | 3300039447 | Unclassified | 845 |
| 184 | Ga0451793_0416430 | 3300041452 | Bacteria | 1176 |
| 185 | Ga0451795_0964804 | 3300041456 | Bacteria | 689 |
| 186 | Ga0451577_0009013 | 3300042876 | Bacteria | 9635 |
| 187 | Ga0439440_0006871 | 3300042993 | Bacteria | 2302 |
| 188 | Ga0466969_0007401 | 3300044656 | Bacteria | 5834 |
| 189 | Ga0466972_0077873 | 3300044658 | Bacteria | 1579 |
| 190 | Ga0453683_0131771 | 3300044673 | Bacteria | 1576 |
| 191 | Ga0466965_0037924 | 3300044683 | Bacteria | 2366 |
| 192 | Ga0466966_0011771 | 3300044684 | Bacteria | 5796 |
| 193 | Ga0466961_0094830 | 3300044693 | Bacteria | 1882 |
| 194 | Ga0466961_0213583 | 3300044693 | Bacteria | 1190 |
| 195 | Ga0466963_0205968 | 3300044694 | Bacteria | 1376 |
| 196 | Ga0466964_0014602 | 3300044706 | Bacteria | 2986 |
| 197 | Ga0466957_0004203 | 3300044842 | Bacteria | 7984 |
| 198 | Ga0451576_0161323 | 3300045051 | Bacteria | 2340 |
| 199 | Ga0451576_0674137 | 3300045051 | Bacteria | 1086 |
| 200 | Ga0451576_0769061 | 3300045051 | Bacteria | 1012 |
| 201 | Ga0466958_0047958 | 3300045836 | Bacteria | 2579 |
| 202 | Ga0495590_0071955 | 3300046457 | Bacteria | 1214 |
| 203 | Ga0495643_0391028 | 3300046522 | Bacteria | 615 |
| 204 | Ga0495621_0045571 | 3300046539 | Bacteria | 1554 |
| 205 | Ga0495634_0241400 | 3300046642 | Bacteria | 1108 |
| 206 | Ga0495658_0312718 | 3300046683 | Unclassified | 995 |
| 207 | Ga0495649_0409495 | 3300046694 | Bacteria | 680 |
| 208 | Ga0495674_0219772 | 3300047319 | Bacteria | 1571 |
| 209 | Ga0495672_0002937 | 3300047320 | Bacteria | 15044 |
| 210 | Ga0495676_0537442 | 3300047321 | Unclassified | 765 |
| 211 | Ga0495686_0002611 | 3300047472 | Bacteria | 16704 |
| 212 | Ga0496100_0007141 | 3300048903 | Bacteria | 6135 |
| 213 | Ga0496101_0008414 | 3300048904 | Bacteria | 6740 |
| 214 | Ga0496102_0156871 | 3300048905 | Bacteria | 2140 |
| 215 | Ga0496103_0206409 | 3300048906 | Bacteria | 1264 |
| 216 | Ga0496103_0747668 | 3300048906 | Bacteria | 618 |
| 217 | Ga0496104_0005572 | 3300048907 | Bacteria | 11024 |
| 218 | Ga0496105_0003211 | 3300048908 | Bacteria | 12037 |
| 219 | Ga0496105_0165605 | 3300048908 | Bacteria | 1814 |
| 220 | Ga0496106_0002685 | 3300048909 | Bacteria | 13218 |
| 221 | Ga0496107_0070404 | 3300048910 | Bacteria | 2539 |
| 222 | Ga0496108_0115838 | 3300048911 | Bacteria | 2295 |
| 223 | Ga0496109_0084461 | 3300048912 | Bacteria | 2929 |
| 224 | Ga0496109_1693491 | 3300048912 | Bacteria | 566 |
| 225 | Ga0496110_0030100 | 3300048913 | Bacteria | 4678 |
| 226 | Ga0496110_0520733 | 3300048913 | Bacteria | 1082 |
| 227 | Ga0496111_0377350 | 3300048914 | Bacteria | 1049 |
| 228 | Ga0496112_0084285 | 3300048915 | Bacteria | 3143 |
| 229 | Ga0496112_0142852 | 3300048915 | Bacteria | 2362 |
| 230 | Ga0496112_0624567 | 3300048915 | Bacteria | 1008 |
| 231 | Ga0496113_0390025 | 3300048916 | Bacteria | 1118 |
| 232 | Ga0496114_0003394 | 3300048917 | Bacteria | 12233 |
| 233 | Ga0496114_0014686 | 3300048917 | Bacteria | 6293 |
| 234 | Ga0496115_0002484 | 3300048918 | Bacteria | 13253 |
| 235 | Ga0496115_0502454 | 3300048918 | Unclassified | 974 |
| 236 | Ga0496117_0002840 | 3300048920 | Bacteria | 21073 |
| 237 | Ga0496118_0004010 | 3300048921 | Bacteria | 17914 |
| 238 | Ga0496121_0098073 | 3300048924 | Bacteria | 2269 |
| 239 | Ga0496126_0000232 | 3300048929 | Bacteria | 120250 |
| 240 | Ga0496126_0022006 | 3300048929 | Bacteria | 6214 |
| 241 | Ga0501304_012948 | 3300049160 | Bacteria | 757 |
| 242 | Ga0501036_0650850 | 3300049572 | Bacteria | 872 |
| 243 | Ga0501039_0222395 | 3300049575 | Bacteria | 1484 |
| 244 | Ga0501039_0795095 | 3300049575 | Bacteria | 738 |
| 245 | Ga0501040_0265066 | 3300049576 | Bacteria | 1226 |
| 246 | Ga0501040_0550116 | 3300049576 | Bacteria | 833 |
| 247 | Ga0501071_0895577 | 3300049587 | Bacteria | 685 |
| 248 | Ga0501074_0363359 | 3300049590 | Bacteria | 1027 |
| 249 | Ga0501075_0168199 | 3300049591 | Bacteria | 1672 |
| 250 | Ga0501077_0002939 | 3300049593 | Bacteria | 10225 |
| 251 | Ga0501077_0756641 | 3300049593 | Bacteria | 625 |
| 252 | Ga0501222_005059 | 3300049662 | Bacteria | 1786 |
| 253 | Ga0501080_0233746 | 3300049742 | Bacteria | 1680 |
| 254 | Ga0501081_1384135 | 3300049743 | Bacteria | 534 |
| 255 | Ga0501083_0015033 | 3300049744 | Bacteria | 5417 |
| 256 | nmdc:mga07m45_63281_c1 | 3300050496 | Bacteria | 2098 |
| 257 | nmdc:mga05p37_1432570_c1 | 3300050507 | Bacteria | 693 |
| 258 | nmdc:mga05p37_194485_c1 | 3300050507 | Bacteria | 2460 |
| 259 | nmdc:mga09592_90051_c1 | 3300050508 | Bacteria | 2621 |
| 260 | nmdc:mga0qj67_783287_c1 | 3300050509 | Bacteria | 755 |
| 261 | nmdc:mga06r32_364855_c1 | 3300050510 | Unclassified | 1428 |
| 262 | nmdc:mga08y16_299085_c1 | 3300050511 | Bacteria | 1659 |
| 263 | nmdc:mga0n895_1064682_c1 | 3300050512 | Bacteria | 787 |
| 264 | nmdc:mga0n895_108467_c1 | 3300050512 | Bacteria | 2791 |
| 265 | nmdc:mga0n895_1251684_c1 | 3300050512 | Bacteria | 714 |
| 266 | nmdc:mga0n895_27726_c1 | 3300050512 | Bacteria | 5384 |
| 267 | nmdc:mga08x19_955841_c1 | 3300050514 | Bacteria | 609 |
| 268 | nmdc:mga0a205_23937_c1 | 3300050515 | Bacteria | 5797 |
| 269 | nmdc:mga0a205_6049_c1 | 3300050515 | Bacteria | 10918 |
| 270 | Ga0501084_1190464 | 3300054114 | Bacteria | 639 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046694 | Ga0495649_0409495 | Ga0495649_0409495_177_593 | 123 |
| 2 | 3300046539 | Ga0495621_0045571 | Ga0495621_0045571_739_1134 | 128 |
| 3 | iso_pu_bacteria | 2643221570 | 2643864334 | 129 |
| 4 | iso_pu_bacteria | 2643221652 | 2644291971 | 129 |
| 5 | iso_pu_bacteria | 2990710928 | 2990714928 | 129 |
| 6 | 3300049590 | Ga0501074_0363359 | Ga0501074_0363359_573_974 | 130 |
| 7 | 3300049742 | Ga0501080_0233746 | Ga0501080_0233746_827_1228 | 130 |
| 8 | 3300049743 | Ga0501081_1384135 | Ga0501081_1384135_88_489 | 130 |
| 9 | 3300050509 | nmdc:mga0qj67_783287_c1 | nmdc:mga0qj67_783287_c1_343_744 | 130 |
| 10 | 3300025972 | Ga0207668_10942315 | Ga0207668_109423152 | 131 |
| 11 | 3300027614 | Ga0209970_1000173 | Ga0209970_10001738 | 131 |
| 12 | 3300044673 | Ga0453683_0131771 | Ga0453683_0131771_157_558 | 131 |
| 13 | 3300047320 | Ga0495672_0002937 | Ga0495672_0002937_8570_8983 | 131 |
| 14 | iso_pu_bacteria | 2515154123 | 2515688052 | 131 |
| 15 | iso_pu_bacteria | 2919704043 | 2919706824 | 131 |
| 16 | 3300005455 | Ga0070663_101640461 | Ga0070663_1016404611 | 132 |
| 17 | 3300005467 | Ga0070706_100085736 | Ga0070706_1000857363 | 132 |
| 18 | 3300025910 | Ga0207684_10038443 | Ga0207684_100384434 | 132 |
| 19 | 3300048924 | Ga0496121_0098073 | Ga0496121_0098073_1737_2141 | 132 |
| 20 | 3300050496 | nmdc:mga07m45_63281_c1 | nmdc:mga07m45_63281_c1_282_686 | 132 |
| 21 | iso_pu_bacteria | 2599185239 | 2599735539 | 132 |
| 22 | iso_pu_bacteria | 2738543024 | 2739308945 | 132 |
| 23 | iso_pu_bacteria | 2818991452 | 2819630434 | 132 |
| 24 | iso_pu_bacteria | 2863421361 | 2863428012 | 132 |
| 25 | iso_pu_bacteria | 2904564687 | 2904565474 | 132 |
| 26 | iso_pu_bacteria | 2904571731 | 2904571830 | 132 |
| 27 | iso_pu_bacteria | 2928170801 | 2928174206 | 132 |
| 28 | iso_pu_bacteria | 2928536128 | 2928537146 | 132 |
| 29 | iso_pu_bacteria | 8018845410 | 8018848898 | 132 |
| 30 | iso_pu_bacteria | 8020938398 | 8020941616 | 132 |
| 31 | iso_pu_bacteria | 8020953355 | 8020955595 | 132 |
| 32 | iso_pu_bacteria | 8021120328 | 8021121029 | 132 |
| 33 | 3300005548 | Ga0070665_101397804 | Ga0070665_1013978041 | 133 |
| 34 | 3300005614 | Ga0068856_101032398 | Ga0068856_1010323981 | 133 |
| 35 | 3300009148 | Ga0105243_10142336 | Ga0105243_101423362 | 133 |
| 36 | 3300011119 | Ga0105246_10087486 | Ga0105246_100874863 | 133 |
| 37 | 3300013297 | Ga0157378_10105546 | Ga0157378_101055463 | 133 |
| 38 | 3300013308 | Ga0157375_10028720 | Ga0157375_100287205 | 133 |
| 39 | 3300039447 | Ga0436361_1159595 | Ga0436361_1159595_397_804 | 133 |
| 40 | 3300045051 | Ga0451576_0769061 | Ga0451576_0769061_509_916 | 133 |
| 41 | 3300046642 | Ga0495634_0241400 | Ga0495634_0241400_467_874 | 133 |
| 42 | 3300046683 | Ga0495658_0312718 | Ga0495658_0312718_81_488 | 133 |
| 43 | 3300047319 | Ga0495674_0219772 | Ga0495674_0219772_404_811 | 133 |
| 44 | 3300047321 | Ga0495676_0537442 | Ga0495676_0537442_39_446 | 133 |
| 45 | 3300048908 | Ga0496105_0165605 | Ga0496105_0165605_881_1288 | 133 |
| 46 | 3300048917 | Ga0496114_0014686 | Ga0496114_0014686_5187_5594 | 133 |
| 47 | 3300048918 | Ga0496115_0502454 | Ga0496115_0502454_149_556 | 133 |
| 48 | 3300049576 | Ga0501040_0265066 | Ga0501040_0265066_278_760 | 133 |
| 49 | 3300050508 | nmdc:mga09592_90051_c1 | nmdc:mga09592_90051_c1_2063_2470 | 133 |
| 50 | 3300050510 | nmdc:mga06r32_364855_c1 | nmdc:mga06r32_364855_c1_901_1308 | 133 |
| 51 | 3300003323 | rootH1_10285178 | rootH1_102851782 | 134 |
| 52 | 3300004798 | Ga0058859_11241233 | Ga0058859_112412331 | 134 |
| 53 | 3300005334 | Ga0068869_100341896 | Ga0068869_1003418962 | 134 |
| 54 | 3300005336 | Ga0070680_100917119 | Ga0070680_1009171192 | 134 |
| 55 | 3300005340 | Ga0070689_101182995 | Ga0070689_1011829952 | 134 |
| 56 | 3300005344 | Ga0070661_100834241 | Ga0070661_1008342411 | 134 |
| 57 | 3300005355 | Ga0070671_101061578 | Ga0070671_1010615782 | 134 |
| 58 | 3300005356 | Ga0070674_100057237 | Ga0070674_1000572372 | 134 |
| 59 | 3300005364 | Ga0070673_100214337 | Ga0070673_1002143372 | 134 |
| 60 | 3300005366 | Ga0070659_100497221 | Ga0070659_1004972212 | 134 |
| 61 | 3300005367 | Ga0070667_100273539 | Ga0070667_1002735393 | 134 |
| 62 | 3300005439 | Ga0070711_100117831 | Ga0070711_1001178313 | 134 |
| 63 | 3300005441 | Ga0070700_100239002 | Ga0070700_1002390023 | 134 |
| 64 | 3300005457 | Ga0070662_100527943 | Ga0070662_1005279432 | 134 |
| 65 | 3300005466 | Ga0070685_10207587 | Ga0070685_102075872 | 134 |
| 66 | 3300005548 | Ga0070665_100627564 | Ga0070665_1006275641 | 134 |
| 67 | 3300005615 | Ga0070702_100144204 | Ga0070702_1001442042 | 134 |
| 68 | 3300005616 | Ga0068852_101734933 | Ga0068852_1017349331 | 134 |
| 69 | 3300005617 | Ga0068859_100854881 | Ga0068859_1008548812 | 134 |
| 70 | 3300005719 | Ga0068861_100366178 | Ga0068861_1003661782 | 134 |
| 71 | 3300005842 | Ga0068858_100212696 | Ga0068858_1002126963 | 134 |
| 72 | 3300006175 | Ga0070712_100815795 | Ga0070712_1008157952 | 134 |
| 73 | 3300006881 | Ga0068865_100019421 | Ga0068865_1000194212 | 134 |
| 74 | 3300006931 | Ga0097620_100854922 | Ga0097620_1008549222 | 134 |
| 75 | 3300009101 | Ga0105247_10004306 | Ga0105247_100043065 | 134 |
| 76 | 3300009148 | Ga0105243_10025442 | Ga0105243_100254423 | 134 |
| 77 | 3300009177 | Ga0105248_10033222 | Ga0105248_100332222 | 134 |
| 78 | 3300009551 | Ga0105238_10588074 | Ga0105238_105880741 | 134 |
| 79 | 3300010375 | Ga0105239_11521855 | Ga0105239_115218551 | 134 |
| 80 | 3300011119 | Ga0105246_10386918 | Ga0105246_103869182 | 134 |
| 81 | 3300013297 | Ga0157378_10123626 | Ga0157378_101236264 | 134 |
| 82 | 3300013308 | Ga0157375_10003490 | Ga0157375_1000349015 | 134 |
| 83 | 3300014745 | Ga0157377_10855673 | Ga0157377_108556732 | 134 |
| 84 | 3300014968 | Ga0157379_10024045 | Ga0157379_100240453 | 134 |
| 85 | 3300014969 | Ga0157376_10002865 | Ga0157376_1000286511 | 134 |
| 86 | 3300025900 | Ga0207710_10008886 | Ga0207710_100088863 | 134 |
| 87 | 3300025916 | Ga0207663_10087994 | Ga0207663_100879943 | 134 |
| 88 | 3300025931 | Ga0207644_10725556 | Ga0207644_107255562 | 134 |
| 89 | 3300025932 | Ga0207690_10581347 | Ga0207690_105813472 | 134 |
| 90 | 3300025935 | Ga0207709_10079285 | Ga0207709_100792852 | 134 |
| 91 | 3300025936 | Ga0207670_10909656 | Ga0207670_109096562 | 134 |
| 92 | 3300025938 | Ga0207704_10003444 | Ga0207704_100034446 | 134 |
| 93 | 3300025941 | Ga0207711_10019960 | Ga0207711_100199601 | 134 |
| 94 | 3300025960 | Ga0207651_10653364 | Ga0207651_106533642 | 134 |
| 95 | 3300025986 | Ga0207658_10180230 | Ga0207658_101802301 | 134 |
| 96 | 3300026035 | Ga0207703_10076632 | Ga0207703_100766322 | 134 |
| 97 | 3300026035 | Ga0207703_11086196 | Ga0207703_110861962 | 134 |
| 98 | 3300026067 | Ga0207678_10720657 | Ga0207678_107206572 | 134 |
| 99 | 3300026078 | Ga0207702_10320483 | Ga0207702_103204833 | 134 |
| 100 | 3300026118 | Ga0207675_100517347 | Ga0207675_1005173472 | 134 |
| 101 | 3300026121 | Ga0207683_10389871 | Ga0207683_103898712 | 134 |
| 102 | 3300026142 | Ga0207698_10603921 | Ga0207698_106039212 | 134 |
| 103 | 3300026142 | Ga0207698_11904822 | Ga0207698_119048222 | 134 |
| 104 | 3300028379 | Ga0268266_10170851 | Ga0268266_101708512 | 134 |
| 105 | 3300028381 | Ga0268264_10306941 | Ga0268264_103069411 | 134 |
| 106 | 3300028794 | Ga0307515_10000284 | Ga0307515_1000028440 | 134 |
| 107 | 3300031548 | Ga0307408_100388244 | Ga0307408_1003882442 | 134 |
| 108 | 3300031995 | Ga0307409_100961853 | Ga0307409_1009618532 | 134 |
| 109 | 3300037418 | Ga0395900_0788307 | Ga0395900_0788307_170_580 | 134 |
| 110 | 3300037471 | Ga0395905_0382445 | Ga0395905_0382445_277_687 | 134 |
| 111 | 3300037471 | Ga0395905_0785637 | Ga0395905_0785637_109_519 | 134 |
| 112 | 3300041456 | Ga0451795_0964804 | Ga0451795_0964804_42_452 | 134 |
| 113 | 3300046457 | Ga0495590_0071955 | Ga0495590_0071955_213_623 | 134 |
| 114 | 3300048903 | Ga0496100_0007141 | Ga0496100_0007141_3485_3895 | 134 |
| 115 | 3300048904 | Ga0496101_0008414 | Ga0496101_0008414_4210_4620 | 134 |
| 116 | 3300048906 | Ga0496103_0206409 | Ga0496103_0206409_286_696 | 134 |
| 117 | 3300048907 | Ga0496104_0005572 | Ga0496104_0005572_9457_9867 | 134 |
| 118 | 3300048908 | Ga0496105_0003211 | Ga0496105_0003211_8659_9069 | 134 |
| 119 | 3300048909 | Ga0496106_0002685 | Ga0496106_0002685_8003_8413 | 134 |
| 120 | 3300048910 | Ga0496107_0070404 | Ga0496107_0070404_1960_2370 | 134 |
| 121 | 3300048911 | Ga0496108_0115838 | Ga0496108_0115838_944_1354 | 134 |
| 122 | 3300048912 | Ga0496109_0084461 | Ga0496109_0084461_25_435 | 134 |
| 123 | 3300048913 | Ga0496110_0030100 | Ga0496110_0030100_2679_3089 | 134 |
| 124 | 3300048914 | Ga0496111_0377350 | Ga0496111_0377350_340_750 | 134 |
| 125 | 3300048915 | Ga0496112_0142852 | Ga0496112_0142852_328_738 | 134 |
| 126 | 3300048915 | Ga0496112_0624567 | Ga0496112_0624567_477_887 | 134 |
| 127 | 3300048916 | Ga0496113_0390025 | Ga0496113_0390025_101_511 | 134 |
| 128 | 3300048917 | Ga0496114_0003394 | Ga0496114_0003394_8327_8737 | 134 |
| 129 | 3300048918 | Ga0496115_0002484 | Ga0496115_0002484_8810_9220 | 134 |
| 130 | 3300003320 | rootH2_10010424 | rootH2_100104245 | 135 |
| 131 | 3300003323 | rootH1_10135344 | rootH1_101353445 | 135 |
| 132 | 3300005334 | Ga0068869_100185930 | Ga0068869_1001859302 | 135 |
| 133 | 3300005440 | Ga0070705_100090165 | Ga0070705_1000901653 | 135 |
| 134 | 3300005444 | Ga0070694_100175462 | Ga0070694_1001754623 | 135 |
| 135 | 3300005457 | Ga0070662_100006550 | Ga0070662_1000065504 | 135 |
| 136 | 3300005468 | Ga0070707_100940970 | Ga0070707_1009409702 | 135 |
| 137 | 3300005518 | Ga0070699_100178927 | Ga0070699_1001789273 | 135 |
| 138 | 3300005545 | Ga0070695_100040396 | Ga0070695_1000403963 | 135 |
| 139 | 3300005616 | Ga0068852_100270231 | Ga0068852_1002702313 | 135 |
| 140 | 3300007076 | Ga0075435_100036442 | Ga0075435_1000364424 | 135 |
| 141 | 3300009147 | Ga0114129_10357639 | Ga0114129_103576392 | 135 |
| 142 | 3300025933 | Ga0207706_10001797 | Ga0207706_100017974 | 135 |
| 143 | 3300028794 | Ga0307515_10033526 | Ga0307515_100335266 | 135 |
| 144 | 3300031456 | Ga0307513_10151776 | Ga0307513_101517763 | 135 |
| 145 | 3300031730 | Ga0307516_10000116 | Ga0307516_1000011620 | 135 |
| 146 | 3300032004 | Ga0307414_11454053 | Ga0307414_114540531 | 135 |
| 147 | 3300037312 | Ga0395899_0000031 | Ga0395899_0000031_248876_249382 | 135 |
| 148 | 3300037312 | Ga0395899_0007170 | Ga0395899_0007170_1504_1917 | 135 |
| 149 | 3300037418 | Ga0395900_0000110 | Ga0395900_0000110_88401_88907 | 135 |
| 150 | 3300037418 | Ga0395900_0019316 | Ga0395900_0019316_5263_5676 | 135 |
| 151 | 3300037418 | Ga0395900_0604870 | Ga0395900_0604870_233_646 | 135 |
| 152 | 3300037466 | Ga0395898_0000040 | Ga0395898_0000040_243883_244389 | 135 |
| 153 | 3300037466 | Ga0395898_0011122 | Ga0395898_0011122_482_895 | 135 |
| 154 | 3300038443 | Ga0395901_0000113 | Ga0395901_0000113_75419_75832 | 135 |
| 155 | 3300038443 | Ga0395901_0000558 | Ga0395901_0000558_9446_9859 | 135 |
| 156 | 3300041452 | Ga0451793_0416430 | Ga0451793_0416430_510_932 | 135 |
| 157 | 3300044656 | Ga0466969_0007401 | Ga0466969_0007401_315_728 | 135 |
| 158 | 3300044658 | Ga0466972_0077873 | Ga0466972_0077873_638_1051 | 135 |
| 159 | 3300044683 | Ga0466965_0037924 | Ga0466965_0037924_305_718 | 135 |
| 160 | 3300044684 | Ga0466966_0011771 | Ga0466966_0011771_203_616 | 135 |
| 161 | 3300044693 | Ga0466961_0094830 | Ga0466961_0094830_1238_1651 | 135 |
| 162 | 3300044693 | Ga0466961_0213583 | Ga0466961_0213583_583_999 | 135 |
| 163 | 3300044694 | Ga0466963_0205968 | Ga0466963_0205968_399_812 | 135 |
| 164 | 3300044706 | Ga0466964_0014602 | Ga0466964_0014602_2050_2463 | 135 |
| 165 | 3300044842 | Ga0466957_0004203 | Ga0466957_0004203_1847_2260 | 135 |
| 166 | 3300045051 | Ga0451576_0161323 | Ga0451576_0161323_1289_1738 | 135 |
| 167 | 3300045836 | Ga0466958_0047958 | Ga0466958_0047958_578_991 | 135 |
| 168 | 3300047472 | Ga0495686_0002611 | Ga0495686_0002611_611_1033 | 135 |
| 169 | 3300048906 | Ga0496103_0747668 | Ga0496103_0747668_49_486 | 135 |
| 170 | 3300048920 | Ga0496117_0002840 | Ga0496117_0002840_989_1426 | 135 |
| 171 | 3300048921 | Ga0496118_0004010 | Ga0496118_0004010_13830_14267 | 135 |
| 172 | 3300048929 | Ga0496126_0000232 | Ga0496126_0000232_97501_97938 | 135 |
| 173 | 3300048929 | Ga0496126_0022006 | Ga0496126_0022006_4003_4422 | 135 |
| 174 | 3300049160 | Ga0501304_012948 | Ga0501304_012948_182_595 | 135 |
| 175 | 3300049572 | Ga0501036_0650850 | Ga0501036_0650850_246_656 | 135 |
| 176 | 3300049662 | Ga0501222_005059 | Ga0501222_005059_904_1317 | 135 |
| 177 | 3300049744 | Ga0501083_0015033 | Ga0501083_0015033_153_566 | 135 |
| 178 | 3300050507 | nmdc:mga05p37_194485_c1 | nmdc:mga05p37_194485_c1_556_969 | 135 |
| 179 | 3300050514 | nmdc:mga08x19_955841_c1 | nmdc:mga08x19_955841_c1_141_554 | 135 |
| 180 | 3300003203 | JGI25406J46586_10001746 | JGI25406J46586_1000174615 | 136 |
| 181 | 3300005290 | Ga0065712_10417691 | Ga0065712_104176911 | 136 |
| 182 | 3300005330 | Ga0070690_100015203 | Ga0070690_1000152037 | 136 |
| 183 | 3300005331 | Ga0070670_100034863 | Ga0070670_1000348636 | 136 |
| 184 | 3300005331 | Ga0070670_100387076 | Ga0070670_1003870762 | 136 |
| 185 | 3300005335 | Ga0070666_10004938 | Ga0070666_100049389 | 136 |
| 186 | 3300005340 | Ga0070689_100103965 | Ga0070689_1001039653 | 136 |
| 187 | 3300005344 | Ga0070661_100015991 | Ga0070661_1000159915 | 136 |
| 188 | 3300005355 | Ga0070671_100014094 | Ga0070671_1000140948 | 136 |
| 189 | 3300005364 | Ga0070673_100322156 | Ga0070673_1003221562 | 136 |
| 190 | 3300005367 | Ga0070667_100030162 | Ga0070667_1000301623 | 136 |
| 191 | 3300005434 | Ga0070709_10746082 | Ga0070709_107460821 | 136 |
| 192 | 3300005439 | Ga0070711_100262722 | Ga0070711_1002627222 | 136 |
| 193 | 3300005535 | Ga0070684_100048498 | Ga0070684_1000484982 | 136 |
| 194 | 3300005543 | Ga0070672_100198037 | Ga0070672_1001980372 | 136 |
| 195 | 3300005548 | Ga0070665_100079166 | Ga0070665_1000791662 | 136 |
| 196 | 3300005578 | Ga0068854_100632719 | Ga0068854_1006327192 | 136 |
| 197 | 3300005615 | Ga0070702_100007342 | Ga0070702_1000073426 | 136 |
| 198 | 3300005617 | Ga0068859_100065334 | Ga0068859_1000653344 | 136 |
| 199 | 3300005618 | Ga0068864_100052778 | Ga0068864_1000527784 | 136 |
| 200 | 3300005834 | Ga0068851_10038257 | Ga0068851_100382573 | 136 |
| 201 | 3300005842 | Ga0068858_100023518 | Ga0068858_1000235185 | 136 |
| 202 | 3300005985 | Ga0081539_10000167 | Ga0081539_1000016757 | 136 |
| 203 | 3300006058 | Ga0075432_10152738 | Ga0075432_101527382 | 136 |
| 204 | 3300006058 | Ga0075432_10219979 | Ga0075432_102199791 | 136 |
| 205 | 3300006237 | Ga0097621_100252189 | Ga0097621_1002521893 | 136 |
| 206 | 3300006237 | Ga0097621_100468661 | Ga0097621_1004686612 | 136 |
| 207 | 3300006358 | Ga0068871_100069526 | Ga0068871_1000695262 | 136 |
| 208 | 3300006358 | Ga0068871_101836875 | Ga0068871_1018368751 | 136 |
| 209 | 3300006847 | Ga0075431_100219784 | Ga0075431_1002197843 | 136 |
| 210 | 3300006852 | Ga0075433_10006639 | Ga0075433_100066398 | 136 |
| 211 | 3300006852 | Ga0075433_10107975 | Ga0075433_101079754 | 136 |
| 212 | 3300006871 | Ga0075434_100003017 | Ga0075434_1000030175 | 136 |
| 213 | 3300006871 | Ga0075434_100007530 | Ga0075434_1000075305 | 136 |
| 214 | 3300006871 | Ga0075434_102146331 | Ga0075434_1021463311 | 136 |
| 215 | 3300006880 | Ga0075429_100282639 | Ga0075429_1002826392 | 136 |
| 216 | 3300006914 | Ga0075436_100008227 | Ga0075436_1000082275 | 136 |
| 217 | 3300006914 | Ga0075436_101100866 | Ga0075436_1011008662 | 136 |
| 218 | 3300006931 | Ga0097620_100065333 | Ga0097620_1000653333 | 136 |
| 219 | 3300009093 | Ga0105240_10093384 | Ga0105240_100933843 | 136 |
| 220 | 3300009094 | Ga0111539_10059869 | Ga0111539_100598692 | 136 |
| 221 | 3300009094 | Ga0111539_10875863 | Ga0111539_108758631 | 136 |
| 222 | 3300009098 | Ga0105245_10037616 | Ga0105245_100376165 | 136 |
| 223 | 3300009101 | Ga0105247_10002393 | Ga0105247_100023934 | 136 |
| 224 | 3300009147 | Ga0114129_10095768 | Ga0114129_100957683 | 136 |
| 225 | 3300009177 | Ga0105248_10019344 | Ga0105248_100193444 | 136 |
| 226 | 3300009551 | Ga0105238_10189192 | Ga0105238_101891923 | 136 |
| 227 | 3300010375 | Ga0105239_10132715 | Ga0105239_101327152 | 136 |
| 228 | 3300013306 | Ga0163162_10115316 | Ga0163162_101153163 | 136 |
| 229 | 3300014325 | Ga0163163_10004561 | Ga0163163_100045618 | 136 |
| 230 | 3300014968 | Ga0157379_10197682 | Ga0157379_101976823 | 136 |
| 231 | 3300021361 | Ga0213872_10040906 | Ga0213872_100409063 | 136 |
| 232 | 3300025900 | Ga0207710_10008841 | Ga0207710_100088415 | 136 |
| 233 | 3300025903 | Ga0207680_10357072 | Ga0207680_103570722 | 136 |
| 234 | 3300025906 | Ga0207699_10228511 | Ga0207699_102285112 | 136 |
| 235 | 3300025911 | Ga0207654_10713896 | Ga0207654_107138962 | 136 |
| 236 | 3300025913 | Ga0207695_10066569 | Ga0207695_100665693 | 136 |
| 237 | 3300025915 | Ga0207693_10639590 | Ga0207693_106395901 | 136 |
| 238 | 3300025916 | Ga0207663_10550467 | Ga0207663_105504672 | 136 |
| 239 | 3300025920 | Ga0207649_10098308 | Ga0207649_100983082 | 136 |
| 240 | 3300025925 | Ga0207650_10145151 | Ga0207650_101451512 | 136 |
| 241 | 3300025928 | Ga0207700_10053341 | Ga0207700_100533412 | 136 |
| 242 | 3300025931 | Ga0207644_10645930 | Ga0207644_106459302 | 136 |
| 243 | 3300025935 | Ga0207709_10338045 | Ga0207709_103380452 | 136 |
| 244 | 3300025939 | Ga0207665_10049704 | Ga0207665_100497043 | 136 |
| 245 | 3300025941 | Ga0207711_10003107 | Ga0207711_1000310713 | 136 |
| 246 | 3300025945 | Ga0207679_10403248 | Ga0207679_104032483 | 136 |
| 247 | 3300025961 | Ga0207712_10705296 | Ga0207712_107052961 | 136 |
| 248 | 3300025972 | Ga0207668_10115559 | Ga0207668_101155593 | 136 |
| 249 | 3300026023 | Ga0207677_10172119 | Ga0207677_101721192 | 136 |
| 250 | 3300026035 | Ga0207703_10041833 | Ga0207703_100418333 | 136 |
| 251 | 3300026095 | Ga0207676_10051035 | Ga0207676_100510353 | 136 |
| 252 | 3300026142 | Ga0207698_10318346 | Ga0207698_103183462 | 136 |
| 253 | 3300027907 | Ga0207428_10263585 | Ga0207428_102635852 | 136 |
| 254 | 3300028379 | Ga0268266_10187441 | Ga0268266_101874413 | 136 |
| 255 | 3300028381 | Ga0268264_10225804 | Ga0268264_102258042 | 136 |
| 256 | 3300028573 | Ga0265334_10001877 | Ga0265334_100018772 | 136 |
| 257 | 3300031251 | Ga0265327_10000419 | Ga0265327_1000041934 | 136 |
| 258 | 3300031507 | Ga0307509_10170432 | Ga0307509_101704322 | 136 |
| 259 | 3300035092 | Ga0373952_0091623 | Ga0373952_0091623_10_426 | 136 |
| 260 | 3300035115 | Ga0373941_0068891 | Ga0373941_0068891_261_677 | 136 |
| 261 | 3300035121 | Ga0373960_0130934 | Ga0373960_0130934_229_651 | 136 |
| 262 | 3300035691 | Ga0373931_0178867 | Ga0373931_0178867_31_447 | 136 |
| 263 | 3300039447 | Ga0436361_1002899 | Ga0436361_1002899_221_760 | 136 |
| 264 | 3300042876 | Ga0451577_0009013 | Ga0451577_0009013_7734_8165 | 136 |
| 265 | 3300042993 | Ga0439440_0006871 | Ga0439440_0006871_1437_1853 | 136 |
| 266 | 3300045051 | Ga0451576_0674137 | Ga0451576_0674137_116_532 | 136 |
| 267 | 3300046522 | Ga0495643_0391028 | Ga0495643_0391028_152_568 | 136 |
| 268 | 3300048905 | Ga0496102_0156871 | Ga0496102_0156871_1229_1645 | 136 |
| 269 | 3300048912 | Ga0496109_1693491 | Ga0496109_1693491_116_532 | 136 |
| 270 | 3300048913 | Ga0496110_0520733 | Ga0496110_0520733_651_1067 | 136 |
| 271 | 3300048915 | Ga0496112_0084285 | Ga0496112_0084285_964_1380 | 136 |
| 272 | 3300049575 | Ga0501039_0222395 | Ga0501039_0222395_135_551 | 136 |
| 273 | 3300049575 | Ga0501039_0795095 | Ga0501039_0795095_136_552 | 136 |
| 274 | 3300049576 | Ga0501040_0550116 | Ga0501040_0550116_342_758 | 136 |
| 275 | 3300049587 | Ga0501071_0895577 | Ga0501071_0895577_221_637 | 136 |
| 276 | 3300049591 | Ga0501075_0168199 | Ga0501075_0168199_490_906 | 136 |
| 277 | 3300049593 | Ga0501077_0002939 | Ga0501077_0002939_879_1310 | 136 |
| 278 | 3300049593 | Ga0501077_0756641 | Ga0501077_0756641_107_532 | 136 |
| 279 | 3300050507 | nmdc:mga05p37_1432570_c1 | nmdc:mga05p37_1432570_c1_63_479 | 136 |
| 280 | 3300050511 | nmdc:mga08y16_299085_c1 | nmdc:mga08y16_299085_c1_988_1404 | 136 |
| 281 | 3300050512 | nmdc:mga0n895_1064682_c1 | nmdc:mga0n895_1064682_c1_293_715 | 136 |
| 282 | 3300050512 | nmdc:mga0n895_108467_c1 | nmdc:mga0n895_108467_c1_832_1248 | 136 |
| 283 | 3300050512 | nmdc:mga0n895_1251684_c1 | nmdc:mga0n895_1251684_c1_233_655 | 136 |
| 284 | 3300050512 | nmdc:mga0n895_27726_c1 | nmdc:mga0n895_27726_c1_2436_2852 | 136 |
| 285 | 3300050515 | nmdc:mga0a205_23937_c1 | nmdc:mga0a205_23937_c1_860_1276 | 136 |
| 286 | 3300050515 | nmdc:mga0a205_6049_c1 | nmdc:mga0a205_6049_c1_8648_9064 | 136 |
| 287 | 3300054114 | Ga0501084_1190464 | Ga0501084_1190464_203_619 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.8083 | 2 | 114 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7376 | 2 | 114 |
| 2pn6-assembly1.cif.gz_A | crystal structure of s32a of st1022-gln complex from sulfolobus tokodaii | 0.6406 | 2 | 114 |
| 2zbc-assembly1.cif.gz_C-2 | crystal structure of sts042, a stand-alone ram module protein, from hyperthermophilic archaeon sulfolobus tokodaii strain7. | 0.6302 | 1 | 114 |
| 2djw-assembly1.cif.gz_F | crystal structure of ttha0845 from thermus thermophilus hb8 | 0.6258 | 2 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8083 | 2 | 114 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7375 | 2 | 114 | 3.30.70.1060 |
| 3phtA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.6681 | 2 | 109 | 3.30.70.1150 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6599 | 1 | 114 | 3.30.70.1060 |
| af_P0AB55_1_98_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6477 | 1 | 114 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1SK36-F1-model_v4 | YciI family protein | 0.9868 | 1 | 130 |
|
| AF-A0A1S9AF86-F1-model_v4 | Dehydrogenase | 0.9825 | 1 | 129 |
|
| AF-A0A0E1TWM3-F1-model_v4 | deleted | 0.9763 | 2 | 131 |
|
| AF-A0A516SH39-F1-model_v4 | YciI family protein | 0.9761 | 1 | 131 |
|
| AF-A0A7H4GMW1-F1-model_v4 | YciI family protein | 0.9739 | 1 | 131 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar