F388662

General Info

Members Datasets Scaffolds Average Seq Length
288 169 285 225

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10143029|Ga0265327_101430292
Length 257
Sequence MRNYSRSNWDLSCISAKFLPNLPLNLCQNFIPLKILVIEDEPVLCETIVSYLEGERYRCEHASTLEKGIEKISLYEYDCILVDIGLPDGNGLSLIRELKKKHPETGIIIVSAKNSNEDKILGLDLGADDYLTKPFHLPELNSRIKSLLRRRKFEGKQEVIIDNITIIPDNRQVFVNNDPVQLTKSEFDLLLFFVANRGRVLSKEAIAEHLWGDFADGADSFDFVYSHLKNLRRKLVEKAEVDYFQNVYGSGYVFMAE

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
108 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.42
Nodule 0
Rhizoplane 0
Rhizosphere 84.03
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_7600008 2162886011 Bacteria 871
2 JGI24736J21556_1039532 3300001904 Unclassified 726
3 rootH2_10000018 3300003320 Bacteria 23416
4 rootH2_10003786 3300003320 Bacteria 46076
5 rootH2_10020473 3300003320 Bacteria 12354
6 rootL2_10251969 3300003322 Bacteria 3700
7 Ga0055530_10011173 3300003791 Bacteria 3249
8 Ga0065715_10385424 3300005293 Bacteria 900
9 Ga0070676_10330221 3300005328 Bacteria 1043
10 Ga0068869_100115789 3300005334 Bacteria 2044
11 Ga0070666_10007610 3300005335 Bacteria 6683
12 Ga0070680_100007372 3300005336 Bacteria 8394
13 Ga0070680_100246196 3300005336 Bacteria 1511
14 Ga0070682_100002612 3300005337 Bacteria 9950
15 Ga0070660_100795249 3300005339 Bacteria 795
16 Ga0070689_100333705 3300005340 Bacteria 1269
17 Ga0070691_10002611 3300005341 Bacteria 8042
18 Ga0070691_10013381 3300005341 Bacteria 3758
19 Ga0070687_100179639 3300005343 Bacteria 1267
20 Ga0070661_100022198 3300005344 Bacteria 4542
21 Ga0070661_100464806 3300005344 Bacteria 1008
22 Ga0070668_100162921 3300005347 Bacteria 1810
23 Ga0070669_100064597 3300005353 Bacteria 2696
24 Ga0070671_100104603 3300005355 Bacteria 2376
25 Ga0070674_100042174 3300005356 Bacteria 3098
26 Ga0070659_100002512 3300005366 Bacteria 13024
27 Ga0070667_100141211 3300005367 Bacteria 2109
28 Ga0070667_100244736 3300005367 Bacteria 1602
29 Ga0070667_100306248 3300005367 Bacteria 1431
30 Ga0070713_100100224 3300005436 Bacteria 2507
31 Ga0070700_100383952 3300005441 Archaea 1051
32 Ga0070681_10138400 3300005458 Bacteria 2364
33 Ga0068867_100598718 3300005459 Bacteria 961
34 Ga0068867_100640175 3300005459 Bacteria 932
35 Ga0070685_10337702 3300005466 Bacteria 1026
36 Ga0070679_100054593 3300005530 Unclassified 3978
37 Ga0070684_100014474 3300005535 Bacteria 6393
38 Ga0068853_100000355 3300005539 Bacteria 31586
39 Ga0068853_100000579 3300005539 Bacteria 24990
40 Ga0068853_100085142 3300005539 Unclassified 2771
41 Ga0070686_100360993 3300005544 Bacteria 1094
42 Ga0070693_100007282 3300005547 Bacteria 5402
43 Ga0070665_100000006 3300005548 Bacteria 718034
44 Ga0070665_100264525 3300005548 Bacteria 1721
45 Ga0068855_100003071 3300005563 Bacteria 20426
46 Ga0068855_100016977 3300005563 Bacteria 8755
47 Ga0068855_100042913 3300005563 Bacteria 5359
48 Ga0068856_100091813 3300005614 Unclassified 3021
49 Ga0068856_100151747 3300005614 Bacteria 2326
50 Ga0068856_100299992 3300005614 Bacteria 1624
51 Ga0068852_100000327 3300005616 Bacteria 32309
52 Ga0068852_100023905 3300005616 Bacteria 4929
53 Ga0068852_100038610 3300005616 Unclassified 4015
54 Ga0068852_100453732 3300005616 Bacteria 1269
55 Ga0068859_100628795 3300005617 Unclassified 1166
56 Ga0068864_100471242 3300005618 Bacteria 1204
57 Ga0068866_10231201 3300005718 Bacteria 1121
58 Ga0068851_10189019 3300005834 Bacteria 1144
59 Ga0068860_100000046 3300005843 Bacteria 214800
60 Ga0068860_100148365 3300005843 Unclassified 2258
61 Ga0081540_1079783 3300005983 Bacteria 1478
62 Ga0075365_10009690 3300006038 Bacteria 5558
63 Ga0075368_10006541 3300006042 Bacteria 4076
64 Ga0075363_100005226 3300006048 Bacteria 5753
65 Ga0075364_10001339 3300006051 Bacteria 13277
66 Ga0075367_10000626 3300006178 Bacteria 13524
67 Ga0097620_100628742 3300006931 Unclassified 1166
68 Ga0105240_10000059 3300009093 Bacteria 219860
69 Ga0105240_10000354 3300009093 Bacteria 86047
70 Ga0105240_10000421 3300009093 Bacteria 78509
71 Ga0105240_10000520 3300009093 Bacteria 70859
72 Ga0105240_10022095 3300009093 Bacteria 8443
73 Ga0105240_10111479 3300009093 Bacteria 3309
74 Ga0105240_10695410 3300009093 Bacteria 1110
75 Ga0111539_10297243 3300009094 Bacteria 1879
76 Ga0105241_10004008 3300009174 Bacteria 10887
77 Ga0105241_10017428 3300009174 Bacteria 5280
78 Ga0105241_10211142 3300009174 Bacteria 1626
79 Ga0105237_10000107 3300009545 Bacteria 117149
80 Ga0105237_10012702 3300009545 Bacteria 8860
81 Ga0105237_10032437 3300009545 Bacteria 5288
82 Ga0105237_10044978 3300009545 Bacteria 4445
83 Ga0105238_10045564 3300009551 Bacteria 4430
84 Ga0105238_10052534 3300009551 Bacteria 4097
85 Ga0105238_10310927 3300009551 Bacteria 1561
86 Ga0105249_10004268 3300009553 Bacteria 12351
87 Ga0105249_10025044 3300009553 Bacteria 5369
88 Ga0105239_10000237 3300010375 Bacteria 81666
89 Ga0105239_10000283 3300010375 Bacteria 74612
90 Ga0105239_10004632 3300010375 Bacteria 16343
91 Ga0105239_10007638 3300010375 Bacteria 12392
92 Ga0105239_10028577 3300010375 Bacteria 6131
93 Ga0105239_10305991 3300010375 Bacteria 1790
94 Ga0105239_11032656 3300010375 Bacteria 945
95 Ga0157373_10000006 3300013100 Bacteria 261768
96 Ga0157373_10003337 3300013100 Bacteria 12128
97 Ga0157373_10157779 3300013100 Bacteria 1596
98 Ga0157371_10029713 3300013102 Unclassified 3949
99 Ga0157371_10436225 3300013102 Bacteria 962
100 Ga0157370_10019064 3300013104 Bacteria 6895
101 Ga0157370_10538313 3300013104 Bacteria 1071
102 Ga0157370_10816540 3300013104 Bacteria 848
103 Ga0157369_10036832 3300013105 Bacteria 5358
104 Ga0157369_10108659 3300013105 Bacteria 2950
105 Ga0157374_10000013 3300013296 Bacteria 461240
106 Ga0157374_10188464 3300013296 Bacteria 2017
107 Ga0157374_10238223 3300013296 Bacteria 1789
108 Ga0157378_10111978 3300013297 Bacteria 2503
109 Ga0163162_10002096 3300013306 Bacteria 18720
110 Ga0163162_10016877 3300013306 Bacteria 7137
111 Ga0163162_10193312 3300013306 Bacteria 2163
112 Ga0163162_10328896 3300013306 Bacteria 1661
113 Ga0157372_10021952 3300013307 Bacteria 6901
114 Ga0157372_10022657 3300013307 Bacteria 6798
115 Ga0157372_10050121 3300013307 Bacteria 4645
116 Ga0157372_10051044 3300013307 Bacteria 4602
117 Ga0157372_10091938 3300013307 Unclassified 3451
118 Ga0157372_10409852 3300013307 Bacteria 1579
119 Ga0157372_10767703 3300013307 Bacteria 1121
120 Ga0157372_10841732 3300013307 Bacteria 1065
121 Ga0157375_11426689 3300013308 Bacteria 816
122 Ga0163163_10056046 3300014325 Bacteria 3896
123 Ga0163163_10442378 3300014325 Bacteria 1360
124 Ga0157380_10000491 3300014326 Bacteria 24096
125 Ga0157380_10028892 3300014326 Bacteria 4234
126 Ga0182008_10000003 3300014497 Bacteria 456880
127 Ga0157376_10002704 3300014969 Bacteria 12073
128 Ga0163161_10026028 3300017792 Unclassified 4144
129 Ga0163161_10040091 3300017792 Bacteria 3363
130 Ga0209050_1004060 3300025298 Bacteria 10247
131 Ga0207696_1025433 3300025711 Bacteria 1845
132 Ga0207680_10016772 3300025903 Unclassified 3854
133 Ga0207647_10000562 3300025904 Bacteria 29264
134 Ga0207647_10066664 3300025904 Bacteria 2182
135 Ga0207654_10012421 3300025911 Unclassified 4365
136 Ga0207707_10002191 3300025912 Bacteria 17703
137 Ga0207707_10027165 3300025912 Bacteria 5005
138 Ga0207695_10000039 3300025913 Bacteria 454801
139 Ga0207695_10000051 3300025913 Bacteria 399641
140 Ga0207695_10000056 3300025913 Bacteria 382433
141 Ga0207695_10000081 3300025913 Bacteria 284797
142 Ga0207695_10000156 3300025913 Bacteria 204576
143 Ga0207695_10000421 3300025913 Bacteria 93835
144 Ga0207695_10000488 3300025913 Bacteria 84750
145 Ga0207695_10003890 3300025913 Bacteria 20675
146 Ga0207695_10045504 3300025913 Bacteria 4658
147 Ga0207695_10054261 3300025913 Bacteria 4187
148 Ga0207695_10080012 3300025913 Bacteria 3310
149 Ga0207695_10148231 3300025913 Bacteria 2288
150 Ga0207671_10002328 3300025914 Bacteria 20500
151 Ga0207671_10003195 3300025914 Bacteria 16517
152 Ga0207671_10047105 3300025914 Bacteria 3190
153 Ga0207671_10571196 3300025914 Bacteria 901
154 Ga0207660_10007709 3300025917 Bacteria 6969
155 Ga0207660_10208377 3300025917 Bacteria 1530
156 Ga0207652_10004792 3300025921 Bacteria 10955
157 Ga0207694_10053898 3300025924 Bacteria 3119
158 Ga0207694_10076411 3300025924 Bacteria 2623
159 Ga0207694_10485596 3300025924 Bacteria 1033
160 Ga0207659_10100263 3300025926 Bacteria 2182
161 Ga0207700_10199068 3300025928 Bacteria 1687
162 Ga0207644_10220652 3300025931 Bacteria 1503
163 Ga0207670_10381920 3300025936 Bacteria 1122
164 Ga0207669_10084456 3300025937 Unclassified 2046
165 Ga0207704_10606093 3300025938 Bacteria 897
166 Ga0207691_10124759 3300025940 Unclassified 2279
167 Ga0207689_10014206 3300025942 Bacteria 6775
168 Ga0207679_10173065 3300025945 Bacteria 1779
169 Ga0207667_10001783 3300025949 Bacteria 27109
170 Ga0207667_10018768 3300025949 Bacteria 7744
171 Ga0207667_10224910 3300025949 Bacteria 1922
172 Ga0207712_10046948 3300025961 Bacteria 2996
173 Ga0207712_10148810 3300025961 Bacteria 1806
174 Ga0207640_10294677 3300025981 Bacteria 1280
175 Ga0207658_10267523 3300025986 Bacteria 1459
176 Ga0207639_10051060 3300026041 Unclassified 3144
177 Ga0207639_10322163 3300026041 Bacteria 1373
178 Ga0207639_10334933 3300026041 Bacteria 1348
179 Ga0207702_10119105 3300026078 Bacteria 2360
180 Ga0207702_10429789 3300026078 Bacteria 1278
181 Ga0207648_10344428 3300026089 Bacteria 1343
182 Ga0207675_100005173 3300026118 Bacteria 12557
183 Ga0207675_101208069 3300026118 Bacteria 776
184 Ga0207698_10073898 3300026142 Bacteria 2717
185 Ga0207698_10111419 3300026142 Bacteria 2294
186 Ga0207698_10818911 3300026142 Unclassified 934
187 Ga0209813_10004824 3300027866 Bacteria 3241
188 Ga0209813_10014625 3300027866 Unclassified 2116
189 Ga0268266_10000010 3300028379 Bacteria 1030233
190 Ga0268265_10059927 3300028380 Bacteria 2915
191 Ga0268264_10000041 3300028381 Bacteria 372501
192 Ga0268264_10446848 3300028381 Bacteria 1252
193 Ga0307517_10001115 3300028786 Bacteria 45308
194 Ga0307517_10174224 3300028786 Bacteria 1406
195 Ga0307515_10226874 3300028794 Bacteria 1671
196 Ga0307511_10000758 3300030521 Bacteria 34462
197 Ga0316177_1067457 3300030731 Bacteria 3839
198 Ga0316176_1065924 3300030732 Bacteria 3856
199 Ga0265327_10143029 3300031251 Bacteria 1117
200 Ga0307513_10072120 3300031456 Bacteria 3601
201 Ga0307513_10189658 3300031456 Bacteria 1909
202 Ga0316579_10176055 3300031691 Unclassified 1034
203 Ga0316576_10042792 3300031727 Unclassified 3265
204 Ga0316576_10137661 3300031727 Bacteria 1838
205 Ga0316576_10430723 3300031727 Bacteria 975
206 Ga0316578_10040029 3300031728 Unclassified 2708
207 Ga0316578_10045493 3300031728 Bacteria 2555
208 Ga0316578_10060527 3300031728 Bacteria 2229
209 Ga0307516_10057279 3300031730 Unclassified 3797
210 Ga0307516_10291343 3300031730 Bacteria 1311
211 Ga0307510_10001013 3300033180 Bacteria 29784
212 Ga0316582_0006289 3300036647 Bacteria 6220
213 Ga0316582_0079009 3300036647 Bacteria 2144
214 Ga0316584_0010437 3300036712 Bacteria 6490
215 Ga0316584_0049078 3300036712 Unclassified 3154
216 Ga0316584_0098212 3300036712 Bacteria 2192
217 Ga0316584_0495350 3300036712 Unclassified 859
218 Ga0373925_0635068 3300037068 Unclassified 880
219 Ga0395900_0023357 3300037418 Bacteria 6329
220 Ga0395900_0230648 3300037418 Bacteria 1862
221 Ga0395900_0961901 3300037418 Bacteria 775
222 Ga0395905_0013067 3300037471 Bacteria 7972
223 Ga0451577_0021687 3300042876 Bacteria 5874
224 Ga0466972_0007346 3300044658 Bacteria 5535
225 Ga0453683_0039010 3300044673 Bacteria 2985
226 Ga0453683_0101653 3300044673 Bacteria 1805
227 Ga0466965_0034087 3300044683 Bacteria 2490
228 Ga0466965_0101142 3300044683 Bacteria 1474
229 Ga0466961_0004449 3300044693 Bacteria 8777
230 Ga0453684_0000676 3300044712 Bacteria 122215
231 Ga0453684_0050136 3300044712 Bacteria 5494
232 Ga0453684_0460253 3300044712 Bacteria 1415
233 Ga0466970_0152435 3300044765 Bacteria 1276
234 Ga0466959_0001128 3300045049 Bacteria 16104
235 Ga0451576_0000083 3300045051 Bacteria 236908
236 Ga0451576_0053946 3300045051 Bacteria 4209
237 Ga0451576_0104070 3300045051 Bacteria 2953
238 Ga0495638_0000039 3300046460 Bacteria 247726
239 Ga0495650_0025804 3300046471 Unclassified 2746
240 Ga0495580_0067421 3300046472 Bacteria 2504
241 Ga0495606_0003663 3300046507 Bacteria 16098
242 Ga0495643_0207226 3300046522 Bacteria 938
243 Ga0495648_0002802 3300046524 Bacteria 15700
244 Ga0495611_0001141 3300046648 Bacteria 13893
245 Ga0495625_0144856 3300046660 Bacteria 1600
246 Ga0495625_0152000 3300046660 Bacteria 1556
247 Ga0495649_0042356 3300046694 Bacteria 2488
248 Ga0495687_000001 3300047443 Bacteria 1215582
249 Ga0495686_0000010 3300047472 Bacteria 573229
250 Ga0496119_0000640 3300048922 Bacteria 47184
251 Ga0496120_0001270 3300048923 Bacteria 31580
252 Ga0496124_0416002 3300048927 Bacteria 928
253 Ga0501034_0097913 3300049571 Unclassified 2929
254 Ga0501047_0244017 3300049581 Bacteria 1646
255 Ga0501048_0219134 3300049582 Bacteria 1350
256 Ga0501069_0093071 3300049585 Unclassified 1705
257 Ga0501070_0013328 3300049586 Bacteria 6933
258 Ga0501073_0026270 3300049589 Bacteria 4171
259 Ga0501074_0579518 3300049590 Unclassified 794
260 Ga0501236_001451 3300049670 Unclassified 2689
261 Ga0501080_0078663 3300049742 Bacteria 3066
262 Ga0501083_0043318 3300049744 Unclassified 3049
263 Ga0501264_000543 3300049761 Bacteria 5501
264 nmdc:mga03n38_3034_c1 3300050490 Bacteria 4818
265 nmdc:mga03n38_87277_c1 3300050490 Unclassified 1478
266 nmdc:mga00v17_274256_c1 3300050491 Bacteria 1095
267 nmdc:mga0yw44_5903_c1 3300050492 Bacteria 5853
268 nmdc:mga06z11_200_c1 3300050494 Bacteria 23961
269 nmdc:mga04h51_17696_c1 3300050495 Unclassified 2089
270 nmdc:mga04h51_5467_c1 3300050495 Bacteria 3241
271 nmdc:mga08y16_179503_c1 3300050511 Bacteria 2198
272 Ga0500646_0026102 3300053090 Bacteria 1582
273 Ga0500583_0020181 3300053092 Bacteria 2746
274 Ga0500642_0018482 3300053130 Bacteria 2698
275 Ga0500568_0005041 3300053139 Bacteria 6916
276 Ga0500568_0023123 3300053139 Unclassified 2647
277 Ga0500616_0000037 3300053153 Bacteria 390473
278 Ga0500616_0024174 3300053153 Bacteria 3380
279 Ga0500622_0000004 3300053156 Bacteria 557587
280 Ga0500622_0000005 3300053156 Bacteria 502443
281 Ga0500622_0000318 3300053156 Bacteria 48445
282 Ga0500622_0011511 3300053156 Bacteria 4815
283 Ga0500627_0070710 3300053158 Bacteria 1546
284 Ga0501084_0022128 3300054114 Bacteria 5303
285 Ga0501082_0184437 3300060353 Bacteria 1815

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0000640 Ga0496119_0000640_39947_40648 197
2 3300048923 Ga0496120_0001270 Ga0496120_0001270_18451_19152 197
3 3300013296 Ga0157374_10000013 Ga0157374_1000001399 208
4 3300014969 Ga0157376_10002704 Ga0157376_100027042 208
5 3300037418 Ga0395900_0961901 Ga0395900_0961901_17_643 208
6 3300031691 Ga0316579_10176055 Ga0316579_101760551 210
7 3300031727 Ga0316576_10042792 Ga0316576_100427922 210
8 3300031728 Ga0316578_10040029 Ga0316578_100400293 210
9 3300036712 Ga0316584_0049078 Ga0316584_0049078_1886_2563 210
10 3300005614 Ga0068856_100299992 Ga0068856_1002999922 212
11 3300025913 Ga0207695_10003890 Ga0207695_100038908 212
12 3300025914 Ga0207671_10003195 Ga0207671_100031954 212
13 3300025924 Ga0207694_10053898 Ga0207694_100538983 212
14 3300044693 Ga0466961_0004449 Ga0466961_0004449_4752_5429 212
15 3300044765 Ga0466970_0152435 Ga0466970_0152435_114_791 212
16 3300045049 Ga0466959_0001128 Ga0466959_0001128_4231_4908 212
17 3300013297 Ga0157378_10111978 Ga0157378_101119782 215
18 3300046648 Ga0495611_0001141 Ga0495611_0001141_5688_6362 215
19 iso_pu_bacteria 2522125168 2522548942 220
20 3300005548 Ga0070665_100264525 Ga0070665_1002645252 222
21 3300048927 Ga0496124_0416002 Ga0496124_0416002_128_802 222
22 3300053139 Ga0500568_0005041 Ga0500568_0005041_5322_5996 222
23 3300053156 Ga0500622_0000318 Ga0500622_0000318_4550_5224 222
24 3300005436 Ga0070713_100100224 Ga0070713_1001002243 223
25 3300025928 Ga0207700_10199068 Ga0207700_101990681 223
26 3300053156 Ga0500622_0000004 Ga0500622_0000004_292721_293452 223
27 3300053156 Ga0500622_0000005 Ga0500622_0000005_213903_214574 223
28 2162886011 MRS1b_contig_7600008 MRS1b_0439.00001120 224
29 3300001904 JGI24736J21556_1039532 JGI24736J21556_10395321 224
30 3300003320 rootH2_10000018 rootH2_100000183 224
31 3300003320 rootH2_10003786 rootH2_1000378619 224
32 3300003320 rootH2_10020473 rootH2_100204739 224
33 3300003322 rootL2_10251969 rootL2_102519692 224
34 3300003791 Ga0055530_10011173 Ga0055530_100111733 224
35 3300005293 Ga0065715_10385424 Ga0065715_103854241 224
36 3300005328 Ga0070676_10330221 Ga0070676_103302211 224
37 3300005334 Ga0068869_100115789 Ga0068869_1001157892 224
38 3300005335 Ga0070666_10007610 Ga0070666_100076101 224
39 3300005336 Ga0070680_100007372 Ga0070680_1000073722 224
40 3300005336 Ga0070680_100246196 Ga0070680_1002461962 224
41 3300005337 Ga0070682_100002612 Ga0070682_1000026122 224
42 3300005339 Ga0070660_100795249 Ga0070660_1007952491 224
43 3300005340 Ga0070689_100333705 Ga0070689_1003337051 224
44 3300005341 Ga0070691_10002611 Ga0070691_100026112 224
45 3300005341 Ga0070691_10013381 Ga0070691_100133813 224
46 3300005343 Ga0070687_100179639 Ga0070687_1001796391 224
47 3300005344 Ga0070661_100022198 Ga0070661_1000221984 224
48 3300005344 Ga0070661_100464806 Ga0070661_1004648061 224
49 3300005347 Ga0070668_100162921 Ga0070668_1001629212 224
50 3300005353 Ga0070669_100064597 Ga0070669_1000645972 224
51 3300005355 Ga0070671_100104603 Ga0070671_1001046032 224
52 3300005356 Ga0070674_100042174 Ga0070674_1000421741 224
53 3300005366 Ga0070659_100002512 Ga0070659_10000251215 224
54 3300005367 Ga0070667_100141211 Ga0070667_1001412112 224
55 3300005367 Ga0070667_100244736 Ga0070667_1002447362 224
56 3300005367 Ga0070667_100306248 Ga0070667_1003062482 224
57 3300005441 Ga0070700_100383952 Ga0070700_1003839522 224
58 3300005458 Ga0070681_10138400 Ga0070681_101384002 224
59 3300005459 Ga0068867_100598718 Ga0068867_1005987181 224
60 3300005459 Ga0068867_100640175 Ga0068867_1006401751 224
61 3300005466 Ga0070685_10337702 Ga0070685_103377021 224
62 3300005530 Ga0070679_100054593 Ga0070679_1000545932 224
63 3300005535 Ga0070684_100014474 Ga0070684_1000144747 224
64 3300005539 Ga0068853_100000355 Ga0068853_10000035522 224
65 3300005539 Ga0068853_100000579 Ga0068853_1000005792 224
66 3300005539 Ga0068853_100085142 Ga0068853_1000851423 224
67 3300005544 Ga0070686_100360993 Ga0070686_1003609932 224
68 3300005547 Ga0070693_100007282 Ga0070693_1000072822 224
69 3300005548 Ga0070665_100000006 Ga0070665_100000006441 224
70 3300005563 Ga0068855_100003071 Ga0068855_10000307112 224
71 3300005563 Ga0068855_100016977 Ga0068855_1000169774 224
72 3300005563 Ga0068855_100042913 Ga0068855_1000429136 224
73 3300005614 Ga0068856_100091813 Ga0068856_1000918132 224
74 3300005614 Ga0068856_100151747 Ga0068856_1001517473 224
75 3300005616 Ga0068852_100000327 Ga0068852_1000003279 224
76 3300005616 Ga0068852_100023905 Ga0068852_1000239054 224
77 3300005616 Ga0068852_100038610 Ga0068852_1000386102 224
78 3300005616 Ga0068852_100453732 Ga0068852_1004537322 224
79 3300005617 Ga0068859_100628795 Ga0068859_1006287951 224
80 3300005618 Ga0068864_100471242 Ga0068864_1004712422 224
81 3300005718 Ga0068866_10231201 Ga0068866_102312012 224
82 3300005834 Ga0068851_10189019 Ga0068851_101890192 224
83 3300005843 Ga0068860_100000046 Ga0068860_100000046152 224
84 3300005843 Ga0068860_100148365 Ga0068860_1001483652 224
85 3300005983 Ga0081540_1079783 Ga0081540_10797832 224
86 3300006038 Ga0075365_10009690 Ga0075365_100096904 224
87 3300006042 Ga0075368_10006541 Ga0075368_100065413 224
88 3300006048 Ga0075363_100005226 Ga0075363_1000052264 224
89 3300006051 Ga0075364_10001339 Ga0075364_100013392 224
90 3300006178 Ga0075367_10000626 Ga0075367_1000062610 224
91 3300006931 Ga0097620_100628742 Ga0097620_1006287421 224
92 3300009093 Ga0105240_10000059 Ga0105240_10000059126 224
93 3300009093 Ga0105240_10000354 Ga0105240_1000035459 224
94 3300009093 Ga0105240_10000421 Ga0105240_1000042112 224
95 3300009093 Ga0105240_10000520 Ga0105240_1000052030 224
96 3300009093 Ga0105240_10022095 Ga0105240_100220956 224
97 3300009093 Ga0105240_10111479 Ga0105240_101114792 224
98 3300009093 Ga0105240_10695410 Ga0105240_106954101 224
99 3300009094 Ga0111539_10297243 Ga0111539_102972432 224
100 3300009174 Ga0105241_10004008 Ga0105241_100040087 224
101 3300009174 Ga0105241_10017428 Ga0105241_100174282 224
102 3300009174 Ga0105241_10211142 Ga0105241_102111422 224
103 3300009545 Ga0105237_10000107 Ga0105237_1000010740 224
104 3300009545 Ga0105237_10012702 Ga0105237_100127023 224
105 3300009545 Ga0105237_10032437 Ga0105237_100324372 224
106 3300009545 Ga0105237_10044978 Ga0105237_100449782 224
107 3300009551 Ga0105238_10045564 Ga0105238_100455641 224
108 3300009551 Ga0105238_10052534 Ga0105238_100525343 224
109 3300009551 Ga0105238_10310927 Ga0105238_103109272 224
110 3300009553 Ga0105249_10004268 Ga0105249_100042689 224
111 3300009553 Ga0105249_10025044 Ga0105249_100250446 224
112 3300010375 Ga0105239_10000237 Ga0105239_1000023722 224
113 3300010375 Ga0105239_10000283 Ga0105239_1000028357 224
114 3300010375 Ga0105239_10004632 Ga0105239_1000463210 224
115 3300010375 Ga0105239_10007638 Ga0105239_1000763811 224
116 3300010375 Ga0105239_10028577 Ga0105239_100285774 224
117 3300010375 Ga0105239_10305991 Ga0105239_103059912 224
118 3300010375 Ga0105239_11032656 Ga0105239_110326561 224
119 3300013100 Ga0157373_10000006 Ga0157373_10000006212 224
120 3300013100 Ga0157373_10003337 Ga0157373_100033379 224
121 3300013100 Ga0157373_10157779 Ga0157373_101577792 224
122 3300013102 Ga0157371_10029713 Ga0157371_100297133 224
123 3300013102 Ga0157371_10436225 Ga0157371_104362252 224
124 3300013104 Ga0157370_10019064 Ga0157370_100190642 224
125 3300013104 Ga0157370_10538313 Ga0157370_105383131 224
126 3300013104 Ga0157370_10816540 Ga0157370_108165401 224
127 3300013105 Ga0157369_10036832 Ga0157369_100368322 224
128 3300013105 Ga0157369_10108659 Ga0157369_101086592 224
129 3300013296 Ga0157374_10188464 Ga0157374_101884642 224
130 3300013296 Ga0157374_10238223 Ga0157374_102382232 224
131 3300013306 Ga0163162_10002096 Ga0163162_100020964 224
132 3300013306 Ga0163162_10016877 Ga0163162_100168775 224
133 3300013306 Ga0163162_10193312 Ga0163162_101933122 224
134 3300013306 Ga0163162_10328896 Ga0163162_103288962 224
135 3300013307 Ga0157372_10021952 Ga0157372_100219523 224
136 3300013307 Ga0157372_10022657 Ga0157372_100226576 224
137 3300013307 Ga0157372_10050121 Ga0157372_100501213 224
138 3300013307 Ga0157372_10051044 Ga0157372_100510442 224
139 3300013307 Ga0157372_10091938 Ga0157372_100919382 224
140 3300013307 Ga0157372_10409852 Ga0157372_104098521 224
141 3300013307 Ga0157372_10767703 Ga0157372_107677031 224
142 3300013307 Ga0157372_10841732 Ga0157372_108417322 224
143 3300013308 Ga0157375_11426689 Ga0157375_114266891 224
144 3300014325 Ga0163163_10056046 Ga0163163_100560464 224
145 3300014325 Ga0163163_10442378 Ga0163163_104423782 224
146 3300014326 Ga0157380_10000491 Ga0157380_1000049117 224
147 3300014326 Ga0157380_10028892 Ga0157380_100288924 224
148 3300014497 Ga0182008_10000003 Ga0182008_10000003389 224
149 3300017792 Ga0163161_10026028 Ga0163161_100260283 224
150 3300017792 Ga0163161_10040091 Ga0163161_100400912 224
151 3300025298 Ga0209050_1004060 Ga0209050_10040602 224
152 3300025711 Ga0207696_1025433 Ga0207696_10254332 224
153 3300025903 Ga0207680_10016772 Ga0207680_100167722 224
154 3300025904 Ga0207647_10000562 Ga0207647_100005628 224
155 3300025904 Ga0207647_10066664 Ga0207647_100666642 224
156 3300025911 Ga0207654_10012421 Ga0207654_100124213 224
157 3300025912 Ga0207707_10002191 Ga0207707_100021912 224
158 3300025912 Ga0207707_10027165 Ga0207707_100271653 224
159 3300025913 Ga0207695_10000039 Ga0207695_10000039292 224
160 3300025913 Ga0207695_10000051 Ga0207695_10000051149 224
161 3300025913 Ga0207695_10000056 Ga0207695_1000005693 224
162 3300025913 Ga0207695_10000081 Ga0207695_10000081149 224
163 3300025913 Ga0207695_10000156 Ga0207695_10000156125 224
164 3300025913 Ga0207695_10000421 Ga0207695_1000042116 224
165 3300025913 Ga0207695_10000488 Ga0207695_1000048853 224
166 3300025913 Ga0207695_10045504 Ga0207695_100455044 224
167 3300025913 Ga0207695_10054261 Ga0207695_100542612 224
168 3300025913 Ga0207695_10080012 Ga0207695_100800123 224
169 3300025913 Ga0207695_10148231 Ga0207695_101482312 224
170 3300025914 Ga0207671_10002328 Ga0207671_100023286 224
171 3300025914 Ga0207671_10047105 Ga0207671_100471053 224
172 3300025914 Ga0207671_10571196 Ga0207671_105711962 224
173 3300025917 Ga0207660_10007709 Ga0207660_100077095 224
174 3300025917 Ga0207660_10208377 Ga0207660_102083772 224
175 3300025921 Ga0207652_10004792 Ga0207652_100047929 224
176 3300025924 Ga0207694_10076411 Ga0207694_100764112 224
177 3300025924 Ga0207694_10485596 Ga0207694_104855961 224
178 3300025926 Ga0207659_10100263 Ga0207659_101002632 224
179 3300025931 Ga0207644_10220652 Ga0207644_102206522 224
180 3300025936 Ga0207670_10381920 Ga0207670_103819202 224
181 3300025937 Ga0207669_10084456 Ga0207669_100844562 224
182 3300025938 Ga0207704_10606093 Ga0207704_106060931 224
183 3300025940 Ga0207691_10124759 Ga0207691_101247592 224
184 3300025942 Ga0207689_10014206 Ga0207689_100142062 224
185 3300025945 Ga0207679_10173065 Ga0207679_101730652 224
186 3300025949 Ga0207667_10001783 Ga0207667_1000178320 224
187 3300025949 Ga0207667_10018768 Ga0207667_100187682 224
188 3300025949 Ga0207667_10224910 Ga0207667_102249102 224
189 3300025961 Ga0207712_10046948 Ga0207712_100469483 224
190 3300025961 Ga0207712_10148810 Ga0207712_101488102 224
191 3300025981 Ga0207640_10294677 Ga0207640_102946772 224
192 3300025986 Ga0207658_10267523 Ga0207658_102675232 224
193 3300026041 Ga0207639_10051060 Ga0207639_100510601 224
194 3300026041 Ga0207639_10322163 Ga0207639_103221632 224
195 3300026041 Ga0207639_10334933 Ga0207639_103349332 224
196 3300026078 Ga0207702_10119105 Ga0207702_101191052 224
197 3300026078 Ga0207702_10429789 Ga0207702_104297892 224
198 3300026089 Ga0207648_10344428 Ga0207648_103444281 224
199 3300026118 Ga0207675_100005173 Ga0207675_1000051737 224
200 3300026118 Ga0207675_101208069 Ga0207675_1012080691 224
201 3300026142 Ga0207698_10073898 Ga0207698_100738983 224
202 3300026142 Ga0207698_10111419 Ga0207698_101114192 224
203 3300026142 Ga0207698_10818911 Ga0207698_108189112 224
204 3300027866 Ga0209813_10004824 Ga0209813_100048243 224
205 3300027866 Ga0209813_10014625 Ga0209813_100146252 224
206 3300028379 Ga0268266_10000010 Ga0268266_10000010521 224
207 3300028380 Ga0268265_10059927 Ga0268265_100599272 224
208 3300028381 Ga0268264_10000041 Ga0268264_10000041175 224
209 3300028381 Ga0268264_10446848 Ga0268264_104468481 224
210 3300028786 Ga0307517_10001115 Ga0307517_1000111512 224
211 3300028786 Ga0307517_10174224 Ga0307517_101742241 224
212 3300028794 Ga0307515_10226874 Ga0307515_102268742 224
213 3300030521 Ga0307511_10000758 Ga0307511_1000075825 224
214 3300030731 Ga0316177_1067457 Ga0316177_10674573 224
215 3300030732 Ga0316176_1065924 Ga0316176_10659242 224
216 3300031251 Ga0265327_10143029 Ga0265327_101430292 224
217 3300031456 Ga0307513_10072120 Ga0307513_100721202 224
218 3300031456 Ga0307513_10189658 Ga0307513_101896582 224
219 3300031727 Ga0316576_10137661 Ga0316576_101376613 224
220 3300031727 Ga0316576_10430723 Ga0316576_104307232 224
221 3300031728 Ga0316578_10045493 Ga0316578_100454933 224
222 3300031728 Ga0316578_10060527 Ga0316578_100605272 224
223 3300031730 Ga0307516_10057279 Ga0307516_100572792 224
224 3300031730 Ga0307516_10291343 Ga0307516_102913432 224
225 3300033180 Ga0307510_10001013 Ga0307510_1000101326 224
226 3300036647 Ga0316582_0006289 Ga0316582_0006289_2537_3214 224
227 3300036647 Ga0316582_0079009 Ga0316582_0079009_299_985 224
228 3300036712 Ga0316584_0010437 Ga0316584_0010437_811_1485 224
229 3300036712 Ga0316584_0098212 Ga0316584_0098212_157_843 224
230 3300036712 Ga0316584_0495350 Ga0316584_0495350_134_811 224
231 3300037068 Ga0373925_0635068 Ga0373925_0635068_158_835 224
232 3300037418 Ga0395900_0023357 Ga0395900_0023357_4067_4744 224
233 3300037418 Ga0395900_0230648 Ga0395900_0230648_1030_1707 224
234 3300037471 Ga0395905_0013067 Ga0395905_0013067_1706_2383 224
235 3300042876 Ga0451577_0021687 Ga0451577_0021687_3403_4077 224
236 3300044658 Ga0466972_0007346 Ga0466972_0007346_2041_2715 224
237 3300044673 Ga0453683_0039010 Ga0453683_0039010_1215_1889 224
238 3300044673 Ga0453683_0101653 Ga0453683_0101653_98_772 224
239 3300044683 Ga0466965_0034087 Ga0466965_0034087_389_1063 224
240 3300044683 Ga0466965_0101142 Ga0466965_0101142_37_714 224
241 3300044712 Ga0453684_0000676 Ga0453684_0000676_45600_46274 224
242 3300044712 Ga0453684_0050136 Ga0453684_0050136_4178_4852 224
243 3300044712 Ga0453684_0460253 Ga0453684_0460253_198_875 224
244 3300045051 Ga0451576_0000083 Ga0451576_0000083_190628_191302 224
245 3300045051 Ga0451576_0053946 Ga0451576_0053946_1783_2460 224
246 3300045051 Ga0451576_0104070 Ga0451576_0104070_870_1544 224
247 3300046460 Ga0495638_0000039 Ga0495638_0000039_225775_226449 224
248 3300046471 Ga0495650_0025804 Ga0495650_0025804_1586_2266 224
249 3300046472 Ga0495580_0067421 Ga0495580_0067421_246_920 224
250 3300046507 Ga0495606_0003663 Ga0495606_0003663_11041_11718 224
251 3300046522 Ga0495643_0207226 Ga0495643_0207226_103_777 224
252 3300046524 Ga0495648_0002802 Ga0495648_0002802_2544_3218 224
253 3300046660 Ga0495625_0144856 Ga0495625_0144856_384_1058 224
254 3300046660 Ga0495625_0152000 Ga0495625_0152000_95_769 224
255 3300046694 Ga0495649_0042356 Ga0495649_0042356_612_1289 224
256 3300047443 Ga0495687_000001 Ga0495687_000001_203460_204134 224
257 3300047472 Ga0495686_0000010 Ga0495686_0000010_216840_217517 224
258 3300049571 Ga0501034_0097913 Ga0501034_0097913_1213_1962 224
259 3300049581 Ga0501047_0244017 Ga0501047_0244017_635_1384 224
260 3300049582 Ga0501048_0219134 Ga0501048_0219134_134_808 224
261 3300049585 Ga0501069_0093071 Ga0501069_0093071_808_1557 224
262 3300049586 Ga0501070_0013328 Ga0501070_0013328_355_1104 224
263 3300049589 Ga0501073_0026270 Ga0501073_0026270_2032_2706 224
264 3300049590 Ga0501074_0579518 Ga0501074_0579518_20_694 224
265 3300049670 Ga0501236_001451 Ga0501236_001451_509_1183 224
266 3300049742 Ga0501080_0078663 Ga0501080_0078663_591_1340 224
267 3300049744 Ga0501083_0043318 Ga0501083_0043318_1772_2521 224
268 3300049761 Ga0501264_000543 Ga0501264_000543_4585_5259 224
269 3300050490 nmdc:mga03n38_3034_c1 nmdc:mga03n38_3034_c1_1709_2389 224
270 3300050490 nmdc:mga03n38_87277_c1 nmdc:mga03n38_87277_c1_214_894 224
271 3300050491 nmdc:mga00v17_274256_c1 nmdc:mga00v17_274256_c1_274_954 224
272 3300050492 nmdc:mga0yw44_5903_c1 nmdc:mga0yw44_5903_c1_2445_3125 224
273 3300050494 nmdc:mga06z11_200_c1 nmdc:mga06z11_200_c1_17552_18232 224
274 3300050495 nmdc:mga04h51_17696_c1 nmdc:mga04h51_17696_c1_807_1487 224
275 3300050495 nmdc:mga04h51_5467_c1 nmdc:mga04h51_5467_c1_1811_2491 224
276 3300050511 nmdc:mga08y16_179503_c1 nmdc:mga08y16_179503_c1_1232_1906 224
277 3300053090 Ga0500646_0026102 Ga0500646_0026102_200_874 224
278 3300053092 Ga0500583_0020181 Ga0500583_0020181_1387_2061 224
279 3300053130 Ga0500642_0018482 Ga0500642_0018482_356_1030 224
280 3300053139 Ga0500568_0023123 Ga0500568_0023123_1128_1802 224
281 3300053153 Ga0500616_0000037 Ga0500616_0000037_98480_99154 224
282 3300053153 Ga0500616_0024174 Ga0500616_0024174_1067_1747 224
283 3300053156 Ga0500622_0000004 Ga0500622_0000004_288533_289207 224
284 3300053156 Ga0500622_0000005 Ga0500622_0000005_210586_211260 224
285 3300053156 Ga0500622_0011511 Ga0500622_0011511_1567_2241 224
286 3300053158 Ga0500627_0070710 Ga0500627_0070710_522_1202 224
287 3300054114 Ga0501084_0022128 Ga0501084_0022128_2620_3369 224
288 3300060353 Ga0501082_0184437 Ga0501082_0184437_597_1346 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

35

145

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dzd-assembly1.cif.gz_B crystal structure of sigma54 activator ntrc4 in the inactive state 0.9651 1 119
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.962 2 118
1zy2-assembly1.cif.gz_A crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.9615 1 122
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9608 1 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9604 2 118
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9763 1 83 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9711 1 79 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9709 1 77 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9684 1 79 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9658 1 79 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0R2TG56-F1-model_v4 Two-component system response regulator 0.9098 1 177 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0R2TG56-F1-model_v4 Two-component system response regulator 0.9004 1 177 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3N5MU89-F1-model_v4 DNA-binding response regulator 0.8652 1 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-J3EQG5-F1-model_v4 Response regulator with CheY-like receiver domain and winged-helix DNA-binding domain 0.8641 1 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3N5MU89-F1-model_v4 DNA-binding response regulator 0.8618 1 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
87.01 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map