F388278

General Info

Members Datasets Scaffolds Average Seq Length
287 233 171 234

Family's Representative Sequence

Representative Sequence 3300053111|Ga0500572_082605|Ga0500572_082605_158_958
Length 266
Sequence MQSDTAIIKPSVRAAHEEGLRFSSQWRSLMKLSAPIFQLKRRAKLVSRNKNVPLNEALDQIAREEGFARWSMLSARMTASPPSKSILPQLQNGDLLLLAGRPGHGKTMLALQLLIDAVDAKRSAVLFTLEYTEKQARKHIQSLDKASSGMSDAVEIVTSDEISADYIVNHLSGARPGTVAAIDYLQLLDQQRNKPPLSEQVRTLGEFARHAGVILGFISQIDRSFDPESKALPDINDVRLPNRVDLNHFTKAFFVHGGETQLETIA

Samples

Sample ID Description Type Environment
1 2509276019 Ensifer aridi TW10 Isolate Nodule
2 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
5 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
6 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
7 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
8 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
9 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
10 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
11 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
12 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
13 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
14 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
15 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
16 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
17 2643221599 Rhizobium sp. Root708 Isolate Unclassified
18 2643221607 Rhizobium sp. Root73 Isolate Unclassified
19 2643221618 Ensifer sp. Root231 Isolate Unclassified
20 2643221626 Ensifer sp. Root31 Isolate Unclassified
21 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
22 2643221655 Ensifer sp. Root1252 Isolate Unclassified
23 2643221659 Ensifer sp. Root127 Isolate Unclassified
24 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
25 2643221712 Ensifer sp. Root258 Isolate Unclassified
26 2738541293 Rhizobium sp. GV031 Isolate Unclassified
27 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
28 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
29 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
30 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
31 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
32 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
33 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
34 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
35 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
36 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
37 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
38 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
39 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
40 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
41 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
42 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
43 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
44 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
45 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
46 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
47 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
48 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
49 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
50 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
51 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
52 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
53 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
54 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
55 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
56 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
57 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
58 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
59 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
60 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
61 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
62 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
63 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
64 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
65 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
66 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
67 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
68 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
69 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
70 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
71 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
72 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
73 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
74 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
75 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
76 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
77 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
78 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
79 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
80 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
81 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
82 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
83 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
84 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
85 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
86 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
87 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
88 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
89 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
90 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
91 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
92 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
93 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
94 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
95 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
96 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
97 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
98 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
99 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
100 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
101 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
102 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
103 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
104 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
105 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
106 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
107 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
108 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
109 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
110 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
111 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
112 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
113 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
114 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
115 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
116 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
117 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
118 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
119 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
120 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
121 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
122 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
123 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
124 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
125 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
126 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
127 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
128 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
129 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
130 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
131 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
132 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
135 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
136 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
151 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
155 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
156 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
157 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
208 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
211 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
214 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
215 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
216 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
217 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
218 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
219 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
232 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
233 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 59.58
Metatranscriptomes 0
Isolates 40.42

Biome Distribution

Category Percentage (%)
Aerial Root 1.39
Bulb 0
Endosphere 25.09
Nodule 30.66
Rhizoplane 1.74
Rhizosphere 19.16
Stem 0
Stem Tuber 0
Unclassified 21.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000636 3300002739 Bacteria 6938
2 JGI25152J39213_1001379 3300002773 Bacteria 10569
3 JGI25150J39212_1010582 3300002774 Bacteria 1707
4 JGI25159J45721_1000773 3300002987 Bacteria 13918
5 JGI25151J46595_10044630 3300003187 Bacteria 1572
6 JGI25153J46596_10007708 3300003215 Bacteria 5247
7 JGI25161J50226_1000135 3300003374 Bacteria 51243
8 Ga0055526_1004210 3300003771 Bacteria 8738
9 Ga0055524_1029361 3300003775 Bacteria 1626
10 Ga0055528_1011314 3300003790 Bacteria 3555
11 Ga0055540_1001984 3300003792 Bacteria 11439
12 Ga0058692_1001687 3300003856 Bacteria 7920
13 Ga0058692_1002787 3300003856 Bacteria 5749
14 Ga0055543_1000219 3300004625 Bacteria 45978
15 Ga0065165_1001469 3300005262 Bacteria 25231
16 Ga0065165_1017331 3300005262 Bacteria 2658
17 Ga0065165_1037337 3300005262 Bacteria 1473
18 Ga0070670_100000416 3300005331 Bacteria 35091
19 Ga0070682_100180270 3300005337 Bacteria 1475
20 Ga0070665_100440027 3300005548 Bacteria 1313
21 Ga0075365_10217934 3300006038 Bacteria 1338
22 Ga0075369_10026459 3300006186 Bacteria 2418
23 Ga0079104_1010732 3300006946 Bacteria 2989
24 Ga0079104_1015868 3300006946 Bacteria 2218
25 Ga0099826_10000045 3300006948 Bacteria 75912
26 Ga0099826_10049525 3300006948 Bacteria 2833
27 Ga0105239_10656382 3300010375 Bacteria 1198
28 Ga0228711_1023823 3300022739 Bacteria 4463
29 Ga0228710_1017381 3300022740 Bacteria 7177
30 Ga0209436_100059 3300025208 Bacteria 60623
31 Ga0207425_1001907 3300025245 Bacteria 7916
32 Ga0209129_1003762 3300025258 Bacteria 6391
33 Ga0209129_1004246 3300025258 Bacteria 5733
34 Ga0209129_1006759 3300025258 Bacteria 3608
35 Ga0209673_1001628 3300025273 Bacteria 19496
36 Ga0209673_1003268 3300025273 Bacteria 9775
37 Ga0209130_1000004 3300025284 Bacteria 633436
38 Ga0209025_1010057 3300025294 Bacteria 6473
39 Ga0209564_1000362 3300025295 Bacteria 84376
40 Ga0209758_1001392 3300025297 Bacteria 28724
41 Ga0209758_1002232 3300025297 Bacteria 20129
42 Ga0209758_1002949 3300025297 Bacteria 16337
43 Ga0209256_1003465 3300025299 Bacteria 11036
44 Ga0209256_1014759 3300025299 Bacteria 2782
45 Ga0207426_1000003 3300025302 Bacteria 1063212
46 Ga0209051_1003439 3300025303 Bacteria 10378
47 Ga0207650_10001503 3300025925 Bacteria 16688
48 Ga0209281_1003946 3300027111 Bacteria 4607
49 Ga0209281_1007626 3300027111 Bacteria 2702
50 Ga0209371_1000003 3300027312 Bacteria 1122971
51 Ga0209371_1001175 3300027312 Bacteria 19137
52 Ga0209282_1000210 3300027666 Bacteria 31123
53 Ga0209282_1009857 3300027666 Bacteria 6036
54 Ga0209282_1038839 3300027666 Bacteria 2846
55 Ga0268256_1000004 3300030500 Bacteria 1122967
56 Ga0268256_1001628 3300030500 Bacteria 12994
57 Ga0307406_10008193 3300031901 Bacteria 5824
58 Ga0307412_10174617 3300031911 Bacteria 1610
59 Ga0315914_1016454 3300031967 Bacteria 7240
60 Ga0315913_1013022 3300033430 Bacteria 9141
61 Ga0315915_1000368 3300033464 Bacteria 44095
62 Ga0451833_0758632 3300041491 Bacteria 1410
63 Ga0451853_0082962 3300041512 Bacteria 858
64 Ga0495638_0011409 3300046460 Bacteria 6123
65 Ga0495638_0015376 3300046460 Bacteria 5140
66 Ga0495638_0020526 3300046460 Bacteria 4363
67 Ga0495607_0068559 3300046501 Bacteria 1989
68 Ga0495583_0073116 3300046506 Bacteria 1503
69 Ga0495610_0116916 3300046512 Bacteria 1174
70 Ga0495616_0056035 3300046513 Bacteria 1948
71 Ga0495620_0014058 3300046515 Bacteria 4081
72 Ga0495631_0030261 3300046518 Bacteria 2457
73 Ga0495637_0027845 3300046520 Bacteria 2525
74 Ga0495648_0113534 3300046524 Bacteria 1469
75 Ga0495654_0015585 3300046530 Bacteria 4033
76 Ga0495633_0018471 3300046558 Bacteria 3541
77 Ga0495625_0163362 3300046660 Bacteria 1490
78 Ga0495661_0023025 3300046665 Bacteria 4048
79 Ga0495588_0057618 3300046674 Bacteria 2007
80 Ga0495649_0017357 3300046694 Bacteria 4061
81 Ga0495660_0039495 3300046810 Bacteria 2621
82 Ga0495686_0167393 3300047472 Bacteria 1280
83 Ga0495626_0060707 3300048091 Bacteria 1722
84 Ga0496106_0000050 3300048909 Bacteria 96126
85 Ga0496116_0003557 3300048919 Bacteria 15322
86 Ga0496116_0012160 3300048919 Bacteria 7045
87 Ga0496116_0052288 3300048919 Bacteria 2707
88 Ga0496117_0011225 3300048920 Bacteria 8041
89 Ga0496117_0080579 3300048920 Bacteria 2140
90 Ga0496117_0202021 3300048920 Bacteria 1122
91 Ga0496118_0011089 3300048921 Bacteria 8846
92 Ga0496118_0213713 3300048921 Bacteria 1129
93 Ga0496119_0006282 3300048922 Bacteria 11079
94 Ga0496119_0241703 3300048922 Bacteria 914
95 Ga0496119_0260279 3300048922 Bacteria 871
96 Ga0496120_0027911 3300048923 Bacteria 3466
97 Ga0496120_0058928 3300048923 Bacteria 2154
98 Ga0496121_0013825 3300048924 Bacteria 8639
99 Ga0496121_0014357 3300048924 Bacteria 8414
100 Ga0496121_0021722 3300048924 Bacteria 6271
101 Ga0496122_0006210 3300048925 Bacteria 13856
102 Ga0496122_0017109 3300048925 Bacteria 6803
103 Ga0496122_0047835 3300048925 Bacteria 3296
104 Ga0496122_0049978 3300048925 Bacteria 3193
105 Ga0496122_0060216 3300048925 Bacteria 2797
106 Ga0496123_0003296 3300048926 Bacteria 18291
107 Ga0496123_0024654 3300048926 Bacteria 4565
108 Ga0496123_0040016 3300048926 Bacteria 3272
109 Ga0496123_0046031 3300048926 Bacteria 2963
110 Ga0496123_0127365 3300048926 Bacteria 1418
111 Ga0496124_0007465 3300048927 Bacteria 11611
112 Ga0496124_0364840 3300048927 Bacteria 1016
113 Ga0496125_0009476 3300048928 Bacteria 9996
114 Ga0496125_0023009 3300048928 Bacteria 5768
115 Ga0496125_0039251 3300048928 Bacteria 4080
116 Ga0496126_0064016 3300048929 Bacteria 3294
117 Ga0501031_0032878 3300049568 Bacteria 3382
118 Ga0501031_0170228 3300049568 Bacteria 1423
119 Ga0501032_0112017 3300049569 Bacteria 1805
120 Ga0501032_0212173 3300049569 Bacteria 1262
121 Ga0501033_0000081 3300049570 Bacteria 90181
122 Ga0501034_0143239 3300049571 Bacteria 2369
123 Ga0501034_0499048 3300049571 Bacteria 1131
124 Ga0501036_0236658 3300049572 Bacteria 1532
125 Ga0501038_0094623 3300049574 Bacteria 2497
126 Ga0501038_0204599 3300049574 Bacteria 1582
127 Ga0501039_0022136 3300049575 Bacteria 4878
128 Ga0501042_0377020 3300049578 Bacteria 1027
129 Ga0501046_0240201 3300049580 Bacteria 1336
130 Ga0501083_0082009 3300049744 Bacteria 2137
131 Ga0501280_003045 3300049776 Bacteria 2645
132 Ga0501035_0006090 3300049822 Bacteria 11357
133 Ga0501044_0068153 3300049823 Bacteria 3625
134 nmdc:mga00v17_317725_c1 3300050491 Bacteria 1012
135 nmdc:mga0yw44_82689_c2 3300050492 Bacteria 1524
136 nmdc:mga07m45_267106_c1 3300050496 Bacteria 995
137 Ga0500578_0188922 3300053086 Bacteria 1266
138 Ga0500643_010585 3300053087 Bacteria 3421
139 Ga0500581_169716 3300053089 Bacteria 1003
140 Ga0500647_0026338 3300053091 Bacteria 2742
141 Ga0500651_0021226 3300053093 Bacteria 4048
142 Ga0500651_0029739 3300053093 Bacteria 3437
143 Ga0500566_0001701 3300053094 Bacteria 12914
144 Ga0500650_0020355 3300053098 Bacteria 2909
145 Ga0500556_0000002 3300053104 Bacteria 773626
146 Ga0500569_072779 3300053109 Bacteria 1084
147 Ga0500572_082605 3300053111 Bacteria 1008
148 Ga0500592_001004 3300053116 Bacteria 4597
149 Ga0500608_000997 3300053122 Bacteria 10187
150 Ga0500618_000084 3300053125 Bacteria 76331
151 Ga0500618_000947 3300053125 Bacteria 14865
152 Ga0500618_004432 3300053125 Bacteria 4497
153 Ga0500642_0000034 3300053130 Bacteria 110440
154 Ga0500652_000255 3300053131 Bacteria 20007
155 Ga0500658_0002920 3300053134 Bacteria 6563
156 Ga0500658_0004487 3300053134 Bacteria 5211
157 Ga0500658_0079744 3300053134 Bacteria 1397
158 Ga0500559_0001473 3300053136 Bacteria 13295
159 Ga0500568_0000842 3300053139 Bacteria 21569
160 Ga0500568_0001733 3300053139 Bacteria 13525
161 Ga0500586_000223 3300053145 Bacteria 11205
162 Ga0500604_0004910 3300053151 Bacteria 3547
163 Ga0500604_0015094 3300053151 Bacteria 2110
164 Ga0500616_0000061 3300053153 Bacteria 249158
165 Ga0500620_035504 3300053155 Bacteria 1607
166 Ga0500622_0000275 3300053156 Bacteria 52724
167 Ga0500622_0004233 3300053156 Bacteria 9137
168 Ga0500627_0230355 3300053158 Bacteria 824
169 Ga0500633_0003251 3300053160 Bacteria 3511
170 Ga0500636_0000123 3300053177 Bacteria 40230
171 Ga0500636_0000319 3300053177 Bacteria 26564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0006282 Ga0496119_0006282_2587_3288 206
2 3300048923 Ga0496120_0027911 Ga0496120_0027911_2578_3279 206
3 3300003856 Ga0058692_1001687 Ga0058692_10016872 209
4 3300027312 Ga0209371_1000003 Ga0209371_1000003358 209
5 3300030500 Ga0268256_1000004 Ga0268256_1000004693 209
6 3300053125 Ga0500618_000947 Ga0500618_000947_10326_11039 212
7 3300006948 Ga0099826_10000045 Ga0099826_1000004546 218
8 3300006948 Ga0099826_10049525 Ga0099826_100495252 218
9 3300027666 Ga0209282_1000210 Ga0209282_100021026 218
10 3300027666 Ga0209282_1038839 Ga0209282_10388394 218
11 3300048928 Ga0496125_0023009 Ga0496125_0023009_271_972 218
12 3300046558 Ga0495633_0018471 Ga0495633_0018471_560_1273 219
13 3300048919 Ga0496116_0052288 Ga0496116_0052288_66_779 219
14 3300048924 Ga0496121_0014357 Ga0496121_0014357_5314_6027 219
15 3300048925 Ga0496122_0049978 Ga0496122_0049978_170_883 219
16 3300048926 Ga0496123_0046031 Ga0496123_0046031_110_823 219
17 3300048927 Ga0496124_0364840 Ga0496124_0364840_155_868 219
18 3300005331 Ga0070670_100000416 Ga0070670_10000041620 221
19 3300025925 Ga0207650_10001503 Ga0207650_100015032 221
20 3300006946 Ga0079104_1015868 Ga0079104_10158682 222
21 3300027111 Ga0209281_1007626 Ga0209281_10076265 222
22 iso_pu_bacteria 2937056579 2937060813 225
23 iso_pu_bacteria 2964607997 2964613445 225
24 3300003856 Ga0058692_1002787 Ga0058692_10027872 226
25 iso_pu_bacteria 2600255279 2601612872 227
26 iso_pu_bacteria 2600255308 2601749601 227
27 iso_pu_bacteria 2818991439 2819557614 227
28 iso_pu_bacteria 2933594066 2933597330 227
29 iso_pu_bacteria 8054563764 8054567340 227
30 iso_pu_bacteria 2979100975 2979102656 228
31 iso_pu_bacteria 2984509177 2984509458 228
32 iso_pu_bacteria 2984518228 2984519842 228
33 iso_pu_bacteria 2984537506 2984537792 228
34 iso_pu_bacteria 2523231067 2523470828 229
35 iso_pu_bacteria 2509276019 2509380582 230
36 iso_pu_bacteria 2510065057 2510303414 230
37 iso_pu_bacteria 2510917030 2511195446 230
38 iso_pu_bacteria 2513237091 2513616077 230
39 iso_pu_bacteria 2513237140 2513884721 230
40 iso_pu_bacteria 2513237140 2513886004 230
41 iso_pu_bacteria 2513237143 2513905116 230
42 iso_pu_bacteria 2513237146 2513928950 230
43 iso_pu_bacteria 2582581283 2585165919 230
44 iso_pu_bacteria 2582581298 2585224522 230
45 iso_pu_bacteria 2585427529 2585546643 230
46 iso_pu_bacteria 2599185170 2599414968 230
47 iso_pu_bacteria 2602042107 2603861458 230
48 iso_pu_bacteria 2643221599 2644007559 230
49 iso_pu_bacteria 2643221607 2644049252 230
50 iso_pu_bacteria 2643221618 2644108156 230
51 iso_pu_bacteria 2643221626 2644145957 230
52 iso_pu_bacteria 2643221636 2644204403 230
53 iso_pu_bacteria 2643221655 2644312152 230
54 iso_pu_bacteria 2643221659 2644335764 230
55 iso_pu_bacteria 2643221686 2644482286 230
56 iso_pu_bacteria 2643221712 2644617822 230
57 iso_pu_bacteria 2738541293 2738803843 230
58 iso_pu_bacteria 2738543031 2739351435 230
59 iso_pu_bacteria 2765235802 2765463994 230
60 iso_pu_bacteria 2775506902 2776271095 230
61 iso_pu_bacteria 2775506904 2776282988 230
62 iso_pu_bacteria 2775507049 2776912429 230
63 iso_pu_bacteria 2818991461 2819685108 230
64 iso_pu_bacteria 2838035591 2838039306 230
65 iso_pu_bacteria 2839993093 2839993938 230
66 iso_pu_bacteria 2841859092 2841860043 230
67 iso_pu_bacteria 2841864319 2841869392 230
68 iso_pu_bacteria 2842217011 2842223575 230
69 iso_pu_bacteria 2842341865 2842346105 230
70 iso_pu_bacteria 2842363717 2842367929 230
71 iso_pu_bacteria 2842515876 2842516828 230
72 iso_pu_bacteria 2850079185 2850085695 230
73 iso_pu_bacteria 2855825444 2855827977 230
74 iso_pu_bacteria 2855839649 2855839750 230
75 iso_pu_bacteria 2857524615 2857528436 230
76 iso_pu_bacteria 2858800743 2858803627 230
77 iso_pu_bacteria 2893066018 2893068847 230
78 iso_pu_bacteria 2915993759 2915997242 230
79 iso_pu_bacteria 2916028427 2916031491 230
80 iso_pu_bacteria 2916041962 2916045086 230
81 iso_pu_bacteria 2916048683 2916053582 230
82 iso_pu_bacteria 2916055098 2916057042 230
83 iso_pu_bacteria 2916076590 2916079743 230
84 iso_pu_bacteria 2919073203 2919075889 230
85 iso_pu_bacteria 2919100787 2919106804 230
86 iso_pu_bacteria 2921201388 2921207511 230
87 iso_pu_bacteria 2921263974 2921268788 230
88 iso_pu_bacteria 2924150972 2924154299 230
89 iso_pu_bacteria 2924158325 2924164671 230
90 iso_pu_bacteria 2933011516 2933012530 230
91 iso_pu_bacteria 2936996657 2937002394 230
92 iso_pu_bacteria 2937042894 2937047420 230
93 iso_pu_bacteria 2937049772 2937053291 230
94 iso_pu_bacteria 2937063883 2937066803 230
95 iso_pu_bacteria 2937091812 2937098715 230
96 iso_pu_bacteria 2937098957 2937102774 230
97 iso_pu_bacteria 2937106411 2937106488 230
98 iso_pu_bacteria 2957388812 2957393307 230
99 iso_pu_bacteria 2957443900 2957447370 230
100 iso_pu_bacteria 2957478035 2957481907 230
101 iso_pu_bacteria 2960610863 2960611650 230
102 iso_pu_bacteria 2960617483 2960620100 230
103 iso_pu_bacteria 2960624210 2960626697 230
104 iso_pu_bacteria 2960652885 2960654403 230
105 iso_pu_bacteria 2960660292 2960660654 230
106 iso_pu_bacteria 2960667422 2960670674 230
107 iso_pu_bacteria 2960667422 2960672112 230
108 iso_pu_bacteria 2960687367 2960687429 230
109 iso_pu_bacteria 2964636051 2964637475 230
110 iso_pu_bacteria 2964649959 2964650089 230
111 iso_pu_bacteria 2964656573 2964661647 230
112 iso_pu_bacteria 2967664464 2967667485 230
113 iso_pu_bacteria 2967678726 2967682566 230
114 iso_pu_bacteria 2967693043 2967694828 230
115 iso_pu_bacteria 2967714385 2967714422 230
116 iso_pu_bacteria 2967721400 2967723746 230
117 iso_pu_bacteria 2967735183 2967739172 230
118 iso_pu_bacteria 2967762386 2967768925 230
119 iso_pu_bacteria 2967775926 2967780075 230
120 iso_pu_bacteria 2970019648 2970021261 230
121 iso_pu_bacteria 2970033650 2970037453 230
122 iso_pu_bacteria 2970040964 2970041038 230
123 iso_pu_bacteria 2970047711 2970054011 230
124 iso_pu_bacteria 2970068827 2970074611 230
125 iso_pu_bacteria 2970082768 2970088113 230
126 iso_pu_bacteria 2970116247 2970118186 230
127 iso_pu_bacteria 2970129317 2970131326 230
128 iso_pu_bacteria 2970177841 2970183582 230
129 iso_pu_bacteria 2970184632 2970188769 230
130 iso_pu_bacteria 2977516862 2977521038 230
131 iso_pu_bacteria 2977551784 2977554745 230
132 iso_pu_bacteria 2977579622 2977584362 230
133 iso_pu_bacteria 2984587000 2984590609 230
134 iso_pu_bacteria 3005445848 3005447671 230
135 iso_pu_bacteria 3005452660 3005453068 230
136 iso_pu_bacteria 643348564 643664329 230
137 iso_pu_bacteria 8003992118 8003992205 230
138 3300053134 Ga0500658_0002920 Ga0500658_0002920_485_1195 231
139 iso_pu_bacteria 2512047086 2512530784 231
140 3300048925 Ga0496122_0017109 Ga0496122_0017109_1048_1758 233
141 3300053091 Ga0500647_0026338 Ga0500647_0026338_1462_2169 233
142 3300002739 JGI25158J39367_1000636 JGI25158J39367_10006368 234
143 3300002773 JGI25152J39213_1001379 JGI25152J39213_100137912 234
144 3300002774 JGI25150J39212_1010582 JGI25150J39212_10105823 234
145 3300002987 JGI25159J45721_1000773 JGI25159J45721_10007737 234
146 3300003187 JGI25151J46595_10044630 JGI25151J46595_100446302 234
147 3300003215 JGI25153J46596_10007708 JGI25153J46596_100077085 234
148 3300003374 JGI25161J50226_1000135 JGI25161J50226_10001357 234
149 3300003771 Ga0055526_1004210 Ga0055526_10042102 234
150 3300003775 Ga0055524_1029361 Ga0055524_10293613 234
151 3300003790 Ga0055528_1011314 Ga0055528_10113144 234
152 3300003792 Ga0055540_1001984 Ga0055540_10019844 234
153 3300004625 Ga0055543_1000219 Ga0055543_100021915 234
154 3300005262 Ga0065165_1001469 Ga0065165_100146918 234
155 3300005262 Ga0065165_1017331 Ga0065165_10173312 234
156 3300005262 Ga0065165_1037337 Ga0065165_10373372 234
157 3300005337 Ga0070682_100180270 Ga0070682_1001802702 234
158 3300005548 Ga0070665_100440027 Ga0070665_1004400272 234
159 3300006038 Ga0075365_10217934 Ga0075365_102179342 234
160 3300006186 Ga0075369_10026459 Ga0075369_100264591 234
161 3300006946 Ga0079104_1010732 Ga0079104_10107324 234
162 3300010375 Ga0105239_10656382 Ga0105239_106563821 234
163 3300022739 Ga0228711_1023823 Ga0228711_10238234 234
164 3300022740 Ga0228710_1017381 Ga0228710_10173814 234
165 3300025208 Ga0209436_100059 Ga0209436_10005960 234
166 3300025245 Ga0207425_1001907 Ga0207425_10019078 234
167 3300025258 Ga0209129_1003762 Ga0209129_10037621 234
168 3300025258 Ga0209129_1004246 Ga0209129_10042465 234
169 3300025258 Ga0209129_1006759 Ga0209129_10067592 234
170 3300025273 Ga0209673_1001628 Ga0209673_10016282 234
171 3300025273 Ga0209673_1003268 Ga0209673_10032685 234
172 3300025284 Ga0209130_1000004 Ga0209130_1000004369 234
173 3300025294 Ga0209025_1010057 Ga0209025_10100579 234
174 3300025295 Ga0209564_1000362 Ga0209564_100036250 234
175 3300025297 Ga0209758_1001392 Ga0209758_100139222 234
176 3300025297 Ga0209758_1002232 Ga0209758_100223226 234
177 3300025297 Ga0209758_1002949 Ga0209758_100294922 234
178 3300025299 Ga0209256_1003465 Ga0209256_10034652 234
179 3300025299 Ga0209256_1014759 Ga0209256_10147591 234
180 3300025302 Ga0207426_1000003 Ga0207426_1000003358 234
181 3300025303 Ga0209051_1003439 Ga0209051_10034399 234
182 3300027111 Ga0209281_1003946 Ga0209281_10039464 234
183 3300027312 Ga0209371_1001175 Ga0209371_10011758 234
184 3300027666 Ga0209282_1009857 Ga0209282_10098574 234
185 3300030500 Ga0268256_1001628 Ga0268256_10016286 234
186 3300031901 Ga0307406_10008193 Ga0307406_100081933 234
187 3300031911 Ga0307412_10174617 Ga0307412_101746172 234
188 3300031967 Ga0315914_1016454 Ga0315914_10164546 234
189 3300033430 Ga0315913_1013022 Ga0315913_10130224 234
190 3300033464 Ga0315915_1000368 Ga0315915_10003684 234
191 3300041491 Ga0451833_0758632 Ga0451833_0758632_549_1262 234
192 3300041512 Ga0451853_0082962 Ga0451853_0082962_73_786 234
193 3300046460 Ga0495638_0011409 Ga0495638_0011409_4851_5564 234
194 3300046460 Ga0495638_0015376 Ga0495638_0015376_2634_3347 234
195 3300046460 Ga0495638_0020526 Ga0495638_0020526_2634_3347 234
196 3300046501 Ga0495607_0068559 Ga0495607_0068559_77_790 234
197 3300046506 Ga0495583_0073116 Ga0495583_0073116_664_1377 234
198 3300046512 Ga0495610_0116916 Ga0495610_0116916_447_1160 234
199 3300046513 Ga0495616_0056035 Ga0495616_0056035_1166_1879 234
200 3300046515 Ga0495620_0014058 Ga0495620_0014058_1985_2698 234
201 3300046518 Ga0495631_0030261 Ga0495631_0030261_40_753 234
202 3300046520 Ga0495637_0027845 Ga0495637_0027845_538_1251 234
203 3300046524 Ga0495648_0113534 Ga0495648_0113534_337_1050 234
204 3300046530 Ga0495654_0015585 Ga0495654_0015585_1856_2569 234
205 3300046660 Ga0495625_0163362 Ga0495625_0163362_501_1214 234
206 3300046665 Ga0495661_0023025 Ga0495661_0023025_3207_3920 234
207 3300046674 Ga0495588_0057618 Ga0495588_0057618_1117_1830 234
208 3300046694 Ga0495649_0017357 Ga0495649_0017357_2510_3220 234
209 3300046810 Ga0495660_0039495 Ga0495660_0039495_717_1430 234
210 3300047472 Ga0495686_0167393 Ga0495686_0167393_77_790 234
211 3300048091 Ga0495626_0060707 Ga0495626_0060707_954_1667 234
212 3300048909 Ga0496106_0000050 Ga0496106_0000050_6355_7065 234
213 3300048919 Ga0496116_0003557 Ga0496116_0003557_6892_7605 234
214 3300048919 Ga0496116_0012160 Ga0496116_0012160_309_1022 234
215 3300048920 Ga0496117_0011225 Ga0496117_0011225_2061_2774 234
216 3300048920 Ga0496117_0080579 Ga0496117_0080579_390_1103 234
217 3300048920 Ga0496117_0202021 Ga0496117_0202021_243_953 234
218 3300048921 Ga0496118_0011089 Ga0496118_0011089_2758_3471 234
219 3300048921 Ga0496118_0213713 Ga0496118_0213713_339_1052 234
220 3300048922 Ga0496119_0241703 Ga0496119_0241703_26_739 234
221 3300048922 Ga0496119_0260279 Ga0496119_0260279_38_751 234
222 3300048923 Ga0496120_0058928 Ga0496120_0058928_782_1495 234
223 3300048924 Ga0496121_0013825 Ga0496121_0013825_7850_8563 234
224 3300048924 Ga0496121_0021722 Ga0496121_0021722_4599_5309 234
225 3300048925 Ga0496122_0006210 Ga0496122_0006210_6701_7411 234
226 3300048925 Ga0496122_0047835 Ga0496122_0047835_298_1011 234
227 3300048925 Ga0496122_0060216 Ga0496122_0060216_1448_2161 234
228 3300048926 Ga0496123_0003296 Ga0496123_0003296_12695_13408 234
229 3300048926 Ga0496123_0024654 Ga0496123_0024654_983_1693 234
230 3300048926 Ga0496123_0040016 Ga0496123_0040016_2059_2772 234
231 3300048926 Ga0496123_0127365 Ga0496123_0127365_379_1092 234
232 3300048927 Ga0496124_0007465 Ga0496124_0007465_341_1054 234
233 3300048928 Ga0496125_0009476 Ga0496125_0009476_3770_4483 234
234 3300048928 Ga0496125_0039251 Ga0496125_0039251_582_1292 234
235 3300048929 Ga0496126_0064016 Ga0496126_0064016_72_785 234
236 3300049568 Ga0501031_0032878 Ga0501031_0032878_58_771 234
237 3300049568 Ga0501031_0170228 Ga0501031_0170228_68_793 234
238 3300049569 Ga0501032_0112017 Ga0501032_0112017_506_1219 234
239 3300049569 Ga0501032_0212173 Ga0501032_0212173_493_1218 234
240 3300049570 Ga0501033_0000081 Ga0501033_0000081_9437_10162 234
241 3300049571 Ga0501034_0143239 Ga0501034_0143239_939_1652 234
242 3300049571 Ga0501034_0499048 Ga0501034_0499048_93_806 234
243 3300049572 Ga0501036_0236658 Ga0501036_0236658_182_886 234
244 3300049574 Ga0501038_0094623 Ga0501038_0094623_1080_1805 234
245 3300049574 Ga0501038_0204599 Ga0501038_0204599_528_1241 234
246 3300049575 Ga0501039_0022136 Ga0501039_0022136_842_1567 234
247 3300049578 Ga0501042_0377020 Ga0501042_0377020_55_780 234
248 3300049580 Ga0501046_0240201 Ga0501046_0240201_290_1015 234
249 3300049744 Ga0501083_0082009 Ga0501083_0082009_1314_2018 234
250 3300049776 Ga0501280_003045 Ga0501280_003045_1667_2380 234
251 3300049822 Ga0501035_0006090 Ga0501035_0006090_1202_1927 234
252 3300049823 Ga0501044_0068153 Ga0501044_0068153_695_1408 234
253 3300050491 nmdc:mga00v17_317725_c1 nmdc:mga00v17_317725_c1_276_989 234
254 3300050492 nmdc:mga0yw44_82689_c2 nmdc:mga0yw44_82689_c2_44_757 234
255 3300050496 nmdc:mga07m45_267106_c1 nmdc:mga07m45_267106_c1_46_777 234
256 3300053086 Ga0500578_0188922 Ga0500578_0188922_321_1034 234
257 3300053087 Ga0500643_010585 Ga0500643_010585_2272_2985 234
258 3300053089 Ga0500581_169716 Ga0500581_169716_241_954 234
259 3300053093 Ga0500651_0021226 Ga0500651_0021226_3297_4010 234
260 3300053093 Ga0500651_0029739 Ga0500651_0029739_1613_2326 234
261 3300053094 Ga0500566_0001701 Ga0500566_0001701_12103_12816 234
262 3300053098 Ga0500650_0020355 Ga0500650_0020355_230_943 234
263 3300053104 Ga0500556_0000002 Ga0500556_0000002_154304_155017 234
264 3300053109 Ga0500569_072779 Ga0500569_072779_139_852 234
265 3300053111 Ga0500572_082605 Ga0500572_082605_158_958 234
266 3300053116 Ga0500592_001004 Ga0500592_001004_2692_3405 234
267 3300053122 Ga0500608_000997 Ga0500608_000997_8872_9585 234
268 3300053125 Ga0500618_000084 Ga0500618_000084_44455_45168 234
269 3300053125 Ga0500618_004432 Ga0500618_004432_2932_3645 234
270 3300053130 Ga0500642_0000034 Ga0500642_0000034_22715_23428 234
271 3300053131 Ga0500652_000255 Ga0500652_000255_16784_17497 234
272 3300053134 Ga0500658_0004487 Ga0500658_0004487_2128_2838 234
273 3300053134 Ga0500658_0079744 Ga0500658_0079744_258_971 234
274 3300053136 Ga0500559_0001473 Ga0500559_0001473_3850_4563 234
275 3300053139 Ga0500568_0000842 Ga0500568_0000842_3021_3734 234
276 3300053139 Ga0500568_0001733 Ga0500568_0001733_2916_3626 234
277 3300053145 Ga0500586_000223 Ga0500586_000223_2466_3179 234
278 3300053151 Ga0500604_0004910 Ga0500604_0004910_2768_3478 234
279 3300053151 Ga0500604_0015094 Ga0500604_0015094_993_1706 234
280 3300053153 Ga0500616_0000061 Ga0500616_0000061_22387_23100 234
281 3300053155 Ga0500620_035504 Ga0500620_035504_440_1150 234
282 3300053156 Ga0500622_0000275 Ga0500622_0000275_41603_42313 234
283 3300053156 Ga0500622_0004233 Ga0500622_0004233_6853_7566 234
284 3300053158 Ga0500627_0230355 Ga0500627_0230355_19_732 234
285 3300053160 Ga0500633_0003251 Ga0500633_0003251_2533_3243 234
286 3300053177 Ga0500636_0000123 Ga0500636_0000123_35002_35715 234
287 3300053177 Ga0500636_0000319 Ga0500636_0000319_22829_23542 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03796

DnaB_C

DnaB-like helicase C terminal domain

84

150

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fux-assembly1.cif.gz_B catalytic domain of thymidine kinase from trypanosoma brucei with dtmp 0.8153 62 190
5fuw-assembly1.cif.gz_B-2 catalytic domain of thymidine kinase from trypanosoma brucei with dtmp or dthd 0.8151 62 190
4uxi-assembly1.cif.gz_A-2 leishmania major thymidine kinase in complex with thymidine 0.793 63 186
6kza-assembly1.cif.gz_A crystal structure of the complex of the interaction domains of e. coli dnab helicase and dnac helicase loader 0.7788 59 222
5fuv-assembly1.cif.gz_A-2 catalytic domain of thymidine kinase from trypanosoma brucei with dthd 0.7787 62 190
ID Description Score Start End Superfamily
af_P9WHJ9_62_274_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7551 61 222 3.40.50.300
af_Q2FUP7_135_413_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.754 42 222 3.40.50.300
af_Q54J94_514_760_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7488 50 230 3.40.50.300
2q6tA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7442 59 222 3.40.50.300
3e2iA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7431 63 186 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4R2U7I6-F1-model_v4 deleted 0.9742 123 234
AF-F7X2M0-F1-model_v4 KaiC-like domain-containing protein 0.9669 65 234
AF-A0A0E4BWW1-F1-model_v4 Replicative DNA helicase 0.9594 149 234 GO:0003678
GO:0005524
GO:0006260
AF-A0A526U3B1-F1-model_v4 DNA helicase 0.9547 70 234 GO:0004386
AF-F7X2M0-F1-model_v4 KaiC-like domain-containing protein 0.9505 65 234

Feature Viewer

pLDDT pTM Quality
88.37 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map