F388294

General Info

Members Datasets Scaffolds Average Seq Length
287 232 574 382

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2523231067|2523467740
Length 386
Sequence EKIAAIAGEAVLWRRDLHRRPELLYALDETSAFVAQKLNAFGLDEVVTGVGGSGVVGVLRGRPGNRAVGLRADMDALPIEEITGAAWASEKPGAMHACGHDGHTATLLAAARRLAADRDFAGTVVFVFQPAEEGGAGAKAMIEDGLFDRFPVDEIYGIHNLPGLPVGRFAVRHGAIMASTDRFYIDILGRGGHAARPQETIDPILVGSQVVTALQSIVARNTDPLASGVVSVTTFHAGNTDNVIPQTARLSGTVRALDGRVRGELEASVSRIATTVATAFGAEARVLYERGYPVTVNHAAAAERVGDVVESLLGQSAIDRTAAPLMAAEDFSYYLERVPGAYFFMGNGPSAGLHHPAYDFADDAIAPGAAVWTALAKASLSAASQA

Samples

Sample ID Description Type Environment
1 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
23 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
27 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
29 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
30 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
42 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
43 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
48 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
49 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
50 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
51 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
52 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
53 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
57 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
58 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
59 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
60 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
61 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
62 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
63 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
64 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
65 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
66 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
69 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
70 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
71 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
72 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
73 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
74 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
75 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
76 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
77 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
78 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
79 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
80 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
81 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
82 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
83 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
84 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
85 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
86 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
87 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
88 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
89 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
90 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
91 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
92 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
93 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
94 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
95 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
96 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
97 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
98 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
99 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
100 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
101 2519899620 Rhizobium sp. Pop5 Isolate Nodule
102 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
103 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
104 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
105 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
106 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
107 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
108 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
109 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
110 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
111 2643221599 Rhizobium sp. Root708 Isolate Unclassified
112 2643221618 Ensifer sp. Root231 Isolate Unclassified
113 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
114 2643221626 Ensifer sp. Root31 Isolate Unclassified
115 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
116 2643221655 Ensifer sp. Root1252 Isolate Unclassified
117 2643221659 Ensifer sp. Root127 Isolate Unclassified
118 2643221698 Ensifer sp. Root142 Isolate Unclassified
119 2643221712 Ensifer sp. Root258 Isolate Unclassified
120 2643221729 Bacillus sp. Root11 Isolate Unclassified
121 2643221730 Bacillus sp. Root131 Isolate Unclassified
122 2684622632 Bacillus cereus 905 Isolate Unclassified
123 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
124 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
125 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
126 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
127 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
128 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
129 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
130 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
131 2718218365 Rhizobium sp. N731 Isolate Nodule
132 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
133 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
134 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
135 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
136 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
137 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
138 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
139 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
140 2728369397 Rhizobium sp. N1314 Isolate Nodule
141 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
142 2738541358 Bacillus sp. OV752 Isolate Unclassified
143 2738543006 Bacillus sp. OK077 Isolate Unclassified
144 2738543024 Aminobacter sp. AP02 Isolate Unclassified
145 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
146 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
147 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
148 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
149 2773857925 Microvirga vignae BR3299 Isolate Unclassified
150 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
151 2791355256 Rhizobium sp. M10 Isolate Nodule
152 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
153 2791355261 Rhizobium sp. J15 Isolate Nodule
154 2791355262 Rhizobium sp. M1 Isolate Nodule
155 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
156 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
157 2802429633 Rhizobium anhuiense J3 Isolate Nodule
158 2802429634 Rhizobium anhuiense S10 Isolate Nodule
159 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
160 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
161 2802429637 Rhizobium anhuiense C15 Isolate Nodule
162 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
163 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
164 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
165 2838048938 Rhizobium pisi 27/80 Isolate Nodule
166 2838061910 Rhizobium phaseoli L15 Isolate Nodule
167 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
168 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
169 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
170 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
171 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
172 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
173 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
174 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
175 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
176 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
177 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
178 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
179 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
180 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
181 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
182 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
183 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
184 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
185 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
186 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
187 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
188 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
189 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
190 2844163670 Ensifer sp. 1H6 Isolate Unclassified
191 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
192 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
193 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
194 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
195 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
196 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
197 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
198 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
199 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
200 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
201 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
202 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
203 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
204 2933599457 Rhizobium phaseoli M3 Isolate Nodule
205 2938917290 Bacillus sp. CR71 Isolate Unclassified
206 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
207 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
208 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
209 2965761152 Bacillus sp. COPE52 Isolate Unclassified
210 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
211 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
212 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
213 2996893221 Rhizobium sp. R635 Isolate Nodule
214 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
215 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
216 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
217 8005382845 Rhizobium sp. R634 Isolate Nodule
218 8005395548 Rhizobium sp. R339 Isolate Nodule
219 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
220 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
221 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
222 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
223 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
224 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
225 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
226 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
227 8022792930 Bacillus sp. Xin Isolate Rhizosphere
228 8023438354 Bacillus sp. BH2 Isolate Unclassified
229 8023444577 Bacillus sp. BH32 Isolate Unclassified
230 8024501048 Rhizobium sp. H4 Isolate Nodule
231 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
232 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 50.52
Metatranscriptomes 0
Isolates 49.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.18
Nodule 28.57
Rhizoplane 2.79
Rhizosphere 18.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1002299 3300002739 Bacteria 3145
2 JGI25152J39213_1001304 3300002773 Bacteria 11151
3 JGI25159J45721_1001122 3300002987 Bacteria 11451
4 JGI25159J45721_1001664 3300002987 Bacteria 9005
5 JGI25151J46595_10002498 3300003187 Bacteria 10972
6 JGI25151J46595_10002643 3300003187 Bacteria 10548
7 JGI25151J46595_10016846 3300003187 Bacteria 3187
8 JGI25151J46595_10026387 3300003187 Bacteria 2345
9 JGI25151J46595_10045727 3300003187 Bacteria 1542
10 JGI25153J46596_10003331 3300003215 Bacteria 9026
11 JGI25153J46596_10009375 3300003215 Bacteria 4560
12 JGI25153J46596_10010946 3300003215 Bacteria 4053
13 JGI25153J46596_10012161 3300003215 Bacteria 3740
14 JGI25160J50197_1006532 3300003354 Bacteria 4705
15 JGI25161J50226_1000107 3300003374 Bacteria 65408
16 Ga0055526_1001730 3300003771 Bacteria 15178
17 Ga0055526_1012791 3300003771 Bacteria 3622
18 Ga0055524_1004185 3300003775 Bacteria 6729
19 Ga0055524_1012744 3300003775 Bacteria 3210
20 Ga0055528_1000496 3300003790 Bacteria 31066
21 Ga0055528_1006645 3300003790 Bacteria 5219
22 Ga0055543_1000582 3300004625 Bacteria 20167
23 Ga0065165_1010425 3300005262 Bacteria 4017
24 Ga0081540_1025053 3300005983 Bacteria 3445
25 Ga0075365_10005063 3300006038 Bacteria 7072
26 Ga0075364_10001571 3300006051 Bacteria 12488
27 Ga0075367_10031768 3300006178 Bacteria 3034
28 Ga0075370_10087053 3300006353 Bacteria 1800
29 Ga0105244_10010834 3300009036 Bacteria 5504
30 Ga0105244_10059203 3300009036 Bacteria 1931
31 Ga0105244_10065586 3300009036 Bacteria 1819
32 Ga0105250_10012057 3300009092 Bacteria 3578
33 Ga0105250_10025430 3300009092 Bacteria 2385
34 Ga0105250_10028970 3300009092 Bacteria 2228
35 Ga0105250_10053988 3300009092 Bacteria 1611
36 Ga0105248_10283549 3300009177 Bacteria 1865
37 Ga0105238_10289695 3300009551 Bacteria 1619
38 Ga0123341_1000098 3300009765 Bacteria 37289
39 Ga0123342_1003939 3300009766 Bacteria 23272
40 Ga0123342_1011467 3300009766 Bacteria 9667
41 Ga0105246_10034353 3300011119 Bacteria 3378
42 Ga0157380_10115366 3300014326 Bacteria 2265
43 Ga0209436_100011 3300025208 Bacteria 139405
44 Ga0209147_102123 3300025229 Bacteria 5514
45 Ga0207425_1003107 3300025245 Bacteria 5483
46 Ga0207425_1004417 3300025245 Bacteria 4227
47 Ga0209129_1000256 3300025258 Bacteria 55133
48 Ga0209129_1000727 3300025258 Bacteria 21221
49 Ga0209129_1000992 3300025258 Bacteria 16987
50 Ga0209129_1001878 3300025258 Bacteria 11089
51 Ga0209673_1000294 3300025273 Bacteria 93050
52 Ga0209673_1003792 3300025273 Bacteria 8587
53 Ga0209673_1023378 3300025273 Bacteria 2106
54 Ga0209130_1000081 3300025284 Bacteria 166440
55 Ga0209130_1001393 3300025284 Bacteria 16214
56 Ga0209130_1003523 3300025284 Bacteria 6571
57 Ga0209025_1000258 3300025294 Bacteria 124837
58 Ga0209025_1000260 3300025294 Bacteria 124240
59 Ga0209025_1000578 3300025294 Bacteria 66380
60 Ga0209025_1003369 3300025294 Bacteria 15282
61 Ga0209025_1010861 3300025294 Bacteria 6103
62 Ga0209025_1046330 3300025294 Bacteria 1789
63 Ga0209025_1056811 3300025294 Bacteria 1501
64 Ga0209564_1000225 3300025295 Bacteria 126209
65 Ga0209564_1002083 3300025295 Bacteria 17152
66 Ga0209758_1000113 3300025297 Bacteria 202528
67 Ga0209758_1000463 3300025297 Bacteria 67158
68 Ga0209758_1001254 3300025297 Bacteria 31419
69 Ga0209758_1005068 3300025297 Bacteria 10441
70 Ga0209758_1022327 3300025297 Bacteria 2908
71 Ga0209256_1000719 3300025299 Bacteria 43868
72 Ga0209256_1008899 3300025299 Bacteria 4531
73 Ga0209256_1010862 3300025299 Bacteria 3742
74 Ga0209256_1012120 3300025299 Bacteria 3349
75 Ga0207426_1000008 3300025302 Bacteria 848730
76 Ga0207426_1002724 3300025302 Bacteria 10742
77 Ga0209051_1002519 3300025303 Bacteria 12995
78 Ga0207696_1001418 3300025711 Bacteria 13070
79 Ga0207696_1007148 3300025711 Bacteria 4405
80 Ga0207655_1023159 3300025728 Bacteria 3089
81 Ga0207713_1065772 3300025735 Bacteria 1360
82 Ga0307515_10013948 3300028794 Bacteria 14957
83 Ga0237817_10140 3300030083 Bacteria 21841
84 Ga0237817_10513 3300030083 Bacteria 5031
85 Ga0265330_10038156 3300031235 Bacteria 2136
86 Ga0265325_10014579 3300031241 Bacteria 4437
87 Ga0265339_10004217 3300031249 Bacteria 9844
88 Ga0265316_10125456 3300031344 Bacteria 1936
89 Ga0265314_10045235 3300031711 Bacteria 3114
90 Ga0265314_10089398 3300031711 Bacteria 2009
91 Ga0265342_10067661 3300031712 Bacteria 2090
92 Ga0237819_00063 3300038705 Bacteria 37959
93 Ga0237819_00265 3300038705 Bacteria 19088
94 Ga0436361_0541183 3300039447 Bacteria 2170
95 Ga0439465_0036538 3300041413 Bacteria 1578
96 Ga0451847_0244573 3300041503 Bacteria 1865
97 Ga0451843_0248735 3300041509 Bacteria 1806
98 Ga0451853_2568499 3300041512 Bacteria 3207
99 Ga0466967_0000124 3300045976 Bacteria 29142
100 Ga0495638_0031038 3300046460 Bacteria 3435
101 Ga0495583_0030343 3300046506 Bacteria 2634
102 Ga0495610_0005461 3300046512 Bacteria 9026
103 Ga0495643_0012721 3300046522 Bacteria 5065
104 Ga0495643_0013858 3300046522 Bacteria 4810
105 Ga0495654_0000152 3300046530 Bacteria 70943
106 Ga0495625_0015656 3300046660 Bacteria 5997
107 Ga0496101_0086202 3300048904 Bacteria 2329
108 Ga0496102_0112697 3300048905 Bacteria 2537
109 Ga0496103_0112391 3300048906 Bacteria 1731
110 Ga0496105_0044205 3300048908 Bacteria 3673
111 Ga0496106_0000038 3300048909 Bacteria 111983
112 Ga0496106_0099381 3300048909 Bacteria 2256
113 Ga0496108_0051334 3300048911 Bacteria 3455
114 Ga0496116_0060120 3300048919 Bacteria 2466
115 Ga0496117_0090509 3300048920 Bacteria 1971
116 Ga0496118_0103936 3300048921 Bacteria 1909
117 Ga0496120_0013641 3300048923 Bacteria 5461
118 Ga0496121_0082093 3300048924 Bacteria 2549
119 Ga0496121_0083291 3300048924 Bacteria 2525
120 Ga0496121_0169755 3300048924 Bacteria 1586
121 Ga0496122_0008036 3300048925 Bacteria 11516
122 Ga0496122_0021209 3300048925 Bacteria 5827
123 Ga0496122_0060508 3300048925 Bacteria 2789
124 Ga0496123_0010080 3300048926 Bacteria 8406
125 Ga0496124_0008622 3300048927 Bacteria 10629
126 Ga0496124_0015486 3300048927 Bacteria 7307
127 Ga0496125_0002346 3300048928 Bacteria 24837
128 Ga0496125_0026975 3300048928 Bacteria 5215
129 Ga0496126_0090301 3300048929 Bacteria 2695
130 nmdc:mga00v17_1432_c1 3300050491 Bacteria 12502
131 nmdc:mga06z11_39867_c1 3300050494 Bacteria 2340
132 nmdc:mga04h51_42680_c1 3300050495 Bacteria 1488
133 nmdc:mga07m45_139869_c1 3300050496 Bacteria 1402
134 nmdc:mga0sz30_12235_c1 3300050516 Bacteria 3334
135 nmdc:mga0sz30_5718_c1 3300050516 Bacteria 4576
136 Ga0500578_0104462 3300053086 Bacteria 1790
137 Ga0500618_000644 3300053125 Bacteria 20789
138 Ga0500618_002296 3300053125 Bacteria 7361
139 Ga0500568_0000266 3300053139 Bacteria 44327
140 Ga0500590_000026 3300053148 Bacteria 36766
141 Ga0500616_0022459 3300053153 Bacteria 3521
142 Ga0500620_000196 3300053155 Bacteria 12159
143 Ga0500620_019585 3300053155 Bacteria 1991
144 Ga0500622_0000367 3300053156 Bacteria 43429
145 Ga0500633_0039458 3300053160 Bacteria 1578
146 2523467740 2523231067 Bacteria 5230452
147 2509073700 2508501114 Bacteria 7082538
148 2509111130 2508501122 Bacteria 6292184
149 2509397676 2509276022 Bacteria 6200534
150 2509443745 2509276033 Bacteria 7180565
151 2510318931 2510065059 Bacteria 6847884
152 2511185684 2510917028 Bacteria 6185411
153 2511196032 2510917030 Bacteria 7460662
154 2512531393 2512047086 Bacteria 6850303
155 2513868178 2513237138 Bacteria 7368160
156 2520380833 2519899620 Bacteria 6499161
157 2524438846 2524023205 Bacteria 8918781
158 2553394081 2551306519 Bacteria 5465154
159 2585222563 2582581298 Bacteria 7315509
160 2585265239 2582581306 Bacteria 6450535
161 2585385627 2582581865 Bacteria 6644329
162 2585401857 2582581867 Bacteria 7184437
163 2585545146 2585427529 Bacteria 7395659
164 2585820257 2585427590 Bacteria 6824633
165 2586004250 2585427634 Bacteria 6455027
166 2644002877 2643221599 Bacteria 6292121
167 2644104001 2643221618 Bacteria 7717186
168 2644129568 2643221623 Bacteria 5239945
169 2644149377 2643221626 Bacteria 8069654
170 2644239319 2643221643 Bacteria 5749658
171 2644306874 2643221655 Bacteria 7722067
172 2644337221 2643221659 Bacteria 7890716
173 2644540466 2643221698 Bacteria 7756764
174 2644619113 2643221712 Bacteria 7729434
175 2644703867 2643221729 Bacteria 6621700
176 2644708560 2643221730 Bacteria 6523787
177 2685149296 2684622632 Bacteria 5380049
178 2698323884 2695420987 Bacteria 6152737
179 2705993344 2703719227 Bacteria 5631989
180 2719665425 2718217997 Bacteria 6740740
181 2720491845 2718218199 Bacteria 6740745
182 2720613112 2718218232 Bacteria 6720332
183 2720619967 2718218233 Bacteria 6662049
184 2720631392 2718218235 Bacteria 6630699
185 2720775120 2718218269 Bacteria 6906114
186 2721156141 2718218365 Bacteria 6274507
187 2721504675 2718218445 Bacteria 5113413
188 2723026756 2721755556 Bacteria 6745503
189 2723560374 2721755684 Bacteria 6859907
190 2723566939 2721755685 Bacteria 6704835
191 2724089727 2721755819 Bacteria 6906405
192 2724104204 2721755822 Bacteria 6726041
193 2724110015 2721755823 Bacteria 6752556
194 2730107692 2728369352 Bacteria 6745171
195 2730295674 2728369397 Bacteria 6274511
196 2739036320 2738541333 Bacteria 7106503
197 2739156355 2738541358 Bacteria 5932299
198 2739210705 2738543006 Bacteria 5904091
199 2739307082 2738543024 Bacteria 5603683
200 2739349190 2738543031 Bacteria 5769731
201 2745074665 2744054633 Bacteria 8678936
202 2756673359 2756170246 Bacteria 7451806
203 2770196006 2767802442 Bacteria 5747986
204 2774868870 2773857925 Bacteria 6472445
205 2776259926 2775506901 Bacteria 9631051
206 2793298217 2791355256 Bacteria 6798008
207 2793318309 2791355259 Bacteria 7254731
208 2793328004 2791355261 Bacteria 6661293
209 2793337156 2791355262 Bacteria 6774204
210 2805927775 2802429605 Bacteria 6875453
211 2805935685 2802429606 Bacteria 6346811
212 2806046423 2802429633 Bacteria 7341974
213 2806053041 2802429634 Bacteria 7083200
214 2806059751 2802429635 Bacteria 7650140
215 2806068511 2802429636 Bacteria 7597525
216 2806074933 2802429637 Bacteria 7067217
217 2819579556 2818991443 Bacteria 6598732
218 2819683490 2818991461 Bacteria 7026071
219 2838021098 2838016132 Bacteria 6577831
220 2838052614 2838048938 Bacteria 6044578
221 2838066140 2838061910 Bacteria 6794874
222 2838071526 2838068647 Bacteria 6208656
223 2838670222 2838668709 Bacteria 6671819
224 2838702593 2838701080 Bacteria 6669771
225 2842146862 2842146304 Bacteria 5957337
226 2842196844 2842192696 Bacteria 6147454
227 2842206240 2842205361 Bacteria 6340321
228 2842251927 2842250916 Bacteria 6579627
229 2842268087 2842264693 Bacteria 6472963
230 2842279697 2842278818 Bacteria 6340002
231 2842313722 2842311132 Bacteria 6616990
232 2842318111 2842317721 Bacteria 6793725
233 2842424816 2842422224 Bacteria 6239196
234 2842431694 2842428310 Bacteria 6767288
235 2842438363 2842434925 Bacteria 6502746
236 2842444994 2842441272 Bacteria 6769273
237 2842452305 2842447887 Bacteria 6754142
238 2842466048 2842462802 Bacteria 6588055
239 2842472978 2842469257 Bacteria 6752936
240 2842492924 2842489311 Bacteria 6620893
241 2842496381 2842495871 Bacteria 6820686
242 2842513287 2842509118 Bacteria 6850950
243 2842927646 2842922631 Bacteria 5824079
244 2844005818 2844002411 Bacteria 7168230
245 2844170961 2844163670 Bacteria 7266046
246 2857534542 2857531043 Bacteria 6754041
247 2871454835 2871451962 Bacteria 7336357
248 2871474083 2871466892 Bacteria 6923287
249 2876424547 2876420981 Bacteria 6687741
250 2883580604 2883577096 Bacteria 4709178
251 2894241958 2894232714 Bacteria 8834183
252 2913298900 2913295892 Bacteria 6333755
253 2919106456 2919100787 Bacteria 7710546
254 2920765711 2920760137 Bacteria 7427611
255 2922157948 2922151315 Bacteria 6902399
256 2923560462 2923556063 Bacteria 6793593
257 2929205960 2929199973 Bacteria 7260745
258 2929234565 2929233124 Bacteria 5948380
259 2933602325 2933599457 Bacteria 5858799
260 2938918743 2938917290 Bacteria 5914775
261 2941503297 2941499720 Bacteria 7599444
262 2947428112 2947426588 Bacteria 5357194
263 2956897945 2956897341 Bacteria 5447711
264 2965762602 2965761152 Bacteria 5806513
265 2979085033 2979083700 Bacteria 5894929
266 2987676217 2987673487 Bacteria 6884027
267 2989352472 2989349275 Bacteria 6349068
268 2996897268 2996893221 Bacteria 5823108
269 3000141792 3000135777 Bacteria 6891109
270 3005457306 3005452660 Bacteria 5889319
271 8005288440 8005282627 Bacteria 6675747
272 8005382976 8005382845 Bacteria 6732062
273 8005398572 8005395548 Bacteria 6806915
274 8005433689 8005430974 Bacteria 6689030
275 8005488342 8005484373 Bacteria 6297373
276 8005500073 8005497431 Bacteria 6477605
277 8005572428 8005570704 Bacteria 6957481
278 8005621438 8005619151 Bacteria 7030230
279 8005631274 8005626139 Bacteria 6534237
280 8005671489 8005668836 Bacteria 6953162
281 8022622529 8022621104 Bacteria 5241040
282 8022798256 8022792930 Bacteria 5693794
283 8023442582 8023438354 Bacteria 5779374
284 8023449584 8023444577 Bacteria 5661597
285 8024506799 8024501048 Bacteria 6427847
286 8055912283 8055909800 Bacteria 7278581
287 8057584118 8057582654 Bacteria 5218944
288 JGI25158J39367_1002299
289 JGI25152J39213_1001304
290 JGI25159J45721_1001122
291 JGI25159J45721_1001664
292 JGI25151J46595_10002498
293 JGI25151J46595_10002643
294 JGI25151J46595_10016846
295 JGI25151J46595_10026387
296 JGI25151J46595_10045727
297 JGI25153J46596_10003331
298 JGI25153J46596_10009375
299 JGI25153J46596_10010946
300 JGI25153J46596_10012161
301 JGI25160J50197_1006532
302 JGI25161J50226_1000107
303 Ga0055526_1001730
304 Ga0055526_1012791
305 Ga0055524_1004185
306 Ga0055524_1012744
307 Ga0055528_1000496
308 Ga0055528_1006645
309 Ga0055543_1000582
310 Ga0065165_1010425
311 Ga0081540_1025053
312 Ga0075365_10005063
313 Ga0075364_10001571
314 Ga0075367_10031768
315 Ga0075370_10087053
316 Ga0105244_10010834
317 Ga0105244_10059203
318 Ga0105244_10065586
319 Ga0105250_10012057
320 Ga0105250_10025430
321 Ga0105250_10028970
322 Ga0105250_10053988
323 Ga0105248_10283549
324 Ga0105238_10289695
325 Ga0123341_1000098
326 Ga0123342_1003939
327 Ga0123342_1011467
328 Ga0105246_10034353
329 Ga0157380_10115366
330 Ga0209436_100011
331 Ga0209147_102123
332 Ga0207425_1003107
333 Ga0207425_1004417
334 Ga0209129_1000256
335 Ga0209129_1000727
336 Ga0209129_1000992
337 Ga0209129_1001878
338 Ga0209673_1000294
339 Ga0209673_1003792
340 Ga0209673_1023378
341 Ga0209130_1000081
342 Ga0209130_1001393
343 Ga0209130_1003523
344 Ga0209025_1000258
345 Ga0209025_1000260
346 Ga0209025_1000578
347 Ga0209025_1003369
348 Ga0209025_1010861
349 Ga0209025_1046330
350 Ga0209025_1056811
351 Ga0209564_1000225
352 Ga0209564_1002083
353 Ga0209758_1000113
354 Ga0209758_1000463
355 Ga0209758_1001254
356 Ga0209758_1005068
357 Ga0209758_1022327
358 Ga0209256_1000719
359 Ga0209256_1008899
360 Ga0209256_1010862
361 Ga0209256_1012120
362 Ga0207426_1000008
363 Ga0207426_1002724
364 Ga0209051_1002519
365 Ga0207696_1001418
366 Ga0207696_1007148
367 Ga0207655_1023159
368 Ga0207713_1065772
369 Ga0307515_10013948
370 Ga0237817_10140
371 Ga0237817_10513
372 Ga0265330_10038156
373 Ga0265325_10014579
374 Ga0265339_10004217
375 Ga0265316_10125456
376 Ga0265314_10045235
377 Ga0265314_10089398
378 Ga0265342_10067661
379 Ga0237819_00063
380 Ga0237819_00265
381 Ga0436361_0541183
382 Ga0439465_0036538
383 Ga0451847_0244573
384 Ga0451843_0248735
385 Ga0451853_2568499
386 Ga0466967_0000124
387 Ga0495638_0031038
388 Ga0495583_0030343
389 Ga0495610_0005461
390 Ga0495643_0012721
391 Ga0495643_0013858
392 Ga0495654_0000152
393 Ga0495625_0015656
394 Ga0496101_0086202
395 Ga0496102_0112697
396 Ga0496103_0112391
397 Ga0496105_0044205
398 Ga0496106_0000038
399 Ga0496106_0099381
400 Ga0496108_0051334
401 Ga0496116_0060120
402 Ga0496117_0090509
403 Ga0496118_0103936
404 Ga0496120_0013641
405 Ga0496121_0082093
406 Ga0496121_0083291
407 Ga0496121_0169755
408 Ga0496122_0008036
409 Ga0496122_0021209
410 Ga0496122_0060508
411 Ga0496123_0010080
412 Ga0496124_0008622
413 Ga0496124_0015486
414 Ga0496125_0002346
415 Ga0496125_0026975
416 Ga0496126_0090301
417 nmdc:mga00v17_1432_c1
418 nmdc:mga06z11_39867_c1
419 nmdc:mga04h51_42680_c1
420 nmdc:mga07m45_139869_c1
421 nmdc:mga0sz30_12235_c1
422 nmdc:mga0sz30_5718_c1
423 Ga0500578_0104462
424 Ga0500618_000644
425 Ga0500618_002296
426 Ga0500568_0000266
427 Ga0500590_000026
428 Ga0500616_0022459
429 Ga0500620_000196
430 Ga0500620_019585
431 Ga0500622_0000367
432 Ga0500633_0039458
433 2523467740
434 2509073700
435 2509111130
436 2509397676
437 2509443745
438 2510318931
439 2511185684
440 2511196032
441 2512531393
442 2513868178
443 2520380833
444 2524438846
445 2553394081
446 2585222563
447 2585265239
448 2585385627
449 2585401857
450 2585545146
451 2585820257
452 2586004250
453 2644002877
454 2644104001
455 2644129568
456 2644149377
457 2644239319
458 2644306874
459 2644337221
460 2644540466
461 2644619113
462 2644703867
463 2644708560
464 2685149296
465 2698323884
466 2705993344
467 2719665425
468 2720491845
469 2720613112
470 2720619967
471 2720631392
472 2720775120
473 2721156141
474 2721504675
475 2723026756
476 2723560374
477 2723566939
478 2724089727
479 2724104204
480 2724110015
481 2730107692
482 2730295674
483 2739036320
484 2739156355
485 2739210705
486 2739307082
487 2739349190
488 2745074665
489 2756673359
490 2770196006
491 2774868870
492 2776259926
493 2793298217
494 2793318309
495 2793328004
496 2793337156
497 2805927775
498 2805935685
499 2806046423
500 2806053041
501 2806059751
502 2806068511
503 2806074933
504 2819579556
505 2819683490
506 2838021098
507 2838052614
508 2838066140
509 2838071526
510 2838670222
511 2838702593
512 2842146862
513 2842196844
514 2842206240
515 2842251927
516 2842268087
517 2842279697
518 2842313722
519 2842318111
520 2842424816
521 2842431694
522 2842438363
523 2842444994
524 2842452305
525 2842466048
526 2842472978
527 2842492924
528 2842496381
529 2842513287
530 2842927646
531 2844005818
532 2844170961
533 2857534542
534 2871454835
535 2871474083
536 2876424547
537 2883580604
538 2894241958
539 2913298900
540 2919106456
541 2920765711
542 2922157948
543 2923560462
544 2929205960
545 2929234565
546 2933602325
547 2938918743
548 2941503297
549 2947428112
550 2956897945
551 2965762602
552 2979085033
553 2987676217
554 2989352472
555 2996897268
556 3000141792
557 3005457306
558 8005288440
559 8005382976
560 8005398572
561 8005433689
562 8005488342
563 8005500073
564 8005572428
565 8005621438
566 8005631274
567 8005671489
568 8022622529
569 8022798256
570 8023442582
571 8023449584
572 8024506799
573 8055912283
574 8057584118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

69

378

0.94

PF07687

M20_dimer

Peptidase dimerisation domain

180

279

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6slf-assembly1.cif.gz_D nalpha-acylglutamine aminoacylase from corynebacterium sp.releasing human axilla odorants co-crystallised with high affinity inhibitor 0.924 5 378
6slf-assembly1.cif.gz_D nalpha-acylglutamine aminoacylase from corynebacterium sp.releasing human axilla odorants co-crystallised with high affinity inhibitor 0.8878 5 378
1ysj-assembly1.cif.gz_B crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.8379 6 383
4ewt-assembly1.cif.gz_B the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.8366 5 380
1ysj-assembly1.cif.gz_A crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.8344 3 383
ID Description Score Start End Superfamily
af_A0A0R0IPM0_41_149_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9589 182 289 3.30.70.360
4ewtD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9515 181 294 3.30.70.360
2q43A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9495 7 383 3.40.630.10
af_Q7XUA8_201_320_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9475 181 293 3.40.630.10
af_A0A0R0IPM1_21_184_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9456 10 119 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A4P0Y354-F1-model_v4 N-acyl-L-amino acid amidohydrolase (EC 3.5.1.14) 0.9931 3 130 GO:0004046
AF-A0A418GRL8-F1-model_v4 Amidohydrolase 0.9825 5 144 GO:0016787
AF-A0A847DRM8-F1-model_v4 Amidohydrolase 0.9755 5 145 GO:0016787
AF-A0A7U6KQ38-F1-model_v4 Amidohydrolase 0.9695 2 130 GO:0016787
AF-A0A484Y945-F1-model_v4 Hippurate hydrolase (EC 3.-.-.-) 0.9637 5 199 GO:0016787

Map