F388500

General Info

Members Datasets Scaffolds Average Seq Length
288 214 576 214

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10002610|Ga0075364_100026104
Length 239
Sequence MACTSCSSARPAPNNNPGWRRALWIALIVNGAMFVAEMTAGVAGGSKALQADALDFLGDAANYAISLGVAGMVLAWRARAAILKGATLAILGLYVLAATIWTIWNGRVPEAEVMGIIGIVALLANAGVAIMLYRFRNGDANMRSVWICSRNDAIGNIAVVLAAAGVFGTGSAWPDLVVAAIMAALGLSGGVQIMIQARRELPGSRTPSLGARQRGPLAGARKEVMPIPHSRGALLQDDT

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
113 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
165 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
183 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
184 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
189 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
190 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
191 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
192 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
193 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
194 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
195 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
196 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
197 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
198 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
199 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
200 2851153111 Caulobacter radicis 736 Isolate Unclassified
201 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
202 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
203 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
204 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
205 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
206 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
207 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
208 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
209 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
210 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
211 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
212 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
213 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
214 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.62
Metatranscriptomes 0.35
Isolates 9.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.79
Nodule 3.12
Rhizoplane 1.39
Rhizosphere 68.4
Stem 0
Stem Tuber 0.35
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10002610 3300006051 Bacteria 10114
2 SwRhRL3b_contig_3173165 2162886006 Bacteria 1564
3 JGI24739J22299_10002530 3300001989 Bacteria 7044
4 JGI24750J21931_1011241 3300002070 Bacteria 1175
5 JGI24751J29686_10003625 3300002459 Bacteria 3111
6 JGI25151J46595_10072523 3300003187 Bacteria 1035
7 Ga0055536_1004008 3300003781 Bacteria 7695
8 Ga0055536_1004837 3300003781 Bacteria 6732
9 Ga0055530_10001241 3300003791 Bacteria 19468
10 Ga0055531_10004486 3300003794 Bacteria 8482
11 Ga0065707_10000679 3300005295 Bacteria 13733
12 Ga0070658_10000081 3300005327 Bacteria 90275
13 Ga0070658_10186601 3300005327 Bacteria 1747
14 Ga0070670_100000053 3300005331 Bacteria 128475
15 Ga0070670_100001886 3300005331 Bacteria 17123
16 Ga0070666_10000392 3300005335 Bacteria 27574
17 Ga0070668_100012774 3300005347 Bacteria 6251
18 Ga0070669_100000023 3300005353 Bacteria 174496
19 Ga0070669_100000030 3300005353 Bacteria 160753
20 Ga0070667_100002263 3300005367 Bacteria 16955
21 Ga0070713_100070612 3300005436 Bacteria 2949
22 Ga0070713_100279666 3300005436 Bacteria 1531
23 Ga0070711_100174348 3300005439 Bacteria 1642
24 Ga0070705_100359477 3300005440 Bacteria 1064
25 Ga0070708_100063173 3300005445 Bacteria 3314
26 Ga0070662_100052313 3300005457 Bacteria 2951
27 Ga0070679_100283078 3300005530 Unclassified 1610
28 Ga0068853_100000140 3300005539 Bacteria 49375
29 Ga0070672_100173904 3300005543 Bacteria 1792
30 Ga0070665_100030306 3300005548 Bacteria 5444
31 Ga0070665_100118053 3300005548 Bacteria 2655
32 Ga0068855_100000313 3300005563 Bacteria 60285
33 Ga0070664_100154970 3300005564 Bacteria 2024
34 Ga0068854_100001416 3300005578 Bacteria 14489
35 Ga0068856_100210631 3300005614 Bacteria 1959
36 Ga0070702_100162974 3300005615 Bacteria 1443
37 Ga0068852_100000112 3300005616 Bacteria 54817
38 Ga0068859_100000958 3300005617 Bacteria 29557
39 Ga0068864_100000055 3300005618 Bacteria 128475
40 Ga0068864_100007326 3300005618 Bacteria 9079
41 Ga0068861_100020314 3300005719 Bacteria 4755
42 Ga0068863_100001618 3300005841 Bacteria 22236
43 Ga0068858_100008736 3300005842 Bacteria 9726
44 Ga0068860_100017887 3300005843 Bacteria 6903
45 Ga0068860_100591459 3300005843 Bacteria 1114
46 Ga0068862_100000425 3300005844 Bacteria 45885
47 Ga0068862_100035914 3300005844 Bacteria 4199
48 Ga0070717_10122752 3300006028 Bacteria 2227
49 Ga0075365_10002035 3300006038 Bacteria 9614
50 Ga0075365_10168947 3300006038 Bacteria 1526
51 Ga0075364_10000022 3300006051 Bacteria 53466
52 Ga0075362_10057120 3300006177 Bacteria 1758
53 Ga0075362_10238472 3300006177 Bacteria 892
54 Ga0075367_10008181 3300006178 Bacteria 5404
55 Ga0075369_10000796 3300006186 Bacteria 10326
56 Ga0075369_10073034 3300006186 Bacteria 1512
57 Ga0075366_10002037 3300006195 Bacteria 10254
58 Ga0075370_10004385 3300006353 Bacteria 6843
59 Ga0075370_10055041 3300006353 Bacteria 2260
60 Ga0075430_100168351 3300006846 Bacteria 1823
61 Ga0097620_100000958 3300006931 Bacteria 29557
62 Ga0105250_10000551 3300009092 Bacteria 25565
63 Ga0105240_10000156 3300009093 Bacteria 139950
64 Ga0105245_11389626 3300009098 Bacteria 752
65 Ga0105247_10007890 3300009101 Bacteria 6510
66 Ga0105248_10137571 3300009177 Bacteria 2755
67 Ga0105248_10308863 3300009177 Bacteria 1781
68 Ga0105237_10000325 3300009545 Bacteria 67280
69 Ga0105249_10006886 3300009553 Bacteria 9908
70 Ga0105249_11053412 3300009553 Bacteria 883
71 Ga0105239_10000118 3300010375 Bacteria 112168
72 Ga0105239_11379736 3300010375 Bacteria 813
73 Ga0157371_10015758 3300013102 Bacteria 5658
74 Ga0163162_11073775 3300013306 Bacteria 912
75 Ga0157372_10000722 3300013307 Bacteria 36035
76 Ga0157379_10095535 3300014968 Bacteria 2667
77 Ga0157379_10691777 3300014968 Bacteria 957
78 Ga0224712_10139000 3300022467 Bacteria 1067
79 Ga0209677_101589 3300025253 Bacteria 9606
80 Ga0209675_1000555 3300025291 Bacteria 27086
81 Ga0209676_1000421 3300025292 Bacteria 74706
82 Ga0209676_1001076 3300025292 Bacteria 30900
83 Ga0209676_1005589 3300025292 Bacteria 6497
84 Ga0209025_1009760 3300025294 Bacteria 6627
85 Ga0209025_1111270 3300025294 Bacteria 841
86 Ga0209050_1000112 3300025298 Bacteria 210320
87 Ga0209050_1006833 3300025298 Bacteria 6632
88 Ga0209257_1000877 3300025304 Bacteria 42562
89 Ga0209257_1003857 3300025304 Bacteria 12255
90 Ga0209257_1008253 3300025304 Bacteria 5989
91 Ga0209257_1019666 3300025304 Bacteria 2531
92 Ga0209257_1038677 3300025304 Bacteria 1443
93 Ga0207697_10000005 3300025315 Bacteria 85907
94 Ga0207696_1010781 3300025711 Bacteria 3332
95 Ga0207710_10003734 3300025900 Bacteria 6740
96 Ga0207680_10000062 3300025903 Bacteria 48850
97 Ga0207647_10012703 3300025904 Bacteria 5852
98 Ga0207705_10000193 3300025909 Bacteria 61961
99 Ga0207695_10000250 3300025913 Bacteria 139984
100 Ga0207671_10000100 3300025914 Bacteria 131821
101 Ga0207663_10157516 3300025916 Bacteria 1599
102 Ga0207652_10046746 3300025921 Bacteria 3695
103 Ga0207681_10000004 3300025923 Bacteria 559005
104 Ga0207681_10000036 3300025923 Bacteria 161782
105 Ga0207694_10022609 3300025924 Bacteria 4771
106 Ga0207650_10000075 3300025925 Bacteria 134026
107 Ga0207650_10001277 3300025925 Bacteria 18255
108 Ga0207706_10020134 3300025933 Bacteria 5995
109 Ga0207691_10503783 3300025940 Bacteria 1028
110 Ga0207711_10114774 3300025941 Bacteria 2399
111 Ga0207679_10670661 3300025945 Bacteria 939
112 Ga0207667_10000006 3300025949 Bacteria 679876
113 Ga0207667_10000091 3300025949 Bacteria 148651
114 Ga0207712_10012624 3300025961 Bacteria 5398
115 Ga0207668_10000370 3300025972 Bacteria 28629
116 Ga0207668_10006943 3300025972 Bacteria 6718
117 Ga0207668_10778051 3300025972 Bacteria 846
118 Ga0207640_10000160 3300025981 Bacteria 48881
119 Ga0207658_10001947 3300025986 Bacteria 15422
120 Ga0207703_10016115 3300026035 Bacteria 5827
121 Ga0207639_10000038 3300026041 Bacteria 145316
122 Ga0207708_10729535 3300026075 Bacteria 849
123 Ga0207702_10197059 3300026078 Bacteria 1865
124 Ga0207641_10000268 3300026088 Bacteria 66121
125 Ga0207676_10000041 3300026095 Bacteria 166172
126 Ga0207676_10001681 3300026095 Bacteria 16316
127 Ga0207675_100024746 3300026118 Bacteria 5584
128 Ga0207698_10000081 3300026142 Bacteria 63461
129 Ga0209974_10007474 3300027876 Bacteria 3765
130 Ga0209974_10212017 3300027876 Bacteria 718
131 Ga0268266_10269080 3300028379 Bacteria 1581
132 Ga0268266_10288622 3300028379 Bacteria 1527
133 Ga0268265_10000046 3300028380 Bacteria 179361
134 Ga0268264_10007525 3300028381 Bacteria 9086
135 Ga0268264_10561010 3300028381 Bacteria 1121
136 Ga0307408_100005173 3300031548 Bacteria 8752
137 Ga0307516_10515392 3300031730 Bacteria 850
138 Ga0307413_10010049 3300031824 Bacteria 4564
139 Ga0307410_10029449 3300031852 Plasmid 3496
140 Ga0307407_10276381 3300031903 Unclassified 1161
141 Ga0307412_10000159 3300031911 Bacteria 47835
142 Ga0307412_10003989 3300031911 Bacteria 8228
143 Ga0307412_10047319 3300031911 Bacteria 2825
144 Ga0307412_10201295 3300031911 Unclassified 1512
145 Ga0307416_100110446 3300032002 Bacteria 2421
146 Ga0307414_10000223 3300032004 Bacteria 37440
147 Ga0307414_10007568 3300032004 Bacteria 6107
148 Ga0307414_10008349 3300032004 Bacteria 5865
149 Ga0307414_10092712 3300032004 Bacteria 2249
150 Ga0307414_10449205 3300032004 Bacteria 1130
151 Ga0307414_11046450 3300032004 Bacteria 752
152 Ga0307411_10000546 3300032005 Bacteria 13328
153 Ga0307411_10178456 3300032005 Bacteria 1609
154 Ga0307507_10172992 3300033179 Bacteria 1564
155 Ga0373935_0443276 3300035692 Bacteria 937
156 Ga0237819_03065 3300038705 Bacteria 3085
157 Ga0237816_00251 3300039145 Bacteria 4480
158 Ga0451577_0606152 3300042876 Bacteria 994
159 Ga0451576_0008284 3300045051 Bacteria 12220
160 Ga0495627_007004 3300046453 Bacteria 4373
161 Ga0495638_0000836 3300046460 Bacteria 32322
162 Ga0495650_0012905 3300046471 Bacteria 4460
163 Ga0495605_0000103 3300046474 Bacteria 105879
164 Ga0495584_0038638 3300046491 Bacteria 2412
165 Ga0495596_0029054 3300046500 Bacteria 2218
166 Ga0495583_0086016 3300046506 Bacteria 1360
167 Ga0495610_0000090 3300046512 Bacteria 106145
168 Ga0495616_0200972 3300046513 Bacteria 876
169 Ga0495632_0000096 3300046519 Bacteria 89284
170 Ga0495637_0001690 3300046520 Bacteria 12740
171 Ga0495643_0001606 3300046522 Bacteria 20005
172 Ga0495643_0002134 3300046522 Bacteria 16303
173 Ga0495643_0019509 3300046522 Bacteria 3921
174 Ga0495643_0059525 3300046522 Bacteria 2030
175 Ga0495663_0000016 3300046525 Bacteria 142125
176 Ga0495654_0001066 3300046530 Bacteria 20022
177 Ga0495621_0090028 3300046539 Bacteria 1155
178 Ga0495597_0152489 3300046542 Bacteria 947
179 Ga0495633_0001331 3300046558 Bacteria 19380
180 Ga0495668_0001409 3300046616 Bacteria 23419
181 Ga0495625_0000031 3300046660 Bacteria 238193
182 Ga0495625_0000526 3300046660 Bacteria 56429
183 Ga0495625_0325184 3300046660 Bacteria 978
184 Ga0495625_0422395 3300046660 Bacteria 829
185 Ga0495671_0000974 3300046692 Bacteria 20005
186 Ga0495683_0210117 3300047323 Bacteria 873
187 Ga0495681_0015171 3300047470 Bacteria 4370
188 Ga0495681_0031945 3300047470 Bacteria 2655
189 Ga0495686_0000060 3300047472 Bacteria 237402
190 Ga0495686_0123110 3300047472 Bacteria 1543
191 Ga0495615_0000007 3300048090 Bacteria 90892
192 Ga0495615_0000033 3300048090 Bacteria 45796
193 Ga0496100_0003322 3300048903 Bacteria 8373
194 Ga0496101_0002485 3300048904 Bacteria 11324
195 Ga0496106_0000047 3300048909 Bacteria 100449
196 Ga0496107_0000035 3300048910 Bacteria 86628
197 Ga0496117_0046062 3300048920 Bacteria 3141
198 Ga0496121_0025741 3300048924 Bacteria 5570
199 Ga0496123_0099869 3300048926 Bacteria 1693
200 Ga0496124_0045778 3300048927 Bacteria 3750
201 Ga0496124_0058391 3300048927 Bacteria 3245
202 Ga0496125_0002524 3300048928 Bacteria 23632
203 Ga0496125_0032927 3300048928 Bacteria 4596
204 Ga0501031_0263645 3300049568 Bacteria 1119
205 Ga0501032_0017562 3300049569 Bacteria 5021
206 Ga0501033_0099787 3300049570 Bacteria 2119
207 Ga0501033_0505936 3300049570 Bacteria 835
208 Ga0501034_0283213 3300049571 Bacteria 1597
209 Ga0501036_0010833 3300049572 Bacteria 7532
210 Ga0501036_0552631 3300049572 Bacteria 957
211 Ga0501037_0056870 3300049573 Bacteria 2856
212 Ga0501038_0009132 3300049574 Bacteria 9095
213 Ga0501038_0024791 3300049574 Bacteria 5347
214 Ga0501043_0053494 3300049579 Bacteria 3170
215 Ga0501043_0364618 3300049579 Bacteria 1096
216 Ga0501047_0001707 3300049581 Bacteria 21355
217 Ga0501047_0038514 3300049581 Bacteria 4625
218 Ga0501048_0332656 3300049582 Bacteria 1082
219 Ga0501070_0152579 3300049586 Bacteria 1906
220 Ga0501073_0010038 3300049589 Bacteria 6961
221 Ga0501235_000335 3300049669 Bacteria 8962
222 Ga0501225_0002378 3300049705 Bacteria 5806
223 Ga0501080_0003602 3300049742 Bacteria 13638
224 Ga0501281_00014 3300049777 Bacteria 23792
225 Ga0501283_000570 3300049779 Bacteria 4829
226 Ga0501035_0007205 3300049822 Bacteria 10408
227 Ga0501035_0267033 3300049822 Bacteria 1449
228 Ga0501035_0297184 3300049822 Bacteria 1361
229 Ga0501044_0044143 3300049823 Bacteria 4629
230 Ga0501044_0068122 3300049823 Bacteria 3626
231 Ga0501044_0112210 3300049823 Bacteria 2733
232 Ga0501044_0699376 3300049823 Bacteria 899
233 nmdc:mga03683_16551_c1 3300050489 Bacteria 2772
234 nmdc:mga00v17_1563_c1 3300050491 Bacteria 11955
235 nmdc:mga00v17_91_c1 3300050491 Bacteria 53223
236 nmdc:mga0yw44_47892_c1 3300050492 Bacteria 2575
237 nmdc:mga0yw44_621_c1 3300050492 Bacteria 12855
238 nmdc:mga0k408_3834_c1 3300050493 Bacteria 7969
239 nmdc:mga0k408_7379_c1 3300050493 Bacteria 5869
240 nmdc:mga06z11_34382_c1 3300050494 Bacteria 2488
241 nmdc:mga07m45_1802_c1 3300050496 Bacteria 9869
242 nmdc:mga07m45_4418_c1 3300050496 Bacteria 5524
243 nmdc:mga07m45_56788_c1 3300050496 Bacteria 2213
244 nmdc:mga0qj67_245330_c1 3300050509 Bacteria 1453
245 nmdc:mga0sz30_34_c1 3300050516 Bacteria 53573
246 nmdc:mga0sz30_36256_c1 3300050516 Bacteria 1512
247 Ga0495601_0001128 3300053077 Bacteria 14641
248 Ga0495612_0010554 3300053078 Bacteria 3734
249 Ga0495619_0033200 3300053085 Bacteria 3351
250 Ga0500651_0184918 3300053093 Bacteria 1236
251 Ga0500658_0000722 3300053134 Bacteria 13655
252 Ga0500559_0008001 3300053136 Bacteria 4656
253 Ga0500564_002317 3300053138 Bacteria 7004
254 Ga0500590_000021 3300053148 Bacteria 42640
255 Ga0500590_100633 3300053148 Bacteria 1388
256 Ga0500604_0008547 3300053151 Bacteria 2719
257 Ga0500622_0000188 3300053156 Bacteria 65148
258 Ga0500622_0006837 3300053156 Bacteria 6557
259 Ga0500627_0000002 3300053158 Bacteria 235747
260 Ga0500627_0000202 3300053158 Bacteria 17284
261 Ga0500637_0004224 3300053178 Bacteria 6780
262 Ga0500596_001463 3300053735 Bacteria 4784
263 2512644769 2512564014 Bacteria 4639632
264 2643821475 2643221560 Bacteria 4801179
265 2643832750 2643221563 Bacteria 4726935
266 2644041024 2643221605 Bacteria 4772303
267 2644053455 2643221608 Bacteria 4724829
268 2739652463 2739367664 Bacteria 4114334
269 2740030936 2739367865 Bacteria 4114482
270 2753763147 2751185897 Bacteria 5322941
271 2809064585 2808606401 Bacteria 4586670
272 2809080504 2808606404 Bacteria 4652788
273 2809084868 2808606405 Bacteria 4586632
274 2851157520 2851153111 Bacteria 5542585
275 2852657093 2852653556 Bacteria 4050083
276 2852683765 2852680915 Bacteria 4100189
277 2885427389 2885427238 Bacteria 2291351
278 2896253992 2896253425 Bacteria 3418029
279 2928969806 2928968154 Bacteria 4633371
280 2935771293 2935769743 Bacteria 7878163
281 2935793448 2935785616 Bacteria 7962367
282 2935801462 2935793552 Bacteria 8012592
283 8016528464 8016522445 Bacteria 8156687
284 8016546843 8016539877 Bacteria 8155419
285 8016555274 8016548790 Bacteria 8155074
286 8016563634 8016557553 Bacteria 8154380
287 8016576159 8016575299 Bacteria 8154085
288 8016601370 8016595262 Bacteria 8149947
289 Ga0075364_10002610
290 SwRhRL3b_contig_3173165
291 JGI24739J22299_10002530
292 JGI24750J21931_1011241
293 JGI24751J29686_10003625
294 JGI25151J46595_10072523
295 Ga0055536_1004008
296 Ga0055536_1004837
297 Ga0055530_10001241
298 Ga0055531_10004486
299 Ga0065707_10000679
300 Ga0070658_10000081
301 Ga0070658_10186601
302 Ga0070670_100000053
303 Ga0070670_100001886
304 Ga0070666_10000392
305 Ga0070668_100012774
306 Ga0070669_100000023
307 Ga0070669_100000030
308 Ga0070667_100002263
309 Ga0070713_100070612
310 Ga0070713_100279666
311 Ga0070711_100174348
312 Ga0070705_100359477
313 Ga0070708_100063173
314 Ga0070662_100052313
315 Ga0070679_100283078
316 Ga0068853_100000140
317 Ga0070672_100173904
318 Ga0070665_100030306
319 Ga0070665_100118053
320 Ga0068855_100000313
321 Ga0070664_100154970
322 Ga0068854_100001416
323 Ga0068856_100210631
324 Ga0070702_100162974
325 Ga0068852_100000112
326 Ga0068859_100000958
327 Ga0068864_100000055
328 Ga0068864_100007326
329 Ga0068861_100020314
330 Ga0068863_100001618
331 Ga0068858_100008736
332 Ga0068860_100017887
333 Ga0068860_100591459
334 Ga0068862_100000425
335 Ga0068862_100035914
336 Ga0070717_10122752
337 Ga0075365_10002035
338 Ga0075365_10168947
339 Ga0075364_10000022
340 Ga0075362_10057120
341 Ga0075362_10238472
342 Ga0075367_10008181
343 Ga0075369_10000796
344 Ga0075369_10073034
345 Ga0075366_10002037
346 Ga0075370_10004385
347 Ga0075370_10055041
348 Ga0075430_100168351
349 Ga0097620_100000958
350 Ga0105250_10000551
351 Ga0105240_10000156
352 Ga0105245_11389626
353 Ga0105247_10007890
354 Ga0105248_10137571
355 Ga0105248_10308863
356 Ga0105237_10000325
357 Ga0105249_10006886
358 Ga0105249_11053412
359 Ga0105239_10000118
360 Ga0105239_11379736
361 Ga0157371_10015758
362 Ga0163162_11073775
363 Ga0157372_10000722
364 Ga0157379_10095535
365 Ga0157379_10691777
366 Ga0224712_10139000
367 Ga0209677_101589
368 Ga0209675_1000555
369 Ga0209676_1000421
370 Ga0209676_1001076
371 Ga0209676_1005589
372 Ga0209025_1009760
373 Ga0209025_1111270
374 Ga0209050_1000112
375 Ga0209050_1006833
376 Ga0209257_1000877
377 Ga0209257_1003857
378 Ga0209257_1008253
379 Ga0209257_1019666
380 Ga0209257_1038677
381 Ga0207697_10000005
382 Ga0207696_1010781
383 Ga0207710_10003734
384 Ga0207680_10000062
385 Ga0207647_10012703
386 Ga0207705_10000193
387 Ga0207695_10000250
388 Ga0207671_10000100
389 Ga0207663_10157516
390 Ga0207652_10046746
391 Ga0207681_10000004
392 Ga0207681_10000036
393 Ga0207694_10022609
394 Ga0207650_10000075
395 Ga0207650_10001277
396 Ga0207706_10020134
397 Ga0207691_10503783
398 Ga0207711_10114774
399 Ga0207679_10670661
400 Ga0207667_10000006
401 Ga0207667_10000091
402 Ga0207712_10012624
403 Ga0207668_10000370
404 Ga0207668_10006943
405 Ga0207668_10778051
406 Ga0207640_10000160
407 Ga0207658_10001947
408 Ga0207703_10016115
409 Ga0207639_10000038
410 Ga0207708_10729535
411 Ga0207702_10197059
412 Ga0207641_10000268
413 Ga0207676_10000041
414 Ga0207676_10001681
415 Ga0207675_100024746
416 Ga0207698_10000081
417 Ga0209974_10007474
418 Ga0209974_10212017
419 Ga0268266_10269080
420 Ga0268266_10288622
421 Ga0268265_10000046
422 Ga0268264_10007525
423 Ga0268264_10561010
424 Ga0307408_100005173
425 Ga0307516_10515392
426 Ga0307413_10010049
427 Ga0307410_10029449
428 Ga0307407_10276381
429 Ga0307412_10000159
430 Ga0307412_10003989
431 Ga0307412_10047319
432 Ga0307412_10201295
433 Ga0307416_100110446
434 Ga0307414_10000223
435 Ga0307414_10007568
436 Ga0307414_10008349
437 Ga0307414_10092712
438 Ga0307414_10449205
439 Ga0307414_11046450
440 Ga0307411_10000546
441 Ga0307411_10178456
442 Ga0307507_10172992
443 Ga0373935_0443276
444 Ga0237819_03065
445 Ga0237816_00251
446 Ga0451577_0606152
447 Ga0451576_0008284
448 Ga0495627_007004
449 Ga0495638_0000836
450 Ga0495650_0012905
451 Ga0495605_0000103
452 Ga0495584_0038638
453 Ga0495596_0029054
454 Ga0495583_0086016
455 Ga0495610_0000090
456 Ga0495616_0200972
457 Ga0495632_0000096
458 Ga0495637_0001690
459 Ga0495643_0001606
460 Ga0495643_0002134
461 Ga0495643_0019509
462 Ga0495643_0059525
463 Ga0495663_0000016
464 Ga0495654_0001066
465 Ga0495621_0090028
466 Ga0495597_0152489
467 Ga0495633_0001331
468 Ga0495668_0001409
469 Ga0495625_0000031
470 Ga0495625_0000526
471 Ga0495625_0325184
472 Ga0495625_0422395
473 Ga0495671_0000974
474 Ga0495683_0210117
475 Ga0495681_0015171
476 Ga0495681_0031945
477 Ga0495686_0000060
478 Ga0495686_0123110
479 Ga0495615_0000007
480 Ga0495615_0000033
481 Ga0496100_0003322
482 Ga0496101_0002485
483 Ga0496106_0000047
484 Ga0496107_0000035
485 Ga0496117_0046062
486 Ga0496121_0025741
487 Ga0496123_0099869
488 Ga0496124_0045778
489 Ga0496124_0058391
490 Ga0496125_0002524
491 Ga0496125_0032927
492 Ga0501031_0263645
493 Ga0501032_0017562
494 Ga0501033_0099787
495 Ga0501033_0505936
496 Ga0501034_0283213
497 Ga0501036_0010833
498 Ga0501036_0552631
499 Ga0501037_0056870
500 Ga0501038_0009132
501 Ga0501038_0024791
502 Ga0501043_0053494
503 Ga0501043_0364618
504 Ga0501047_0001707
505 Ga0501047_0038514
506 Ga0501048_0332656
507 Ga0501070_0152579
508 Ga0501073_0010038
509 Ga0501235_000335
510 Ga0501225_0002378
511 Ga0501080_0003602
512 Ga0501281_00014
513 Ga0501283_000570
514 Ga0501035_0007205
515 Ga0501035_0267033
516 Ga0501035_0297184
517 Ga0501044_0044143
518 Ga0501044_0068122
519 Ga0501044_0112210
520 Ga0501044_0699376
521 nmdc:mga03683_16551_c1
522 nmdc:mga00v17_1563_c1
523 nmdc:mga00v17_91_c1
524 nmdc:mga0yw44_47892_c1
525 nmdc:mga0yw44_621_c1
526 nmdc:mga0k408_3834_c1
527 nmdc:mga0k408_7379_c1
528 nmdc:mga06z11_34382_c1
529 nmdc:mga07m45_1802_c1
530 nmdc:mga07m45_4418_c1
531 nmdc:mga07m45_56788_c1
532 nmdc:mga0qj67_245330_c1
533 nmdc:mga0sz30_34_c1
534 nmdc:mga0sz30_36256_c1
535 Ga0495601_0001128
536 Ga0495612_0010554
537 Ga0495619_0033200
538 Ga0500651_0184918
539 Ga0500658_0000722
540 Ga0500559_0008001
541 Ga0500564_002317
542 Ga0500590_000021
543 Ga0500590_100633
544 Ga0500604_0008547
545 Ga0500622_0000188
546 Ga0500622_0006837
547 Ga0500627_0000002
548 Ga0500627_0000202
549 Ga0500637_0004224
550 Ga0500596_001463
551 2512644769
552 2643821475
553 2643832750
554 2644041024
555 2644053455
556 2739652463
557 2740030936
558 2753763147
559 2809064585
560 2809080504
561 2809084868
562 2851157520
563 2852657093
564 2852683765
565 2885427389
566 2896253992
567 2928969806
568 2935771293
569 2935793448
570 2935801462
571 8016528464
572 8016546843
573 8016555274
574 8016563634
575 8016576159
576 8016601370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

23

201

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f6h-assembly1.cif.gz_B cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex 0.8659 22 201
5vrf-assembly1.cif.gz_A cryoem structure of the zinc transporter yiip from helical crystals 0.852 21 199
8f6h-assembly1.cif.gz_A cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex 0.799 21 198
8j80-assembly1.cif.gz_B cryo-em structure of hznt7-fab complex in zinc state 1, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-unbound conformation 0.7774 16 201
8j7w-assembly1.cif.gz_B cryo-em structure of hznt7-fab complex in zinc state 2, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-bound conformation 0.7606 23 201
ID Description Score Start End Superfamily
af_P96876_30_219_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9007 22 198 1.20.1510.10
af_P75757_17_213_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8964 22 203 1.20.1510.10
af_Q9M271_29_255_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8937 23 201 1.20.1510.10
af_O35149_110_332_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8692 23 200 1.20.1510.10
af_Q5A0W4_303_536_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8403 23 200 1.20.1510.10
ID Description Score Start End GO Terms
AF-A0A849P7M8-F1-model_v4 Cation transporter 0.9909 20 205 GO:0005385
GO:0005886
AF-A0A7U8GRG4-F1-model_v4 Cation transporter 0.9894 20 208 GO:0005385
GO:0005886
AF-A0A1V4CIQ9-F1-model_v4 Cation transporter 0.989 17 204 GO:0005385
GO:0005886
AF-A0A6L6JIN2-F1-model_v4 Cation transporter 0.9835 20 196 GO:0005385
GO:0005886
GO:0046872
AF-A0A0A0BGM7-F1-model_v4 Cobalt-zinc-cadmium resistance protein CzcD 0.982 20 196 GO:0005385
GO:0005886
GO:0046872

Map