F388662
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 288 | 169 | 285 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10143029|Ga0265327_101430292 |
| Length | 257 |
| Sequence | MRNYSRSNWDLSCISAKFLPNLPLNLCQNFIPLKILVIEDEPVLCETIVSYLEGERYRCEHASTLEKGIEKISLYEYDCILVDIGLPDGNGLSLIRELKKKHPETGIIIVSAKNSNEDKILGLDLGADDYLTKPFHLPELNSRIKSLLRRRKFEGKQEVIIDNITIIPDNRQVFVNNDPVQLTKSEFDLLLFFVANRGRVLSKEAIAEHLWGDFADGADSFDFVYSHLKNLRRKLVEKAEVDYFQNVYGSGYVFMAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 105 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 106 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 107 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 108 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 111 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 112 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 113 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 114 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 115 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 116 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 117 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 118 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 123 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 124 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 125 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 128 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 142 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 143 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 144 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 152 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 155 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 156 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 157 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 158 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 159 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 160 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 162 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 163 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 164 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 165 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 166 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 167 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 168 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.42 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 84.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_7600008 | 2162886011 | Bacteria | 871 |
| 2 | JGI24736J21556_1039532 | 3300001904 | Unclassified | 726 |
| 3 | rootH2_10000018 | 3300003320 | Bacteria | 23416 |
| 4 | rootH2_10003786 | 3300003320 | Bacteria | 46076 |
| 5 | rootH2_10020473 | 3300003320 | Bacteria | 12354 |
| 6 | rootL2_10251969 | 3300003322 | Bacteria | 3700 |
| 7 | Ga0055530_10011173 | 3300003791 | Bacteria | 3249 |
| 8 | Ga0065715_10385424 | 3300005293 | Bacteria | 900 |
| 9 | Ga0070676_10330221 | 3300005328 | Bacteria | 1043 |
| 10 | Ga0068869_100115789 | 3300005334 | Bacteria | 2044 |
| 11 | Ga0070666_10007610 | 3300005335 | Bacteria | 6683 |
| 12 | Ga0070680_100007372 | 3300005336 | Bacteria | 8394 |
| 13 | Ga0070680_100246196 | 3300005336 | Bacteria | 1511 |
| 14 | Ga0070682_100002612 | 3300005337 | Bacteria | 9950 |
| 15 | Ga0070660_100795249 | 3300005339 | Bacteria | 795 |
| 16 | Ga0070689_100333705 | 3300005340 | Bacteria | 1269 |
| 17 | Ga0070691_10002611 | 3300005341 | Bacteria | 8042 |
| 18 | Ga0070691_10013381 | 3300005341 | Bacteria | 3758 |
| 19 | Ga0070687_100179639 | 3300005343 | Bacteria | 1267 |
| 20 | Ga0070661_100022198 | 3300005344 | Bacteria | 4542 |
| 21 | Ga0070661_100464806 | 3300005344 | Bacteria | 1008 |
| 22 | Ga0070668_100162921 | 3300005347 | Bacteria | 1810 |
| 23 | Ga0070669_100064597 | 3300005353 | Bacteria | 2696 |
| 24 | Ga0070671_100104603 | 3300005355 | Bacteria | 2376 |
| 25 | Ga0070674_100042174 | 3300005356 | Bacteria | 3098 |
| 26 | Ga0070659_100002512 | 3300005366 | Bacteria | 13024 |
| 27 | Ga0070667_100141211 | 3300005367 | Bacteria | 2109 |
| 28 | Ga0070667_100244736 | 3300005367 | Bacteria | 1602 |
| 29 | Ga0070667_100306248 | 3300005367 | Bacteria | 1431 |
| 30 | Ga0070713_100100224 | 3300005436 | Bacteria | 2507 |
| 31 | Ga0070700_100383952 | 3300005441 | Archaea | 1051 |
| 32 | Ga0070681_10138400 | 3300005458 | Bacteria | 2364 |
| 33 | Ga0068867_100598718 | 3300005459 | Bacteria | 961 |
| 34 | Ga0068867_100640175 | 3300005459 | Bacteria | 932 |
| 35 | Ga0070685_10337702 | 3300005466 | Bacteria | 1026 |
| 36 | Ga0070679_100054593 | 3300005530 | Unclassified | 3978 |
| 37 | Ga0070684_100014474 | 3300005535 | Bacteria | 6393 |
| 38 | Ga0068853_100000355 | 3300005539 | Bacteria | 31586 |
| 39 | Ga0068853_100000579 | 3300005539 | Bacteria | 24990 |
| 40 | Ga0068853_100085142 | 3300005539 | Unclassified | 2771 |
| 41 | Ga0070686_100360993 | 3300005544 | Bacteria | 1094 |
| 42 | Ga0070693_100007282 | 3300005547 | Bacteria | 5402 |
| 43 | Ga0070665_100000006 | 3300005548 | Bacteria | 718034 |
| 44 | Ga0070665_100264525 | 3300005548 | Bacteria | 1721 |
| 45 | Ga0068855_100003071 | 3300005563 | Bacteria | 20426 |
| 46 | Ga0068855_100016977 | 3300005563 | Bacteria | 8755 |
| 47 | Ga0068855_100042913 | 3300005563 | Bacteria | 5359 |
| 48 | Ga0068856_100091813 | 3300005614 | Unclassified | 3021 |
| 49 | Ga0068856_100151747 | 3300005614 | Bacteria | 2326 |
| 50 | Ga0068856_100299992 | 3300005614 | Bacteria | 1624 |
| 51 | Ga0068852_100000327 | 3300005616 | Bacteria | 32309 |
| 52 | Ga0068852_100023905 | 3300005616 | Bacteria | 4929 |
| 53 | Ga0068852_100038610 | 3300005616 | Unclassified | 4015 |
| 54 | Ga0068852_100453732 | 3300005616 | Bacteria | 1269 |
| 55 | Ga0068859_100628795 | 3300005617 | Unclassified | 1166 |
| 56 | Ga0068864_100471242 | 3300005618 | Bacteria | 1204 |
| 57 | Ga0068866_10231201 | 3300005718 | Bacteria | 1121 |
| 58 | Ga0068851_10189019 | 3300005834 | Bacteria | 1144 |
| 59 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 60 | Ga0068860_100148365 | 3300005843 | Unclassified | 2258 |
| 61 | Ga0081540_1079783 | 3300005983 | Bacteria | 1478 |
| 62 | Ga0075365_10009690 | 3300006038 | Bacteria | 5558 |
| 63 | Ga0075368_10006541 | 3300006042 | Bacteria | 4076 |
| 64 | Ga0075363_100005226 | 3300006048 | Bacteria | 5753 |
| 65 | Ga0075364_10001339 | 3300006051 | Bacteria | 13277 |
| 66 | Ga0075367_10000626 | 3300006178 | Bacteria | 13524 |
| 67 | Ga0097620_100628742 | 3300006931 | Unclassified | 1166 |
| 68 | Ga0105240_10000059 | 3300009093 | Bacteria | 219860 |
| 69 | Ga0105240_10000354 | 3300009093 | Bacteria | 86047 |
| 70 | Ga0105240_10000421 | 3300009093 | Bacteria | 78509 |
| 71 | Ga0105240_10000520 | 3300009093 | Bacteria | 70859 |
| 72 | Ga0105240_10022095 | 3300009093 | Bacteria | 8443 |
| 73 | Ga0105240_10111479 | 3300009093 | Bacteria | 3309 |
| 74 | Ga0105240_10695410 | 3300009093 | Bacteria | 1110 |
| 75 | Ga0111539_10297243 | 3300009094 | Bacteria | 1879 |
| 76 | Ga0105241_10004008 | 3300009174 | Bacteria | 10887 |
| 77 | Ga0105241_10017428 | 3300009174 | Bacteria | 5280 |
| 78 | Ga0105241_10211142 | 3300009174 | Bacteria | 1626 |
| 79 | Ga0105237_10000107 | 3300009545 | Bacteria | 117149 |
| 80 | Ga0105237_10012702 | 3300009545 | Bacteria | 8860 |
| 81 | Ga0105237_10032437 | 3300009545 | Bacteria | 5288 |
| 82 | Ga0105237_10044978 | 3300009545 | Bacteria | 4445 |
| 83 | Ga0105238_10045564 | 3300009551 | Bacteria | 4430 |
| 84 | Ga0105238_10052534 | 3300009551 | Bacteria | 4097 |
| 85 | Ga0105238_10310927 | 3300009551 | Bacteria | 1561 |
| 86 | Ga0105249_10004268 | 3300009553 | Bacteria | 12351 |
| 87 | Ga0105249_10025044 | 3300009553 | Bacteria | 5369 |
| 88 | Ga0105239_10000237 | 3300010375 | Bacteria | 81666 |
| 89 | Ga0105239_10000283 | 3300010375 | Bacteria | 74612 |
| 90 | Ga0105239_10004632 | 3300010375 | Bacteria | 16343 |
| 91 | Ga0105239_10007638 | 3300010375 | Bacteria | 12392 |
| 92 | Ga0105239_10028577 | 3300010375 | Bacteria | 6131 |
| 93 | Ga0105239_10305991 | 3300010375 | Bacteria | 1790 |
| 94 | Ga0105239_11032656 | 3300010375 | Bacteria | 945 |
| 95 | Ga0157373_10000006 | 3300013100 | Bacteria | 261768 |
| 96 | Ga0157373_10003337 | 3300013100 | Bacteria | 12128 |
| 97 | Ga0157373_10157779 | 3300013100 | Bacteria | 1596 |
| 98 | Ga0157371_10029713 | 3300013102 | Unclassified | 3949 |
| 99 | Ga0157371_10436225 | 3300013102 | Bacteria | 962 |
| 100 | Ga0157370_10019064 | 3300013104 | Bacteria | 6895 |
| 101 | Ga0157370_10538313 | 3300013104 | Bacteria | 1071 |
| 102 | Ga0157370_10816540 | 3300013104 | Bacteria | 848 |
| 103 | Ga0157369_10036832 | 3300013105 | Bacteria | 5358 |
| 104 | Ga0157369_10108659 | 3300013105 | Bacteria | 2950 |
| 105 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 106 | Ga0157374_10188464 | 3300013296 | Bacteria | 2017 |
| 107 | Ga0157374_10238223 | 3300013296 | Bacteria | 1789 |
| 108 | Ga0157378_10111978 | 3300013297 | Bacteria | 2503 |
| 109 | Ga0163162_10002096 | 3300013306 | Bacteria | 18720 |
| 110 | Ga0163162_10016877 | 3300013306 | Bacteria | 7137 |
| 111 | Ga0163162_10193312 | 3300013306 | Bacteria | 2163 |
| 112 | Ga0163162_10328896 | 3300013306 | Bacteria | 1661 |
| 113 | Ga0157372_10021952 | 3300013307 | Bacteria | 6901 |
| 114 | Ga0157372_10022657 | 3300013307 | Bacteria | 6798 |
| 115 | Ga0157372_10050121 | 3300013307 | Bacteria | 4645 |
| 116 | Ga0157372_10051044 | 3300013307 | Bacteria | 4602 |
| 117 | Ga0157372_10091938 | 3300013307 | Unclassified | 3451 |
| 118 | Ga0157372_10409852 | 3300013307 | Bacteria | 1579 |
| 119 | Ga0157372_10767703 | 3300013307 | Bacteria | 1121 |
| 120 | Ga0157372_10841732 | 3300013307 | Bacteria | 1065 |
| 121 | Ga0157375_11426689 | 3300013308 | Bacteria | 816 |
| 122 | Ga0163163_10056046 | 3300014325 | Bacteria | 3896 |
| 123 | Ga0163163_10442378 | 3300014325 | Bacteria | 1360 |
| 124 | Ga0157380_10000491 | 3300014326 | Bacteria | 24096 |
| 125 | Ga0157380_10028892 | 3300014326 | Bacteria | 4234 |
| 126 | Ga0182008_10000003 | 3300014497 | Bacteria | 456880 |
| 127 | Ga0157376_10002704 | 3300014969 | Bacteria | 12073 |
| 128 | Ga0163161_10026028 | 3300017792 | Unclassified | 4144 |
| 129 | Ga0163161_10040091 | 3300017792 | Bacteria | 3363 |
| 130 | Ga0209050_1004060 | 3300025298 | Bacteria | 10247 |
| 131 | Ga0207696_1025433 | 3300025711 | Bacteria | 1845 |
| 132 | Ga0207680_10016772 | 3300025903 | Unclassified | 3854 |
| 133 | Ga0207647_10000562 | 3300025904 | Bacteria | 29264 |
| 134 | Ga0207647_10066664 | 3300025904 | Bacteria | 2182 |
| 135 | Ga0207654_10012421 | 3300025911 | Unclassified | 4365 |
| 136 | Ga0207707_10002191 | 3300025912 | Bacteria | 17703 |
| 137 | Ga0207707_10027165 | 3300025912 | Bacteria | 5005 |
| 138 | Ga0207695_10000039 | 3300025913 | Bacteria | 454801 |
| 139 | Ga0207695_10000051 | 3300025913 | Bacteria | 399641 |
| 140 | Ga0207695_10000056 | 3300025913 | Bacteria | 382433 |
| 141 | Ga0207695_10000081 | 3300025913 | Bacteria | 284797 |
| 142 | Ga0207695_10000156 | 3300025913 | Bacteria | 204576 |
| 143 | Ga0207695_10000421 | 3300025913 | Bacteria | 93835 |
| 144 | Ga0207695_10000488 | 3300025913 | Bacteria | 84750 |
| 145 | Ga0207695_10003890 | 3300025913 | Bacteria | 20675 |
| 146 | Ga0207695_10045504 | 3300025913 | Bacteria | 4658 |
| 147 | Ga0207695_10054261 | 3300025913 | Bacteria | 4187 |
| 148 | Ga0207695_10080012 | 3300025913 | Bacteria | 3310 |
| 149 | Ga0207695_10148231 | 3300025913 | Bacteria | 2288 |
| 150 | Ga0207671_10002328 | 3300025914 | Bacteria | 20500 |
| 151 | Ga0207671_10003195 | 3300025914 | Bacteria | 16517 |
| 152 | Ga0207671_10047105 | 3300025914 | Bacteria | 3190 |
| 153 | Ga0207671_10571196 | 3300025914 | Bacteria | 901 |
| 154 | Ga0207660_10007709 | 3300025917 | Bacteria | 6969 |
| 155 | Ga0207660_10208377 | 3300025917 | Bacteria | 1530 |
| 156 | Ga0207652_10004792 | 3300025921 | Bacteria | 10955 |
| 157 | Ga0207694_10053898 | 3300025924 | Bacteria | 3119 |
| 158 | Ga0207694_10076411 | 3300025924 | Bacteria | 2623 |
| 159 | Ga0207694_10485596 | 3300025924 | Bacteria | 1033 |
| 160 | Ga0207659_10100263 | 3300025926 | Bacteria | 2182 |
| 161 | Ga0207700_10199068 | 3300025928 | Bacteria | 1687 |
| 162 | Ga0207644_10220652 | 3300025931 | Bacteria | 1503 |
| 163 | Ga0207670_10381920 | 3300025936 | Bacteria | 1122 |
| 164 | Ga0207669_10084456 | 3300025937 | Unclassified | 2046 |
| 165 | Ga0207704_10606093 | 3300025938 | Bacteria | 897 |
| 166 | Ga0207691_10124759 | 3300025940 | Unclassified | 2279 |
| 167 | Ga0207689_10014206 | 3300025942 | Bacteria | 6775 |
| 168 | Ga0207679_10173065 | 3300025945 | Bacteria | 1779 |
| 169 | Ga0207667_10001783 | 3300025949 | Bacteria | 27109 |
| 170 | Ga0207667_10018768 | 3300025949 | Bacteria | 7744 |
| 171 | Ga0207667_10224910 | 3300025949 | Bacteria | 1922 |
| 172 | Ga0207712_10046948 | 3300025961 | Bacteria | 2996 |
| 173 | Ga0207712_10148810 | 3300025961 | Bacteria | 1806 |
| 174 | Ga0207640_10294677 | 3300025981 | Bacteria | 1280 |
| 175 | Ga0207658_10267523 | 3300025986 | Bacteria | 1459 |
| 176 | Ga0207639_10051060 | 3300026041 | Unclassified | 3144 |
| 177 | Ga0207639_10322163 | 3300026041 | Bacteria | 1373 |
| 178 | Ga0207639_10334933 | 3300026041 | Bacteria | 1348 |
| 179 | Ga0207702_10119105 | 3300026078 | Bacteria | 2360 |
| 180 | Ga0207702_10429789 | 3300026078 | Bacteria | 1278 |
| 181 | Ga0207648_10344428 | 3300026089 | Bacteria | 1343 |
| 182 | Ga0207675_100005173 | 3300026118 | Bacteria | 12557 |
| 183 | Ga0207675_101208069 | 3300026118 | Bacteria | 776 |
| 184 | Ga0207698_10073898 | 3300026142 | Bacteria | 2717 |
| 185 | Ga0207698_10111419 | 3300026142 | Bacteria | 2294 |
| 186 | Ga0207698_10818911 | 3300026142 | Unclassified | 934 |
| 187 | Ga0209813_10004824 | 3300027866 | Bacteria | 3241 |
| 188 | Ga0209813_10014625 | 3300027866 | Unclassified | 2116 |
| 189 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 190 | Ga0268265_10059927 | 3300028380 | Bacteria | 2915 |
| 191 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 192 | Ga0268264_10446848 | 3300028381 | Bacteria | 1252 |
| 193 | Ga0307517_10001115 | 3300028786 | Bacteria | 45308 |
| 194 | Ga0307517_10174224 | 3300028786 | Bacteria | 1406 |
| 195 | Ga0307515_10226874 | 3300028794 | Bacteria | 1671 |
| 196 | Ga0307511_10000758 | 3300030521 | Bacteria | 34462 |
| 197 | Ga0316177_1067457 | 3300030731 | Bacteria | 3839 |
| 198 | Ga0316176_1065924 | 3300030732 | Bacteria | 3856 |
| 199 | Ga0265327_10143029 | 3300031251 | Bacteria | 1117 |
| 200 | Ga0307513_10072120 | 3300031456 | Bacteria | 3601 |
| 201 | Ga0307513_10189658 | 3300031456 | Bacteria | 1909 |
| 202 | Ga0316579_10176055 | 3300031691 | Unclassified | 1034 |
| 203 | Ga0316576_10042792 | 3300031727 | Unclassified | 3265 |
| 204 | Ga0316576_10137661 | 3300031727 | Bacteria | 1838 |
| 205 | Ga0316576_10430723 | 3300031727 | Bacteria | 975 |
| 206 | Ga0316578_10040029 | 3300031728 | Unclassified | 2708 |
| 207 | Ga0316578_10045493 | 3300031728 | Bacteria | 2555 |
| 208 | Ga0316578_10060527 | 3300031728 | Bacteria | 2229 |
| 209 | Ga0307516_10057279 | 3300031730 | Unclassified | 3797 |
| 210 | Ga0307516_10291343 | 3300031730 | Bacteria | 1311 |
| 211 | Ga0307510_10001013 | 3300033180 | Bacteria | 29784 |
| 212 | Ga0316582_0006289 | 3300036647 | Bacteria | 6220 |
| 213 | Ga0316582_0079009 | 3300036647 | Bacteria | 2144 |
| 214 | Ga0316584_0010437 | 3300036712 | Bacteria | 6490 |
| 215 | Ga0316584_0049078 | 3300036712 | Unclassified | 3154 |
| 216 | Ga0316584_0098212 | 3300036712 | Bacteria | 2192 |
| 217 | Ga0316584_0495350 | 3300036712 | Unclassified | 859 |
| 218 | Ga0373925_0635068 | 3300037068 | Unclassified | 880 |
| 219 | Ga0395900_0023357 | 3300037418 | Bacteria | 6329 |
| 220 | Ga0395900_0230648 | 3300037418 | Bacteria | 1862 |
| 221 | Ga0395900_0961901 | 3300037418 | Bacteria | 775 |
| 222 | Ga0395905_0013067 | 3300037471 | Bacteria | 7972 |
| 223 | Ga0451577_0021687 | 3300042876 | Bacteria | 5874 |
| 224 | Ga0466972_0007346 | 3300044658 | Bacteria | 5535 |
| 225 | Ga0453683_0039010 | 3300044673 | Bacteria | 2985 |
| 226 | Ga0453683_0101653 | 3300044673 | Bacteria | 1805 |
| 227 | Ga0466965_0034087 | 3300044683 | Bacteria | 2490 |
| 228 | Ga0466965_0101142 | 3300044683 | Bacteria | 1474 |
| 229 | Ga0466961_0004449 | 3300044693 | Bacteria | 8777 |
| 230 | Ga0453684_0000676 | 3300044712 | Bacteria | 122215 |
| 231 | Ga0453684_0050136 | 3300044712 | Bacteria | 5494 |
| 232 | Ga0453684_0460253 | 3300044712 | Bacteria | 1415 |
| 233 | Ga0466970_0152435 | 3300044765 | Bacteria | 1276 |
| 234 | Ga0466959_0001128 | 3300045049 | Bacteria | 16104 |
| 235 | Ga0451576_0000083 | 3300045051 | Bacteria | 236908 |
| 236 | Ga0451576_0053946 | 3300045051 | Bacteria | 4209 |
| 237 | Ga0451576_0104070 | 3300045051 | Bacteria | 2953 |
| 238 | Ga0495638_0000039 | 3300046460 | Bacteria | 247726 |
| 239 | Ga0495650_0025804 | 3300046471 | Unclassified | 2746 |
| 240 | Ga0495580_0067421 | 3300046472 | Bacteria | 2504 |
| 241 | Ga0495606_0003663 | 3300046507 | Bacteria | 16098 |
| 242 | Ga0495643_0207226 | 3300046522 | Bacteria | 938 |
| 243 | Ga0495648_0002802 | 3300046524 | Bacteria | 15700 |
| 244 | Ga0495611_0001141 | 3300046648 | Bacteria | 13893 |
| 245 | Ga0495625_0144856 | 3300046660 | Bacteria | 1600 |
| 246 | Ga0495625_0152000 | 3300046660 | Bacteria | 1556 |
| 247 | Ga0495649_0042356 | 3300046694 | Bacteria | 2488 |
| 248 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 249 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 250 | Ga0496119_0000640 | 3300048922 | Bacteria | 47184 |
| 251 | Ga0496120_0001270 | 3300048923 | Bacteria | 31580 |
| 252 | Ga0496124_0416002 | 3300048927 | Bacteria | 928 |
| 253 | Ga0501034_0097913 | 3300049571 | Unclassified | 2929 |
| 254 | Ga0501047_0244017 | 3300049581 | Bacteria | 1646 |
| 255 | Ga0501048_0219134 | 3300049582 | Bacteria | 1350 |
| 256 | Ga0501069_0093071 | 3300049585 | Unclassified | 1705 |
| 257 | Ga0501070_0013328 | 3300049586 | Bacteria | 6933 |
| 258 | Ga0501073_0026270 | 3300049589 | Bacteria | 4171 |
| 259 | Ga0501074_0579518 | 3300049590 | Unclassified | 794 |
| 260 | Ga0501236_001451 | 3300049670 | Unclassified | 2689 |
| 261 | Ga0501080_0078663 | 3300049742 | Bacteria | 3066 |
| 262 | Ga0501083_0043318 | 3300049744 | Unclassified | 3049 |
| 263 | Ga0501264_000543 | 3300049761 | Bacteria | 5501 |
| 264 | nmdc:mga03n38_3034_c1 | 3300050490 | Bacteria | 4818 |
| 265 | nmdc:mga03n38_87277_c1 | 3300050490 | Unclassified | 1478 |
| 266 | nmdc:mga00v17_274256_c1 | 3300050491 | Bacteria | 1095 |
| 267 | nmdc:mga0yw44_5903_c1 | 3300050492 | Bacteria | 5853 |
| 268 | nmdc:mga06z11_200_c1 | 3300050494 | Bacteria | 23961 |
| 269 | nmdc:mga04h51_17696_c1 | 3300050495 | Unclassified | 2089 |
| 270 | nmdc:mga04h51_5467_c1 | 3300050495 | Bacteria | 3241 |
| 271 | nmdc:mga08y16_179503_c1 | 3300050511 | Bacteria | 2198 |
| 272 | Ga0500646_0026102 | 3300053090 | Bacteria | 1582 |
| 273 | Ga0500583_0020181 | 3300053092 | Bacteria | 2746 |
| 274 | Ga0500642_0018482 | 3300053130 | Bacteria | 2698 |
| 275 | Ga0500568_0005041 | 3300053139 | Bacteria | 6916 |
| 276 | Ga0500568_0023123 | 3300053139 | Unclassified | 2647 |
| 277 | Ga0500616_0000037 | 3300053153 | Bacteria | 390473 |
| 278 | Ga0500616_0024174 | 3300053153 | Bacteria | 3380 |
| 279 | Ga0500622_0000004 | 3300053156 | Bacteria | 557587 |
| 280 | Ga0500622_0000005 | 3300053156 | Bacteria | 502443 |
| 281 | Ga0500622_0000318 | 3300053156 | Bacteria | 48445 |
| 282 | Ga0500622_0011511 | 3300053156 | Bacteria | 4815 |
| 283 | Ga0500627_0070710 | 3300053158 | Bacteria | 1546 |
| 284 | Ga0501084_0022128 | 3300054114 | Bacteria | 5303 |
| 285 | Ga0501082_0184437 | 3300060353 | Bacteria | 1815 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048922 | Ga0496119_0000640 | Ga0496119_0000640_39947_40648 | 197 |
| 2 | 3300048923 | Ga0496120_0001270 | Ga0496120_0001270_18451_19152 | 197 |
| 3 | 3300013296 | Ga0157374_10000013 | Ga0157374_1000001399 | 208 |
| 4 | 3300014969 | Ga0157376_10002704 | Ga0157376_100027042 | 208 |
| 5 | 3300037418 | Ga0395900_0961901 | Ga0395900_0961901_17_643 | 208 |
| 6 | 3300031691 | Ga0316579_10176055 | Ga0316579_101760551 | 210 |
| 7 | 3300031727 | Ga0316576_10042792 | Ga0316576_100427922 | 210 |
| 8 | 3300031728 | Ga0316578_10040029 | Ga0316578_100400293 | 210 |
| 9 | 3300036712 | Ga0316584_0049078 | Ga0316584_0049078_1886_2563 | 210 |
| 10 | 3300005614 | Ga0068856_100299992 | Ga0068856_1002999922 | 212 |
| 11 | 3300025913 | Ga0207695_10003890 | Ga0207695_100038908 | 212 |
| 12 | 3300025914 | Ga0207671_10003195 | Ga0207671_100031954 | 212 |
| 13 | 3300025924 | Ga0207694_10053898 | Ga0207694_100538983 | 212 |
| 14 | 3300044693 | Ga0466961_0004449 | Ga0466961_0004449_4752_5429 | 212 |
| 15 | 3300044765 | Ga0466970_0152435 | Ga0466970_0152435_114_791 | 212 |
| 16 | 3300045049 | Ga0466959_0001128 | Ga0466959_0001128_4231_4908 | 212 |
| 17 | 3300013297 | Ga0157378_10111978 | Ga0157378_101119782 | 215 |
| 18 | 3300046648 | Ga0495611_0001141 | Ga0495611_0001141_5688_6362 | 215 |
| 19 | iso_pu_bacteria | 2522125168 | 2522548942 | 220 |
| 20 | 3300005548 | Ga0070665_100264525 | Ga0070665_1002645252 | 222 |
| 21 | 3300048927 | Ga0496124_0416002 | Ga0496124_0416002_128_802 | 222 |
| 22 | 3300053139 | Ga0500568_0005041 | Ga0500568_0005041_5322_5996 | 222 |
| 23 | 3300053156 | Ga0500622_0000318 | Ga0500622_0000318_4550_5224 | 222 |
| 24 | 3300005436 | Ga0070713_100100224 | Ga0070713_1001002243 | 223 |
| 25 | 3300025928 | Ga0207700_10199068 | Ga0207700_101990681 | 223 |
| 26 | 3300053156 | Ga0500622_0000004 | Ga0500622_0000004_292721_293452 | 223 |
| 27 | 3300053156 | Ga0500622_0000005 | Ga0500622_0000005_213903_214574 | 223 |
| 28 | 2162886011 | MRS1b_contig_7600008 | MRS1b_0439.00001120 | 224 |
| 29 | 3300001904 | JGI24736J21556_1039532 | JGI24736J21556_10395321 | 224 |
| 30 | 3300003320 | rootH2_10000018 | rootH2_100000183 | 224 |
| 31 | 3300003320 | rootH2_10003786 | rootH2_1000378619 | 224 |
| 32 | 3300003320 | rootH2_10020473 | rootH2_100204739 | 224 |
| 33 | 3300003322 | rootL2_10251969 | rootL2_102519692 | 224 |
| 34 | 3300003791 | Ga0055530_10011173 | Ga0055530_100111733 | 224 |
| 35 | 3300005293 | Ga0065715_10385424 | Ga0065715_103854241 | 224 |
| 36 | 3300005328 | Ga0070676_10330221 | Ga0070676_103302211 | 224 |
| 37 | 3300005334 | Ga0068869_100115789 | Ga0068869_1001157892 | 224 |
| 38 | 3300005335 | Ga0070666_10007610 | Ga0070666_100076101 | 224 |
| 39 | 3300005336 | Ga0070680_100007372 | Ga0070680_1000073722 | 224 |
| 40 | 3300005336 | Ga0070680_100246196 | Ga0070680_1002461962 | 224 |
| 41 | 3300005337 | Ga0070682_100002612 | Ga0070682_1000026122 | 224 |
| 42 | 3300005339 | Ga0070660_100795249 | Ga0070660_1007952491 | 224 |
| 43 | 3300005340 | Ga0070689_100333705 | Ga0070689_1003337051 | 224 |
| 44 | 3300005341 | Ga0070691_10002611 | Ga0070691_100026112 | 224 |
| 45 | 3300005341 | Ga0070691_10013381 | Ga0070691_100133813 | 224 |
| 46 | 3300005343 | Ga0070687_100179639 | Ga0070687_1001796391 | 224 |
| 47 | 3300005344 | Ga0070661_100022198 | Ga0070661_1000221984 | 224 |
| 48 | 3300005344 | Ga0070661_100464806 | Ga0070661_1004648061 | 224 |
| 49 | 3300005347 | Ga0070668_100162921 | Ga0070668_1001629212 | 224 |
| 50 | 3300005353 | Ga0070669_100064597 | Ga0070669_1000645972 | 224 |
| 51 | 3300005355 | Ga0070671_100104603 | Ga0070671_1001046032 | 224 |
| 52 | 3300005356 | Ga0070674_100042174 | Ga0070674_1000421741 | 224 |
| 53 | 3300005366 | Ga0070659_100002512 | Ga0070659_10000251215 | 224 |
| 54 | 3300005367 | Ga0070667_100141211 | Ga0070667_1001412112 | 224 |
| 55 | 3300005367 | Ga0070667_100244736 | Ga0070667_1002447362 | 224 |
| 56 | 3300005367 | Ga0070667_100306248 | Ga0070667_1003062482 | 224 |
| 57 | 3300005441 | Ga0070700_100383952 | Ga0070700_1003839522 | 224 |
| 58 | 3300005458 | Ga0070681_10138400 | Ga0070681_101384002 | 224 |
| 59 | 3300005459 | Ga0068867_100598718 | Ga0068867_1005987181 | 224 |
| 60 | 3300005459 | Ga0068867_100640175 | Ga0068867_1006401751 | 224 |
| 61 | 3300005466 | Ga0070685_10337702 | Ga0070685_103377021 | 224 |
| 62 | 3300005530 | Ga0070679_100054593 | Ga0070679_1000545932 | 224 |
| 63 | 3300005535 | Ga0070684_100014474 | Ga0070684_1000144747 | 224 |
| 64 | 3300005539 | Ga0068853_100000355 | Ga0068853_10000035522 | 224 |
| 65 | 3300005539 | Ga0068853_100000579 | Ga0068853_1000005792 | 224 |
| 66 | 3300005539 | Ga0068853_100085142 | Ga0068853_1000851423 | 224 |
| 67 | 3300005544 | Ga0070686_100360993 | Ga0070686_1003609932 | 224 |
| 68 | 3300005547 | Ga0070693_100007282 | Ga0070693_1000072822 | 224 |
| 69 | 3300005548 | Ga0070665_100000006 | Ga0070665_100000006441 | 224 |
| 70 | 3300005563 | Ga0068855_100003071 | Ga0068855_10000307112 | 224 |
| 71 | 3300005563 | Ga0068855_100016977 | Ga0068855_1000169774 | 224 |
| 72 | 3300005563 | Ga0068855_100042913 | Ga0068855_1000429136 | 224 |
| 73 | 3300005614 | Ga0068856_100091813 | Ga0068856_1000918132 | 224 |
| 74 | 3300005614 | Ga0068856_100151747 | Ga0068856_1001517473 | 224 |
| 75 | 3300005616 | Ga0068852_100000327 | Ga0068852_1000003279 | 224 |
| 76 | 3300005616 | Ga0068852_100023905 | Ga0068852_1000239054 | 224 |
| 77 | 3300005616 | Ga0068852_100038610 | Ga0068852_1000386102 | 224 |
| 78 | 3300005616 | Ga0068852_100453732 | Ga0068852_1004537322 | 224 |
| 79 | 3300005617 | Ga0068859_100628795 | Ga0068859_1006287951 | 224 |
| 80 | 3300005618 | Ga0068864_100471242 | Ga0068864_1004712422 | 224 |
| 81 | 3300005718 | Ga0068866_10231201 | Ga0068866_102312012 | 224 |
| 82 | 3300005834 | Ga0068851_10189019 | Ga0068851_101890192 | 224 |
| 83 | 3300005843 | Ga0068860_100000046 | Ga0068860_100000046152 | 224 |
| 84 | 3300005843 | Ga0068860_100148365 | Ga0068860_1001483652 | 224 |
| 85 | 3300005983 | Ga0081540_1079783 | Ga0081540_10797832 | 224 |
| 86 | 3300006038 | Ga0075365_10009690 | Ga0075365_100096904 | 224 |
| 87 | 3300006042 | Ga0075368_10006541 | Ga0075368_100065413 | 224 |
| 88 | 3300006048 | Ga0075363_100005226 | Ga0075363_1000052264 | 224 |
| 89 | 3300006051 | Ga0075364_10001339 | Ga0075364_100013392 | 224 |
| 90 | 3300006178 | Ga0075367_10000626 | Ga0075367_1000062610 | 224 |
| 91 | 3300006931 | Ga0097620_100628742 | Ga0097620_1006287421 | 224 |
| 92 | 3300009093 | Ga0105240_10000059 | Ga0105240_10000059126 | 224 |
| 93 | 3300009093 | Ga0105240_10000354 | Ga0105240_1000035459 | 224 |
| 94 | 3300009093 | Ga0105240_10000421 | Ga0105240_1000042112 | 224 |
| 95 | 3300009093 | Ga0105240_10000520 | Ga0105240_1000052030 | 224 |
| 96 | 3300009093 | Ga0105240_10022095 | Ga0105240_100220956 | 224 |
| 97 | 3300009093 | Ga0105240_10111479 | Ga0105240_101114792 | 224 |
| 98 | 3300009093 | Ga0105240_10695410 | Ga0105240_106954101 | 224 |
| 99 | 3300009094 | Ga0111539_10297243 | Ga0111539_102972432 | 224 |
| 100 | 3300009174 | Ga0105241_10004008 | Ga0105241_100040087 | 224 |
| 101 | 3300009174 | Ga0105241_10017428 | Ga0105241_100174282 | 224 |
| 102 | 3300009174 | Ga0105241_10211142 | Ga0105241_102111422 | 224 |
| 103 | 3300009545 | Ga0105237_10000107 | Ga0105237_1000010740 | 224 |
| 104 | 3300009545 | Ga0105237_10012702 | Ga0105237_100127023 | 224 |
| 105 | 3300009545 | Ga0105237_10032437 | Ga0105237_100324372 | 224 |
| 106 | 3300009545 | Ga0105237_10044978 | Ga0105237_100449782 | 224 |
| 107 | 3300009551 | Ga0105238_10045564 | Ga0105238_100455641 | 224 |
| 108 | 3300009551 | Ga0105238_10052534 | Ga0105238_100525343 | 224 |
| 109 | 3300009551 | Ga0105238_10310927 | Ga0105238_103109272 | 224 |
| 110 | 3300009553 | Ga0105249_10004268 | Ga0105249_100042689 | 224 |
| 111 | 3300009553 | Ga0105249_10025044 | Ga0105249_100250446 | 224 |
| 112 | 3300010375 | Ga0105239_10000237 | Ga0105239_1000023722 | 224 |
| 113 | 3300010375 | Ga0105239_10000283 | Ga0105239_1000028357 | 224 |
| 114 | 3300010375 | Ga0105239_10004632 | Ga0105239_1000463210 | 224 |
| 115 | 3300010375 | Ga0105239_10007638 | Ga0105239_1000763811 | 224 |
| 116 | 3300010375 | Ga0105239_10028577 | Ga0105239_100285774 | 224 |
| 117 | 3300010375 | Ga0105239_10305991 | Ga0105239_103059912 | 224 |
| 118 | 3300010375 | Ga0105239_11032656 | Ga0105239_110326561 | 224 |
| 119 | 3300013100 | Ga0157373_10000006 | Ga0157373_10000006212 | 224 |
| 120 | 3300013100 | Ga0157373_10003337 | Ga0157373_100033379 | 224 |
| 121 | 3300013100 | Ga0157373_10157779 | Ga0157373_101577792 | 224 |
| 122 | 3300013102 | Ga0157371_10029713 | Ga0157371_100297133 | 224 |
| 123 | 3300013102 | Ga0157371_10436225 | Ga0157371_104362252 | 224 |
| 124 | 3300013104 | Ga0157370_10019064 | Ga0157370_100190642 | 224 |
| 125 | 3300013104 | Ga0157370_10538313 | Ga0157370_105383131 | 224 |
| 126 | 3300013104 | Ga0157370_10816540 | Ga0157370_108165401 | 224 |
| 127 | 3300013105 | Ga0157369_10036832 | Ga0157369_100368322 | 224 |
| 128 | 3300013105 | Ga0157369_10108659 | Ga0157369_101086592 | 224 |
| 129 | 3300013296 | Ga0157374_10188464 | Ga0157374_101884642 | 224 |
| 130 | 3300013296 | Ga0157374_10238223 | Ga0157374_102382232 | 224 |
| 131 | 3300013306 | Ga0163162_10002096 | Ga0163162_100020964 | 224 |
| 132 | 3300013306 | Ga0163162_10016877 | Ga0163162_100168775 | 224 |
| 133 | 3300013306 | Ga0163162_10193312 | Ga0163162_101933122 | 224 |
| 134 | 3300013306 | Ga0163162_10328896 | Ga0163162_103288962 | 224 |
| 135 | 3300013307 | Ga0157372_10021952 | Ga0157372_100219523 | 224 |
| 136 | 3300013307 | Ga0157372_10022657 | Ga0157372_100226576 | 224 |
| 137 | 3300013307 | Ga0157372_10050121 | Ga0157372_100501213 | 224 |
| 138 | 3300013307 | Ga0157372_10051044 | Ga0157372_100510442 | 224 |
| 139 | 3300013307 | Ga0157372_10091938 | Ga0157372_100919382 | 224 |
| 140 | 3300013307 | Ga0157372_10409852 | Ga0157372_104098521 | 224 |
| 141 | 3300013307 | Ga0157372_10767703 | Ga0157372_107677031 | 224 |
| 142 | 3300013307 | Ga0157372_10841732 | Ga0157372_108417322 | 224 |
| 143 | 3300013308 | Ga0157375_11426689 | Ga0157375_114266891 | 224 |
| 144 | 3300014325 | Ga0163163_10056046 | Ga0163163_100560464 | 224 |
| 145 | 3300014325 | Ga0163163_10442378 | Ga0163163_104423782 | 224 |
| 146 | 3300014326 | Ga0157380_10000491 | Ga0157380_1000049117 | 224 |
| 147 | 3300014326 | Ga0157380_10028892 | Ga0157380_100288924 | 224 |
| 148 | 3300014497 | Ga0182008_10000003 | Ga0182008_10000003389 | 224 |
| 149 | 3300017792 | Ga0163161_10026028 | Ga0163161_100260283 | 224 |
| 150 | 3300017792 | Ga0163161_10040091 | Ga0163161_100400912 | 224 |
| 151 | 3300025298 | Ga0209050_1004060 | Ga0209050_10040602 | 224 |
| 152 | 3300025711 | Ga0207696_1025433 | Ga0207696_10254332 | 224 |
| 153 | 3300025903 | Ga0207680_10016772 | Ga0207680_100167722 | 224 |
| 154 | 3300025904 | Ga0207647_10000562 | Ga0207647_100005628 | 224 |
| 155 | 3300025904 | Ga0207647_10066664 | Ga0207647_100666642 | 224 |
| 156 | 3300025911 | Ga0207654_10012421 | Ga0207654_100124213 | 224 |
| 157 | 3300025912 | Ga0207707_10002191 | Ga0207707_100021912 | 224 |
| 158 | 3300025912 | Ga0207707_10027165 | Ga0207707_100271653 | 224 |
| 159 | 3300025913 | Ga0207695_10000039 | Ga0207695_10000039292 | 224 |
| 160 | 3300025913 | Ga0207695_10000051 | Ga0207695_10000051149 | 224 |
| 161 | 3300025913 | Ga0207695_10000056 | Ga0207695_1000005693 | 224 |
| 162 | 3300025913 | Ga0207695_10000081 | Ga0207695_10000081149 | 224 |
| 163 | 3300025913 | Ga0207695_10000156 | Ga0207695_10000156125 | 224 |
| 164 | 3300025913 | Ga0207695_10000421 | Ga0207695_1000042116 | 224 |
| 165 | 3300025913 | Ga0207695_10000488 | Ga0207695_1000048853 | 224 |
| 166 | 3300025913 | Ga0207695_10045504 | Ga0207695_100455044 | 224 |
| 167 | 3300025913 | Ga0207695_10054261 | Ga0207695_100542612 | 224 |
| 168 | 3300025913 | Ga0207695_10080012 | Ga0207695_100800123 | 224 |
| 169 | 3300025913 | Ga0207695_10148231 | Ga0207695_101482312 | 224 |
| 170 | 3300025914 | Ga0207671_10002328 | Ga0207671_100023286 | 224 |
| 171 | 3300025914 | Ga0207671_10047105 | Ga0207671_100471053 | 224 |
| 172 | 3300025914 | Ga0207671_10571196 | Ga0207671_105711962 | 224 |
| 173 | 3300025917 | Ga0207660_10007709 | Ga0207660_100077095 | 224 |
| 174 | 3300025917 | Ga0207660_10208377 | Ga0207660_102083772 | 224 |
| 175 | 3300025921 | Ga0207652_10004792 | Ga0207652_100047929 | 224 |
| 176 | 3300025924 | Ga0207694_10076411 | Ga0207694_100764112 | 224 |
| 177 | 3300025924 | Ga0207694_10485596 | Ga0207694_104855961 | 224 |
| 178 | 3300025926 | Ga0207659_10100263 | Ga0207659_101002632 | 224 |
| 179 | 3300025931 | Ga0207644_10220652 | Ga0207644_102206522 | 224 |
| 180 | 3300025936 | Ga0207670_10381920 | Ga0207670_103819202 | 224 |
| 181 | 3300025937 | Ga0207669_10084456 | Ga0207669_100844562 | 224 |
| 182 | 3300025938 | Ga0207704_10606093 | Ga0207704_106060931 | 224 |
| 183 | 3300025940 | Ga0207691_10124759 | Ga0207691_101247592 | 224 |
| 184 | 3300025942 | Ga0207689_10014206 | Ga0207689_100142062 | 224 |
| 185 | 3300025945 | Ga0207679_10173065 | Ga0207679_101730652 | 224 |
| 186 | 3300025949 | Ga0207667_10001783 | Ga0207667_1000178320 | 224 |
| 187 | 3300025949 | Ga0207667_10018768 | Ga0207667_100187682 | 224 |
| 188 | 3300025949 | Ga0207667_10224910 | Ga0207667_102249102 | 224 |
| 189 | 3300025961 | Ga0207712_10046948 | Ga0207712_100469483 | 224 |
| 190 | 3300025961 | Ga0207712_10148810 | Ga0207712_101488102 | 224 |
| 191 | 3300025981 | Ga0207640_10294677 | Ga0207640_102946772 | 224 |
| 192 | 3300025986 | Ga0207658_10267523 | Ga0207658_102675232 | 224 |
| 193 | 3300026041 | Ga0207639_10051060 | Ga0207639_100510601 | 224 |
| 194 | 3300026041 | Ga0207639_10322163 | Ga0207639_103221632 | 224 |
| 195 | 3300026041 | Ga0207639_10334933 | Ga0207639_103349332 | 224 |
| 196 | 3300026078 | Ga0207702_10119105 | Ga0207702_101191052 | 224 |
| 197 | 3300026078 | Ga0207702_10429789 | Ga0207702_104297892 | 224 |
| 198 | 3300026089 | Ga0207648_10344428 | Ga0207648_103444281 | 224 |
| 199 | 3300026118 | Ga0207675_100005173 | Ga0207675_1000051737 | 224 |
| 200 | 3300026118 | Ga0207675_101208069 | Ga0207675_1012080691 | 224 |
| 201 | 3300026142 | Ga0207698_10073898 | Ga0207698_100738983 | 224 |
| 202 | 3300026142 | Ga0207698_10111419 | Ga0207698_101114192 | 224 |
| 203 | 3300026142 | Ga0207698_10818911 | Ga0207698_108189112 | 224 |
| 204 | 3300027866 | Ga0209813_10004824 | Ga0209813_100048243 | 224 |
| 205 | 3300027866 | Ga0209813_10014625 | Ga0209813_100146252 | 224 |
| 206 | 3300028379 | Ga0268266_10000010 | Ga0268266_10000010521 | 224 |
| 207 | 3300028380 | Ga0268265_10059927 | Ga0268265_100599272 | 224 |
| 208 | 3300028381 | Ga0268264_10000041 | Ga0268264_10000041175 | 224 |
| 209 | 3300028381 | Ga0268264_10446848 | Ga0268264_104468481 | 224 |
| 210 | 3300028786 | Ga0307517_10001115 | Ga0307517_1000111512 | 224 |
| 211 | 3300028786 | Ga0307517_10174224 | Ga0307517_101742241 | 224 |
| 212 | 3300028794 | Ga0307515_10226874 | Ga0307515_102268742 | 224 |
| 213 | 3300030521 | Ga0307511_10000758 | Ga0307511_1000075825 | 224 |
| 214 | 3300030731 | Ga0316177_1067457 | Ga0316177_10674573 | 224 |
| 215 | 3300030732 | Ga0316176_1065924 | Ga0316176_10659242 | 224 |
| 216 | 3300031251 | Ga0265327_10143029 | Ga0265327_101430292 | 224 |
| 217 | 3300031456 | Ga0307513_10072120 | Ga0307513_100721202 | 224 |
| 218 | 3300031456 | Ga0307513_10189658 | Ga0307513_101896582 | 224 |
| 219 | 3300031727 | Ga0316576_10137661 | Ga0316576_101376613 | 224 |
| 220 | 3300031727 | Ga0316576_10430723 | Ga0316576_104307232 | 224 |
| 221 | 3300031728 | Ga0316578_10045493 | Ga0316578_100454933 | 224 |
| 222 | 3300031728 | Ga0316578_10060527 | Ga0316578_100605272 | 224 |
| 223 | 3300031730 | Ga0307516_10057279 | Ga0307516_100572792 | 224 |
| 224 | 3300031730 | Ga0307516_10291343 | Ga0307516_102913432 | 224 |
| 225 | 3300033180 | Ga0307510_10001013 | Ga0307510_1000101326 | 224 |
| 226 | 3300036647 | Ga0316582_0006289 | Ga0316582_0006289_2537_3214 | 224 |
| 227 | 3300036647 | Ga0316582_0079009 | Ga0316582_0079009_299_985 | 224 |
| 228 | 3300036712 | Ga0316584_0010437 | Ga0316584_0010437_811_1485 | 224 |
| 229 | 3300036712 | Ga0316584_0098212 | Ga0316584_0098212_157_843 | 224 |
| 230 | 3300036712 | Ga0316584_0495350 | Ga0316584_0495350_134_811 | 224 |
| 231 | 3300037068 | Ga0373925_0635068 | Ga0373925_0635068_158_835 | 224 |
| 232 | 3300037418 | Ga0395900_0023357 | Ga0395900_0023357_4067_4744 | 224 |
| 233 | 3300037418 | Ga0395900_0230648 | Ga0395900_0230648_1030_1707 | 224 |
| 234 | 3300037471 | Ga0395905_0013067 | Ga0395905_0013067_1706_2383 | 224 |
| 235 | 3300042876 | Ga0451577_0021687 | Ga0451577_0021687_3403_4077 | 224 |
| 236 | 3300044658 | Ga0466972_0007346 | Ga0466972_0007346_2041_2715 | 224 |
| 237 | 3300044673 | Ga0453683_0039010 | Ga0453683_0039010_1215_1889 | 224 |
| 238 | 3300044673 | Ga0453683_0101653 | Ga0453683_0101653_98_772 | 224 |
| 239 | 3300044683 | Ga0466965_0034087 | Ga0466965_0034087_389_1063 | 224 |
| 240 | 3300044683 | Ga0466965_0101142 | Ga0466965_0101142_37_714 | 224 |
| 241 | 3300044712 | Ga0453684_0000676 | Ga0453684_0000676_45600_46274 | 224 |
| 242 | 3300044712 | Ga0453684_0050136 | Ga0453684_0050136_4178_4852 | 224 |
| 243 | 3300044712 | Ga0453684_0460253 | Ga0453684_0460253_198_875 | 224 |
| 244 | 3300045051 | Ga0451576_0000083 | Ga0451576_0000083_190628_191302 | 224 |
| 245 | 3300045051 | Ga0451576_0053946 | Ga0451576_0053946_1783_2460 | 224 |
| 246 | 3300045051 | Ga0451576_0104070 | Ga0451576_0104070_870_1544 | 224 |
| 247 | 3300046460 | Ga0495638_0000039 | Ga0495638_0000039_225775_226449 | 224 |
| 248 | 3300046471 | Ga0495650_0025804 | Ga0495650_0025804_1586_2266 | 224 |
| 249 | 3300046472 | Ga0495580_0067421 | Ga0495580_0067421_246_920 | 224 |
| 250 | 3300046507 | Ga0495606_0003663 | Ga0495606_0003663_11041_11718 | 224 |
| 251 | 3300046522 | Ga0495643_0207226 | Ga0495643_0207226_103_777 | 224 |
| 252 | 3300046524 | Ga0495648_0002802 | Ga0495648_0002802_2544_3218 | 224 |
| 253 | 3300046660 | Ga0495625_0144856 | Ga0495625_0144856_384_1058 | 224 |
| 254 | 3300046660 | Ga0495625_0152000 | Ga0495625_0152000_95_769 | 224 |
| 255 | 3300046694 | Ga0495649_0042356 | Ga0495649_0042356_612_1289 | 224 |
| 256 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_203460_204134 | 224 |
| 257 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_216840_217517 | 224 |
| 258 | 3300049571 | Ga0501034_0097913 | Ga0501034_0097913_1213_1962 | 224 |
| 259 | 3300049581 | Ga0501047_0244017 | Ga0501047_0244017_635_1384 | 224 |
| 260 | 3300049582 | Ga0501048_0219134 | Ga0501048_0219134_134_808 | 224 |
| 261 | 3300049585 | Ga0501069_0093071 | Ga0501069_0093071_808_1557 | 224 |
| 262 | 3300049586 | Ga0501070_0013328 | Ga0501070_0013328_355_1104 | 224 |
| 263 | 3300049589 | Ga0501073_0026270 | Ga0501073_0026270_2032_2706 | 224 |
| 264 | 3300049590 | Ga0501074_0579518 | Ga0501074_0579518_20_694 | 224 |
| 265 | 3300049670 | Ga0501236_001451 | Ga0501236_001451_509_1183 | 224 |
| 266 | 3300049742 | Ga0501080_0078663 | Ga0501080_0078663_591_1340 | 224 |
| 267 | 3300049744 | Ga0501083_0043318 | Ga0501083_0043318_1772_2521 | 224 |
| 268 | 3300049761 | Ga0501264_000543 | Ga0501264_000543_4585_5259 | 224 |
| 269 | 3300050490 | nmdc:mga03n38_3034_c1 | nmdc:mga03n38_3034_c1_1709_2389 | 224 |
| 270 | 3300050490 | nmdc:mga03n38_87277_c1 | nmdc:mga03n38_87277_c1_214_894 | 224 |
| 271 | 3300050491 | nmdc:mga00v17_274256_c1 | nmdc:mga00v17_274256_c1_274_954 | 224 |
| 272 | 3300050492 | nmdc:mga0yw44_5903_c1 | nmdc:mga0yw44_5903_c1_2445_3125 | 224 |
| 273 | 3300050494 | nmdc:mga06z11_200_c1 | nmdc:mga06z11_200_c1_17552_18232 | 224 |
| 274 | 3300050495 | nmdc:mga04h51_17696_c1 | nmdc:mga04h51_17696_c1_807_1487 | 224 |
| 275 | 3300050495 | nmdc:mga04h51_5467_c1 | nmdc:mga04h51_5467_c1_1811_2491 | 224 |
| 276 | 3300050511 | nmdc:mga08y16_179503_c1 | nmdc:mga08y16_179503_c1_1232_1906 | 224 |
| 277 | 3300053090 | Ga0500646_0026102 | Ga0500646_0026102_200_874 | 224 |
| 278 | 3300053092 | Ga0500583_0020181 | Ga0500583_0020181_1387_2061 | 224 |
| 279 | 3300053130 | Ga0500642_0018482 | Ga0500642_0018482_356_1030 | 224 |
| 280 | 3300053139 | Ga0500568_0023123 | Ga0500568_0023123_1128_1802 | 224 |
| 281 | 3300053153 | Ga0500616_0000037 | Ga0500616_0000037_98480_99154 | 224 |
| 282 | 3300053153 | Ga0500616_0024174 | Ga0500616_0024174_1067_1747 | 224 |
| 283 | 3300053156 | Ga0500622_0000004 | Ga0500622_0000004_288533_289207 | 224 |
| 284 | 3300053156 | Ga0500622_0000005 | Ga0500622_0000005_210586_211260 | 224 |
| 285 | 3300053156 | Ga0500622_0011511 | Ga0500622_0011511_1567_2241 | 224 |
| 286 | 3300053158 | Ga0500627_0070710 | Ga0500627_0070710_522_1202 | 224 |
| 287 | 3300054114 | Ga0501084_0022128 | Ga0501084_0022128_2620_3369 | 224 |
| 288 | 3300060353 | Ga0501082_0184437 | Ga0501082_0184437_597_1346 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dzd-assembly1.cif.gz_B | crystal structure of sigma54 activator ntrc4 in the inactive state | 0.9651 | 1 | 119 |
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.962 | 2 | 118 |
| 1zy2-assembly1.cif.gz_A | crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus | 0.9615 | 1 | 122 |
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9608 | 1 | 118 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9604 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9763 | 1 | 83 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9711 | 1 | 79 | 3.40.50.2300 |
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9709 | 1 | 77 | 3.40.50.2300 |
| af_P52076_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9684 | 1 | 79 | 3.40.50.2300 |
| af_P30843_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9658 | 1 | 79 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R2TG56-F1-model_v4 | Two-component system response regulator | 0.9098 | 1 | 177 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A0R2TG56-F1-model_v4 | Two-component system response regulator | 0.9004 | 1 | 177 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A3N5MU89-F1-model_v4 | DNA-binding response regulator | 0.8652 | 1 | 224 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-J3EQG5-F1-model_v4 | Response regulator with CheY-like receiver domain and winged-helix DNA-binding domain | 0.8641 | 1 | 224 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A3N5MU89-F1-model_v4 | DNA-binding response regulator | 0.8618 | 1 | 224 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar