F388593

General Info

Members Datasets Scaffolds Average Seq Length
288 188 574 345

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10268659|Ga0157380_102686592
Length 398
Sequence MKVETPRLVLPANDLMEYESFRNARQSALAECGPVFASGFGAARKCAGRNKMTITRRKFVAAAGATVASPAIVGSVSAQAPTTLKLHHFLPPMSNPHQKFLKPWAEQVEKDSGGRLKIDIFPSMQLGGTPPQLFDQAKDGVVDIVWTLPGNTPGRFPTTEVFELPFTASRRSIVNSKACAEFIPQLANETKDVKLLAFWAHDHGLIHANKQVKTMDDLKGLKLRFPTRLAGEALKALGATAIGMPIPQVPESLAQKVIDGCVVPWEVVPAIKVHELLKFHTEIPGSPTLYTTTFFLAMNKAKYESLSADLRSAIDKNSGMAASEMAGNLWDTMGLPVAEMVKQRGNTITVLAEDEKAKWQKATEPVIEAWVKGSKEKNIDGAKLLETVKGLLAKHEKA

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
102 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
166 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
167 2643221557 Ensifer sp. Root558 Isolate Unclassified
168 2643221610 Ensifer sp. Root74 Isolate Unclassified
169 2643221668 Ensifer sp. Root423 Isolate Unclassified
170 2643221675 Ensifer sp. Root1298 Isolate Unclassified
171 2643221680 Ensifer sp. Root1312 Isolate Unclassified
172 2643221723 Ensifer sp. Root278 Isolate Unclassified
173 2643221726 Ensifer sp. Root954 Isolate Unclassified
174 2643221733 Bosea sp. Root381 Isolate Unclassified
175 2643221736 Bosea sp. Root483D1 Isolate Unclassified
176 2841760612 Bosea sp. Tri-49 Isolate Nodule
177 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
178 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
179 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
180 2844104063 Bosea sp. Tri-39 Isolate Nodule
181 2851182111 Bosea sp. Tri-44 Isolate Nodule
182 2851246043 Bosea sp. Tri-54 Isolate Nodule
183 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
184 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
185 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
186 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
187 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
188 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.32
Metatranscriptomes 0
Isolates 8.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.22
Nodule 3.12
Rhizoplane 4.51
Rhizosphere 63.54
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10268659 3300014326 Bacteria 1553
2 JGI25159J45721_1000052 3300002987 Bacteria 57175
3 JGI25159J45721_1013569 3300002987 Bacteria 1879
4 JGI25151J46595_10008500 3300003187 Bacteria 4933
5 JGI25406J46586_10000208 3300003203 Bacteria 26104
6 rootL2_10116271 3300003322 Bacteria 4092
7 JGI25160J50197_1000007 3300003354 Bacteria 316012
8 JGI25161J50226_1000991 3300003374 Bacteria 9991
9 Ga0055526_1001100 3300003771 Bacteria 19639
10 Ga0055524_1000633 3300003775 Bacteria 25060
11 Ga0055543_1000120 3300004625 Bacteria 66419
12 Ga0065165_1000011 3300005262 Bacteria 316465
13 Ga0065165_1000764 3300005262 Bacteria 43568
14 Ga0070676_10092443 3300005328 Bacteria 1855
15 Ga0068869_100163340 3300005334 Bacteria 1735
16 Ga0068868_100125799 3300005338 Bacteria 2094
17 Ga0070668_100036911 3300005347 Bacteria 3730
18 Ga0070668_100286880 3300005347 Bacteria 1376
19 Ga0070675_100318018 3300005354 Bacteria 1375
20 Ga0070674_100049936 3300005356 Bacteria 2878
21 Ga0070667_100171715 3300005367 Bacteria 1914
22 Ga0070667_100229384 3300005367 Bacteria 1655
23 Ga0070694_100070731 3300005444 Bacteria 2403
24 Ga0070662_100196538 3300005457 Bacteria 1598
25 Ga0068867_100150643 3300005459 Bacteria 1827
26 Ga0070706_100379071 3300005467 Bacteria 1317
27 Ga0070672_100229730 3300005543 Bacteria 1558
28 Ga0068861_100027317 3300005719 Bacteria 4155
29 Ga0068863_100097978 3300005841 Bacteria 2785
30 Ga0068858_100002684 3300005842 Bacteria 17910
31 Ga0068860_100372294 3300005843 Bacteria 1409
32 Ga0068862_100024525 3300005844 Bacteria 5061
33 Ga0081538_10022257 3300005981 Bacteria 4596
34 Ga0081540_1000011 3300005983 Bacteria 191880
35 Ga0081539_10000322 3300005985 Bacteria 106875
36 Ga0081539_10031960 3300005985 Bacteria 3232
37 Ga0081539_10055071 3300005985 Bacteria 2215
38 Ga0075365_10016081 3300006038 Bacteria 4541
39 Ga0075368_10001420 3300006042 Bacteria 7661
40 Ga0075368_10003207 3300006042 Bacteria 5434
41 Ga0075363_100022117 3300006048 Bacteria 3212
42 Ga0075363_100032598 3300006048 Bacteria 2707
43 Ga0075363_100039489 3300006048 Bacteria 2484
44 Ga0075364_10004815 3300006051 Bacteria 7813
45 Ga0075364_10005730 3300006051 Bacteria 7242
46 Ga0075432_10036523 3300006058 Bacteria 1708
47 Ga0075362_10007338 3300006177 Bacteria 4170
48 Ga0075362_10013717 3300006177 Bacteria 3251
49 Ga0075367_10001861 3300006178 Bacteria 9321
50 Ga0075367_10006560 3300006178 Bacteria 5891
51 Ga0075367_10007276 3300006178 Bacteria 5658
52 Ga0075367_10016526 3300006178 Bacteria 4030
53 Ga0075367_10099273 3300006178 Bacteria 1778
54 Ga0075369_10019098 3300006186 Bacteria 2796
55 Ga0075369_10034234 3300006186 Bacteria 2156
56 Ga0075366_10005054 3300006195 Bacteria 7130
57 Ga0075366_10172985 3300006195 Bacteria 1311
58 Ga0075370_10139021 3300006353 Bacteria 1419
59 Ga0075428_100003249 3300006844 Bacteria 17798
60 Ga0075428_100079494 3300006844 Bacteria 3579
61 Ga0075428_100152755 3300006844 Bacteria 2508
62 Ga0075430_100085484 3300006846 Bacteria 2641
63 Ga0075431_100022345 3300006847 Bacteria 6466
64 Ga0075431_100320411 3300006847 Bacteria 1563
65 Ga0075429_100013723 3300006880 Bacteria 7023
66 Ga0075429_100103644 3300006880 Bacteria 2485
67 Ga0111539_10000208 3300009094 Bacteria 69518
68 Ga0111539_10001652 3300009094 Bacteria 29773
69 Ga0111539_10022926 3300009094 Bacteria 7666
70 Ga0111539_10027224 3300009094 Bacteria 6983
71 Ga0111539_10483375 3300009094 Bacteria 1442
72 Ga0111539_10580896 3300009094 Bacteria 1305
73 Ga0105247_10102563 3300009101 Bacteria 1831
74 Ga0114129_10001020 3300009147 Bacteria 36568
75 Ga0114129_10092613 3300009147 Bacteria 4187
76 Ga0105243_10011574 3300009148 Bacteria 6675
77 Ga0105242_10001133 3300009176 Bacteria 20985
78 Ga0105248_10518097 3300009177 Bacteria 1345
79 Ga0105249_10287005 3300009553 Bacteria 1646
80 Ga0105249_10605895 3300009553 Bacteria 1150
81 Ga0105239_10492641 3300010375 Bacteria 1393
82 Ga0163162_10030341 3300013306 Bacteria 5357
83 Ga0157375_10200923 3300013308 Bacteria 2149
84 Ga0157380_10009947 3300014326 Bacteria 6825
85 Ga0157380_10027610 3300014326 Bacteria 4318
86 Ga0157380_10172220 3300014326 Bacteria 1893
87 Ga0209436_100290 3300025208 Bacteria 23122
88 Ga0209130_1000033 3300025284 Bacteria 316064
89 Ga0209130_1000447 3300025284 Bacteria 43525
90 Ga0209676_1001879 3300025292 Bacteria 17159
91 Ga0209025_1000032 3300025294 Bacteria 416141
92 Ga0209025_1000697 3300025294 Bacteria 57311
93 Ga0209025_1027744 3300025294 Bacteria 2798
94 Ga0209025_1035858 3300025294 Bacteria 2232
95 Ga0209564_1000079 3300025295 Bacteria 266525
96 Ga0209256_1000310 3300025299 Bacteria 85227
97 Ga0209256_1000950 3300025299 Bacteria 35138
98 Ga0207426_1000078 3300025302 Bacteria 316064
99 Ga0209257_1006061 3300025304 Bacteria 8047
100 Ga0207645_10072893 3300025907 Bacteria 2198
101 Ga0207643_10030044 3300025908 Bacteria 3023
102 Ga0207705_10015819 3300025909 Bacteria 5418
103 Ga0207690_10191430 3300025932 Bacteria 1547
104 Ga0207686_10001396 3300025934 Bacteria 13734
105 Ga0207669_10261481 3300025937 Bacteria 1295
106 Ga0207691_10072995 3300025940 Bacteria 3095
107 Ga0207691_10323190 3300025940 Bacteria 1323
108 Ga0207711_10059355 3300025941 Bacteria 3294
109 Ga0207689_10166511 3300025942 Bacteria 1816
110 Ga0207668_10048655 3300025972 Bacteria 2911
111 Ga0207658_10204477 3300025986 Bacteria 1651
112 Ga0207703_10001282 3300026035 Bacteria 23304
113 Ga0207678_10092429 3300026067 Bacteria 2586
114 Ga0207708_10175653 3300026075 Bacteria 1699
115 Ga0207641_10289433 3300026088 Bacteria 1544
116 Ga0207648_10053632 3300026089 Bacteria 3523
117 Ga0207676_10090192 3300026095 Bacteria 2515
118 Ga0207675_100120683 3300026118 Bacteria 2480
119 Ga0207683_10146746 3300026121 Bacteria 2128
120 Ga0209813_10000181 3300027866 Bacteria 20461
121 Ga0209813_10023545 3300027866 Bacteria 1752
122 Ga0209974_10001110 3300027876 Bacteria 9529
123 Ga0207428_10000016 3300027907 Bacteria 327690
124 Ga0207428_10007766 3300027907 Bacteria 9761
125 Ga0207428_10023650 3300027907 Bacteria 5164
126 Ga0207428_10178703 3300027907 Bacteria 1604
127 Ga0307517_10000035 3300028786 Bacteria 172762
128 Ga0307509_10008423 3300031507 Bacteria 13161
129 Ga0307408_100012537 3300031548 Bacteria 5619
130 Ga0307405_10012548 3300031731 Bacteria 4491
131 Ga0307413_10011036 3300031824 Bacteria 4418
132 Ga0307413_10197214 3300031824 Bacteria 1451
133 Ga0307410_10005327 3300031852 Bacteria 6793
134 Ga0307406_10002188 3300031901 Bacteria 10639
135 Ga0307407_10066371 3300031903 Bacteria 2128
136 Ga0307412_10015079 3300031911 Bacteria 4572
137 Ga0307409_100008985 3300031995 Bacteria 6108
138 Ga0307409_100226419 3300031995 Bacteria 1692
139 Ga0307416_100096797 3300032002 Bacteria 2553
140 Ga0307414_10008726 3300032004 Bacteria 5776
141 Ga0307411_10004167 3300032005 Bacteria 6872
142 Ga0307411_10030178 3300032005 Bacteria 3321
143 Ga0373931_0157989 3300035691 Bacteria 1327
144 Ga0373927_0021368 3300035695 Bacteria 4242
145 Ga0373927_0068046 3300035695 Bacteria 2304
146 Ga0439453_0005354 3300041408 Bacteria 1951
147 Ga0439435_0056421 3300042436 Bacteria 1135
148 Ga0451577_0000191 3300042876 Bacteria 128991
149 Ga0451577_0219845 3300042876 Bacteria 1717
150 Ga0453684_0000590 3300044712 Bacteria 134718
151 Ga0451576_0004238 3300045051 Bacteria 18831
152 Ga0451576_0084751 3300045051 Bacteria 3297
153 Ga0451576_0314006 3300045051 Bacteria 1640
154 Ga0495580_0009635 3300046472 Bacteria 7585
155 Ga0495625_0262263 3300046660 Bacteria 1118
156 Ga0496104_0002785 3300048907 Bacteria 15071
157 Ga0496104_0446107 3300048907 Unclassified 1206
158 Ga0496105_0048804 3300048908 Bacteria 3494
159 Ga0496105_0278260 3300048908 Bacteria 1350
160 Ga0496108_0166764 3300048911 Bacteria 1904
161 Ga0496109_0102707 3300048912 Bacteria 2653
162 Ga0496110_0017164 3300048913 Bacteria 6052
163 Ga0496111_0008265 3300048914 Bacteria 6882
164 Ga0496111_0183640 3300048914 Bacteria 1555
165 Ga0496112_0054960 3300048915 Bacteria 3913
166 Ga0496112_0213445 3300048915 Bacteria 1887
167 Ga0496113_0060514 3300048916 Bacteria 2855
168 Ga0496118_0008599 3300048921 Bacteria 10508
169 Ga0496121_0021027 3300048924 Bacteria 6418
170 Ga0496121_0026855 3300048924 Bacteria 5408
171 Ga0501031_0000002 3300049568 Bacteria 217588
172 Ga0501031_0072337 3300049568 Bacteria 2245
173 Ga0501031_0147220 3300049568 Bacteria 1539
174 Ga0501032_0000004 3300049569 Bacteria 310855
175 Ga0501032_0183662 3300049569 Bacteria 1369
176 Ga0501033_0000016 3300049570 Bacteria 217458
177 Ga0501033_0070713 3300049570 Bacteria 2563
178 Ga0501033_0123107 3300049570 Bacteria 1881
179 Ga0501034_0000011 3300049571 Bacteria 310855
180 Ga0501034_0030244 3300049571 Bacteria 5505
181 Ga0501036_0000001 3300049572 Bacteria 310855
182 Ga0501036_0105667 3300049572 Bacteria 2381
183 Ga0501037_0000006 3300049573 Bacteria 217461
184 Ga0501037_0357111 3300049573 Bacteria 1007
185 Ga0501038_0000003 3300049574 Bacteria 310855
186 Ga0501038_0228882 3300049574 Bacteria 1480
187 Ga0501039_0000004 3300049575 Bacteria 310855
188 Ga0501039_0095203 3300049575 Bacteria 2322
189 Ga0501039_0252323 3300049575 Bacteria 1387
190 Ga0501040_0006793 3300049576 Bacteria 7418
191 Ga0501040_0135578 3300049576 Bacteria 1733
192 Ga0501040_0265684 3300049576 Bacteria 1225
193 Ga0501041_0029120 3300049577 Bacteria 3332
194 Ga0501041_0032811 3300049577 Bacteria 3139
195 Ga0501042_0160172 3300049578 Bacteria 1624
196 Ga0501042_0207365 3300049578 Bacteria 1413
197 Ga0501043_0000478 3300049579 Bacteria 35744
198 Ga0501043_0232136 3300049579 Bacteria 1425
199 Ga0501046_0050548 3300049580 Bacteria 3284
200 Ga0501047_0000968 3300049581 Bacteria 29008
201 Ga0501048_0151009 3300049582 Bacteria 1643
202 Ga0501071_0027902 3300049587 Bacteria 3974
203 Ga0501071_0029057 3300049587 Bacteria 3899
204 Ga0501072_0032530 3300049588 Bacteria 4085
205 Ga0501072_0036137 3300049588 Bacteria 3872
206 Ga0501075_0105258 3300049591 Bacteria 2144
207 Ga0501076_0086729 3300049592 Bacteria 2516
208 Ga0501076_0098523 3300049592 Bacteria 2355
209 Ga0501077_0122922 3300049593 Bacteria 1645
210 Ga0501079_0110855 3300049741 Bacteria 2132
211 Ga0501079_0166011 3300049741 Bacteria 1722
212 Ga0501080_0074125 3300049742 Bacteria 3167
213 Ga0501080_0416988 3300049742 Bacteria 1206
214 Ga0501081_0079622 3300049743 Bacteria 2291
215 Ga0501083_0289056 3300049744 Bacteria 1066
216 Ga0501035_0000009 3300049822 Bacteria 310827
217 Ga0501035_0368017 3300049822 Bacteria 1200
218 Ga0501044_0000005 3300049823 Bacteria 310855
219 Ga0501044_0297361 3300049823 Bacteria 1544
220 Ga0501044_0312824 3300049823 Bacteria 1497
221 Ga0501044_0319248 3300049823 Bacteria 1478
222 Ga0501045_0141457 3300049824 Bacteria 1789
223 Ga0501045_0184495 3300049824 Bacteria 1554
224 nmdc:mga03683_8726_c1 3300050489 Bacteria 3575
225 nmdc:mga03n38_10363_c1 3300050490 Bacteria 3424
226 nmdc:mga03n38_9026_c1 3300050490 Bacteria 2272
227 nmdc:mga00v17_31457_c1 3300050491 Bacteria 3130
228 nmdc:mga00v17_6085_c1 3300050491 Bacteria 6386
229 nmdc:mga0yw44_11688_c1 3300050492 Bacteria 4546
230 nmdc:mga0yw44_5894_c1 3300050492 Bacteria 5857
231 nmdc:mga0k408_3590_c1 3300050493 Bacteria 8204
232 nmdc:mga06z11_1555_c1 3300050494 Bacteria 8532
233 nmdc:mga06z11_1582_c1 3300050494 Bacteria 8478
234 nmdc:mga06z11_1754_c1 3300050494 Bacteria 8154
235 nmdc:mga06z11_39660_c1 3300050494 Bacteria 2345
236 nmdc:mga04h51_1223_c1 3300050495 Bacteria 5938
237 nmdc:mga04h51_12644_c1 3300050495 Bacteria 2374
238 nmdc:mga05p37_220936_c1 3300050507 Bacteria 2286
239 nmdc:mga05p37_387623_c1 3300050507 Bacteria 1635
240 nmdc:mga05p37_4031_c1 3300050507 Bacteria 17172
241 nmdc:mga09592_21598_c1 3300050508 Bacteria 5306
242 nmdc:mga09592_58738_c1 3300050508 Bacteria 3252
243 nmdc:mga09592_96504_c1 3300050508 Bacteria 2529
244 nmdc:mga0qj67_82206_c1 3300050509 Bacteria 2583
245 nmdc:mga06r32_2724_c1 3300050510 Bacteria 15809
246 nmdc:mga06r32_87211_c1 3300050510 Bacteria 3045
247 nmdc:mga08y16_207164_c1 3300050511 Bacteria 2031
248 nmdc:mga08y16_26_c1 3300050511 Bacteria 223965
249 nmdc:mga08y16_35988_c1 3300050511 Bacteria 5199
250 nmdc:mga08y16_40394_c1 3300050511 Bacteria 4891
251 nmdc:mga08y16_475037_c1 3300050511 Bacteria 1273
252 nmdc:mga08y16_843_c1 3300050511 Bacteria 22807
253 Ga0500644_0001088 3300053088 Bacteria 8020
254 Ga0500651_0094789 3300053093 Bacteria 1835
255 Ga0500594_0000753 3300053118 Bacteria 6893
256 Ga0500616_0011463 3300053153 Bacteria 5233
257 Ga0500622_0001145 3300053156 Bacteria 22070
258 Ga0501084_0061167 3300054114 Bacteria 3153
259 Ga0501084_0184278 3300054114 Bacteria 1762
260 Ga0501082_0073215 3300060353 Bacteria 2951
261 Ga0501082_0089175 3300060353 Bacteria 2663
262 Ga0530510_0020741 3300061734 Bacteria 4675
263 2514589475 2513237351 Bacteria 6968952
264 2600192549 2599185352 Bacteria 7228948
265 2643809466 2643221557 Bacteria 7184309
266 2644066862 2643221610 Bacteria 7480339
267 2644375807 2643221668 Bacteria 7306521
268 2644418065 2643221675 Bacteria 7473456
269 2644451320 2643221680 Bacteria 7473610
270 2644677406 2643221723 Bacteria 7095460
271 2644691665 2643221726 Bacteria 7455827
272 2644732133 2643221733 Bacteria 5690728
273 2644745517 2643221736 Bacteria 6608466
274 2841761058 2841760612 Bacteria 6454112
275 2841912999 2841911363 Bacteria 6173697
276 2841918746 2841917233 Bacteria 6173500
277 2842780063 2842775625 Bacteria 5587290
278 2844104083 2844104063 Bacteria 6440972
279 2851184069 2851182111 Bacteria 6047226
280 2851247071 2851246043 Bacteria 6439203
281 2883581587 2883577096 Bacteria 4709178
282 2894775021 2894772417 Bacteria 5305674
283 2919705012 2919704043 Bacteria 5560311
284 2929204329 2929199973 Bacteria 7260745
285 8055910647 8055909800 Bacteria 7278581
286 8057530740 8057529695 Bacteria 6306553
287 8057535695 8057529695 Bacteria 6306553
288 Ga0157380_10268659
289 JGI25159J45721_1000052
290 JGI25159J45721_1013569
291 JGI25151J46595_10008500
292 JGI25406J46586_10000208
293 rootL2_10116271
294 JGI25160J50197_1000007
295 JGI25161J50226_1000991
296 Ga0055526_1001100
297 Ga0055524_1000633
298 Ga0055543_1000120
299 Ga0065165_1000011
300 Ga0065165_1000764
301 Ga0070676_10092443
302 Ga0068869_100163340
303 Ga0068868_100125799
304 Ga0070668_100036911
305 Ga0070668_100286880
306 Ga0070675_100318018
307 Ga0070674_100049936
308 Ga0070667_100171715
309 Ga0070667_100229384
310 Ga0070694_100070731
311 Ga0070662_100196538
312 Ga0068867_100150643
313 Ga0070706_100379071
314 Ga0070672_100229730
315 Ga0068861_100027317
316 Ga0068863_100097978
317 Ga0068858_100002684
318 Ga0068860_100372294
319 Ga0068862_100024525
320 Ga0081538_10022257
321 Ga0081540_1000011
322 Ga0081539_10000322
323 Ga0081539_10031960
324 Ga0081539_10055071
325 Ga0075365_10016081
326 Ga0075368_10001420
327 Ga0075368_10003207
328 Ga0075363_100022117
329 Ga0075363_100032598
330 Ga0075363_100039489
331 Ga0075364_10004815
332 Ga0075364_10005730
333 Ga0075432_10036523
334 Ga0075362_10007338
335 Ga0075362_10013717
336 Ga0075367_10001861
337 Ga0075367_10006560
338 Ga0075367_10007276
339 Ga0075367_10016526
340 Ga0075367_10099273
341 Ga0075369_10019098
342 Ga0075369_10034234
343 Ga0075366_10005054
344 Ga0075366_10172985
345 Ga0075370_10139021
346 Ga0075428_100003249
347 Ga0075428_100079494
348 Ga0075428_100152755
349 Ga0075430_100085484
350 Ga0075431_100022345
351 Ga0075431_100320411
352 Ga0075429_100013723
353 Ga0075429_100103644
354 Ga0111539_10000208
355 Ga0111539_10001652
356 Ga0111539_10022926
357 Ga0111539_10027224
358 Ga0111539_10483375
359 Ga0111539_10580896
360 Ga0105247_10102563
361 Ga0114129_10001020
362 Ga0114129_10092613
363 Ga0105243_10011574
364 Ga0105242_10001133
365 Ga0105248_10518097
366 Ga0105249_10287005
367 Ga0105249_10605895
368 Ga0105239_10492641
369 Ga0163162_10030341
370 Ga0157375_10200923
371 Ga0157380_10009947
372 Ga0157380_10027610
373 Ga0157380_10172220
374 Ga0209436_100290
375 Ga0209130_1000033
376 Ga0209130_1000447
377 Ga0209676_1001879
378 Ga0209025_1000032
379 Ga0209025_1000697
380 Ga0209025_1027744
381 Ga0209025_1035858
382 Ga0209564_1000079
383 Ga0209256_1000310
384 Ga0209256_1000950
385 Ga0207426_1000078
386 Ga0209257_1006061
387 Ga0207645_10072893
388 Ga0207643_10030044
389 Ga0207705_10015819
390 Ga0207690_10191430
391 Ga0207686_10001396
392 Ga0207669_10261481
393 Ga0207691_10072995
394 Ga0207691_10323190
395 Ga0207711_10059355
396 Ga0207689_10166511
397 Ga0207668_10048655
398 Ga0207658_10204477
399 Ga0207703_10001282
400 Ga0207678_10092429
401 Ga0207708_10175653
402 Ga0207641_10289433
403 Ga0207648_10053632
404 Ga0207676_10090192
405 Ga0207675_100120683
406 Ga0207683_10146746
407 Ga0209813_10000181
408 Ga0209813_10023545
409 Ga0209974_10001110
410 Ga0207428_10000016
411 Ga0207428_10007766
412 Ga0207428_10023650
413 Ga0207428_10178703
414 Ga0307517_10000035
415 Ga0307509_10008423
416 Ga0307408_100012537
417 Ga0307405_10012548
418 Ga0307413_10011036
419 Ga0307413_10197214
420 Ga0307410_10005327
421 Ga0307406_10002188
422 Ga0307407_10066371
423 Ga0307412_10015079
424 Ga0307409_100008985
425 Ga0307409_100226419
426 Ga0307416_100096797
427 Ga0307414_10008726
428 Ga0307411_10004167
429 Ga0307411_10030178
430 Ga0373931_0157989
431 Ga0373927_0021368
432 Ga0373927_0068046
433 Ga0439453_0005354
434 Ga0439435_0056421
435 Ga0451577_0000191
436 Ga0451577_0219845
437 Ga0453684_0000590
438 Ga0451576_0004238
439 Ga0451576_0084751
440 Ga0451576_0314006
441 Ga0495580_0009635
442 Ga0495625_0262263
443 Ga0496104_0002785
444 Ga0496104_0446107
445 Ga0496105_0048804
446 Ga0496105_0278260
447 Ga0496108_0166764
448 Ga0496109_0102707
449 Ga0496110_0017164
450 Ga0496111_0008265
451 Ga0496111_0183640
452 Ga0496112_0054960
453 Ga0496112_0213445
454 Ga0496113_0060514
455 Ga0496118_0008599
456 Ga0496121_0021027
457 Ga0496121_0026855
458 Ga0501031_0000002
459 Ga0501031_0072337
460 Ga0501031_0147220
461 Ga0501032_0000004
462 Ga0501032_0183662
463 Ga0501033_0000016
464 Ga0501033_0070713
465 Ga0501033_0123107
466 Ga0501034_0000011
467 Ga0501034_0030244
468 Ga0501036_0000001
469 Ga0501036_0105667
470 Ga0501037_0000006
471 Ga0501037_0357111
472 Ga0501038_0000003
473 Ga0501038_0228882
474 Ga0501039_0000004
475 Ga0501039_0095203
476 Ga0501039_0252323
477 Ga0501040_0006793
478 Ga0501040_0135578
479 Ga0501040_0265684
480 Ga0501041_0029120
481 Ga0501041_0032811
482 Ga0501042_0160172
483 Ga0501042_0207365
484 Ga0501043_0000478
485 Ga0501043_0232136
486 Ga0501046_0050548
487 Ga0501047_0000968
488 Ga0501048_0151009
489 Ga0501071_0027902
490 Ga0501071_0029057
491 Ga0501072_0032530
492 Ga0501072_0036137
493 Ga0501075_0105258
494 Ga0501076_0086729
495 Ga0501076_0098523
496 Ga0501077_0122922
497 Ga0501079_0110855
498 Ga0501079_0166011
499 Ga0501080_0074125
500 Ga0501080_0416988
501 Ga0501081_0079622
502 Ga0501083_0289056
503 Ga0501035_0000009
504 Ga0501035_0368017
505 Ga0501044_0000005
506 Ga0501044_0297361
507 Ga0501044_0312824
508 Ga0501044_0319248
509 Ga0501045_0141457
510 Ga0501045_0184495
511 nmdc:mga03683_8726_c1
512 nmdc:mga03n38_10363_c1
513 nmdc:mga03n38_9026_c1
514 nmdc:mga00v17_31457_c1
515 nmdc:mga00v17_6085_c1
516 nmdc:mga0yw44_11688_c1
517 nmdc:mga0yw44_5894_c1
518 nmdc:mga0k408_3590_c1
519 nmdc:mga06z11_1555_c1
520 nmdc:mga06z11_1582_c1
521 nmdc:mga06z11_1754_c1
522 nmdc:mga06z11_39660_c1
523 nmdc:mga04h51_1223_c1
524 nmdc:mga04h51_12644_c1
525 nmdc:mga05p37_220936_c1
526 nmdc:mga05p37_387623_c1
527 nmdc:mga05p37_4031_c1
528 nmdc:mga09592_21598_c1
529 nmdc:mga09592_58738_c1
530 nmdc:mga09592_96504_c1
531 nmdc:mga0qj67_82206_c1
532 nmdc:mga06r32_2724_c1
533 nmdc:mga06r32_87211_c1
534 nmdc:mga08y16_207164_c1
535 nmdc:mga08y16_26_c1
536 nmdc:mga08y16_35988_c1
537 nmdc:mga08y16_40394_c1
538 nmdc:mga08y16_475037_c1
539 nmdc:mga08y16_843_c1
540 Ga0500644_0001088
541 Ga0500651_0094789
542 Ga0500594_0000753
543 Ga0500616_0011463
544 Ga0500622_0001145
545 Ga0501084_0061167
546 Ga0501084_0184278
547 Ga0501082_0073215
548 Ga0501082_0089175
549 Ga0530510_0020741
550 2514589475
551 2600192549
552 2643809466
553 2644066862
554 2644375807
555 2644418065
556 2644451320
557 2644677406
558 2644691665
559 2644732133
560 2644745517
561 2841761058
562 2841912999
563 2841918746
564 2842780063
565 2844104083
566 2851184069
567 2851247071
568 2883581587
569 2894775021
570 2919705012
571 2929204329
572 8055910647
573 8057530740
574 8057535695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

86

373

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i7i-assembly1.cif.gz_A crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-crystallized 3-hydroxybenzoate 0.976 33 348
5izz-assembly1.cif.gz_A crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with metahydroxyphenylacetate, thermal exchange of ligand 0.9734 33 348
7nr2-assembly4.cif.gz_EEE the structure of the sbp tarp_sse in complex with coumarate 0.9661 33 348
5i7i-assembly1.cif.gz_A crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-crystallized 3-hydroxybenzoate 0.9639 33 348
5izz-assembly1.cif.gz_A crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with metahydroxyphenylacetate, thermal exchange of ligand 0.9614 33 348
ID Description Score Start End Superfamily
5izzA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9734 33 348 3.40.190.170
5izzA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9614 33 348 3.40.190.170
5im2A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9586 33 350 3.40.190.170
5im2A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9441 33 350 3.40.190.170
4p56A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9185 33 347 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A3D3SNP8-F1-model_v4 deleted 0.9765 73 349
AF-A0A2E6RRN2-F1-model_v4 C4-dicarboxylate ABC transporter 0.9751 22 348 GO:0055085
AF-A0A553AMA6-F1-model_v4 TRAP transporter substrate-binding protein 0.9717 45 351 GO:0042597
GO:0055085
AF-A0A4R6EF00-F1-model_v4 TRAP-type C4-dicarboxylate transport system substrate-binding protein 0.9708 26 348 GO:0055085
AF-A0A7W1L6Y3-F1-model_v4 TRAP transporter substrate-binding protein 0.9705 31 349 GO:0055085

Map