F388783

General Info

Members Datasets Scaffolds Average Seq Length
288 153 576 271

Family's Representative Sequence

Representative Sequence 3300046515|Ga0495620_0003612|Ga0495620_0003612_7493_8428
Length 311
Sequence MLYYEYALVSLFYALHPLSSNHRHDSHALGSAASAPYVGILMPELPEVETTVRGLARFLEGERIARVAVNRPDLRRPFPPDLVQVLTGARVTGMGRRAKYGLIHTDRDATMVFHLGMSGRWRIEPETPDKHDHLVLETAAGHVLALNDARRFGSVDLVATDQLDAWGPFAKLGPEPLGEGLTPKHLRAAFADRIAPIKQMLLDQTIVAGLGNIYVCEALFRSGIRPDKEAGRVSLPALSKLVPAIREVLSESIAAGGSTIRDYAQPNGELGYFAASWQVYGREGETCACGAPVQRFVQGGRSTFWCRTCQK

Samples

Sample ID Description Type Environment
1 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
81 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
93 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
94 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
116 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
119 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
124 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
127 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
128 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
129 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
131 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
132 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
133 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
134 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
135 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
136 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
138 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
139 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
140 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
141 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
142 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
143 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
144 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
145 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
146 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
147 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
148 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
149 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
150 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
151 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
152 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
153 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.49
Metatranscriptomes 0
Isolates 4.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.14
Nodule 0.69
Rhizoplane 4.17
Rhizosphere 59.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495620_0003612 3300046515 Bacteria 8835
2 SwRhRL2b_contig_2092658 2162886007 Bacteria 3968
3 SwRhRL2b_contig_3207873 2162886007 Bacteria 73231
4 JGI24748J21848_1000454 3300002074 Bacteria 4554
5 Ga0065704_10070205 3300005289 Bacteria 83747
6 Ga0065704_10070413 3300005289 Bacteria 26038
7 Ga0070666_10025171 3300005335 Bacteria 3879
8 Ga0070666_10100240 3300005335 Bacteria 1995
9 Ga0070666_10134578 3300005335 Bacteria 1719
10 Ga0070668_100000028 3300005347 Bacteria 89707
11 Ga0070668_100000927 3300005347 Bacteria 20472
12 Ga0070668_100004618 3300005347 Bacteria 10202
13 Ga0070668_100083773 3300005347 Bacteria 2504
14 Ga0070669_100000776 3300005353 Bacteria 23176
15 Ga0070669_100001504 3300005353 Bacteria 16853
16 Ga0070669_100249763 3300005353 Bacteria 1412
17 Ga0070675_100029966 3300005354 Bacteria 4391
18 Ga0070671_100000829 3300005355 Bacteria 22442
19 Ga0070671_100001575 3300005355 Bacteria 17171
20 Ga0070671_100010845 3300005355 Bacteria 7312
21 Ga0070674_100183647 3300005356 Bacteria 1604
22 Ga0070667_100000626 3300005367 Bacteria 34381
23 Ga0070667_100001140 3300005367 Bacteria 24152
24 Ga0070667_100016515 3300005367 Bacteria 6109
25 Ga0070663_100049466 3300005455 Bacteria 2985
26 Ga0070665_100000070 3300005548 Bacteria 200681
27 Ga0070665_100008683 3300005548 Bacteria 10285
28 Ga0068859_100055617 3300005617 Bacteria 3982
29 Ga0068859_100095478 3300005617 Bacteria 3026
30 Ga0068864_100001835 3300005618 Bacteria 17465
31 Ga0068863_100000052 3300005841 Bacteria 125430
32 Ga0068863_100000092 3300005841 Bacteria 97076
33 Ga0068863_100002981 3300005841 Bacteria 16743
34 Ga0068858_100002691 3300005842 Bacteria 17896
35 Ga0068858_100073903 3300005842 Bacteria 3164
36 Ga0068860_100000007 3300005843 Bacteria 429329
37 Ga0068860_100000196 3300005843 Bacteria 97096
38 Ga0068860_100029952 3300005843 Bacteria 5235
39 Ga0068860_100042994 3300005843 Bacteria 4312
40 Ga0068860_100128610 3300005843 Bacteria 2429
41 Ga0068862_100001863 3300005844 Bacteria 19097
42 Ga0068862_100024968 3300005844 Bacteria 5017
43 Ga0068862_100034343 3300005844 Bacteria 4290
44 Ga0068862_100090810 3300005844 Bacteria 2659
45 Ga0075368_10000152 3300006042 Bacteria 18566
46 Ga0075363_100000467 3300006048 Bacteria 12681
47 Ga0075364_10013287 3300006051 Bacteria 5056
48 Ga0075364_10020634 3300006051 Bacteria 4146
49 Ga0075364_10097135 3300006051 Bacteria 1959
50 Ga0075364_10235055 3300006051 Bacteria 1245
51 Ga0075362_10000066 3300006177 Bacteria 29420
52 Ga0075362_10000596 3300006177 Bacteria 10593
53 Ga0075369_10004971 3300006186 Bacteria 4947
54 Ga0075369_10071245 3300006186 Bacteria 1530
55 Ga0075369_10112666 3300006186 Bacteria 1227
56 Ga0075366_10000145 3300006195 Bacteria 29884
57 Ga0075366_10007378 3300006195 Bacteria 6069
58 Ga0075366_10069721 3300006195 Bacteria 2093
59 Ga0075366_10200385 3300006195 Bacteria 1214
60 Ga0075370_10000055 3300006353 Bacteria 33979
61 Ga0075370_10004306 3300006353 Bacteria 6891
62 Ga0075370_10008006 3300006353 Bacteria 5418
63 Ga0075370_10049565 3300006353 Bacteria 2381
64 Ga0097620_100055618 3300006931 Bacteria 3982
65 Ga0097620_100095482 3300006931 Bacteria 3026
66 Ga0079104_1028204 3300006946 Bacteria 1429
67 Ga0079104_1034343 3300006946 Bacteria 1232
68 Ga0105251_10003158 3300009011 Bacteria 12211
69 Ga0105251_10123116 3300009011 Bacteria 1177
70 Ga0105247_10184413 3300009101 Bacteria 1394
71 Ga0105247_10246694 3300009101 Bacteria 1219
72 Ga0105248_10012649 3300009177 Bacteria 9312
73 Ga0105248_10013983 3300009177 Bacteria 8831
74 Ga0105248_10076069 3300009177 Bacteria 3773
75 Ga0105249_10032567 3300009553 Bacteria 4717
76 Ga0157371_10057495 3300013102 Bacteria 2758
77 Ga0163162_10021575 3300013306 Bacteria 6344
78 Ga0163162_10024944 3300013306 Bacteria 5906
79 Ga0157380_10074423 3300014326 Bacteria 2757
80 Ga0163161_10001840 3300017792 Bacteria 15493
81 Ga0163161_10353331 3300017792 Bacteria 1169
82 Ga0213873_10000009 3300021358 Bacteria 237102
83 Ga0213872_10000285 3300021361 Bacteria 43243
84 Ga0213872_10028123 3300021361 Bacteria 2580
85 Ga0213876_10000004 3300021384 Bacteria 943822
86 Ga0209050_1000262 3300025298 Bacteria 112798
87 Ga0207696_1001953 3300025711 Bacteria 10478
88 Ga0207713_1004906 3300025735 Bacteria 8551
89 Ga0207713_1018913 3300025735 Bacteria 3392
90 Ga0207710_10085132 3300025900 Bacteria 1472
91 Ga0207710_10095852 3300025900 Bacteria 1394
92 Ga0207680_10037075 3300025903 Bacteria 2813
93 Ga0207680_10096216 3300025903 Bacteria 1894
94 Ga0207680_10141006 3300025903 Bacteria 1598
95 Ga0207681_10002329 3300025923 Bacteria 12089
96 Ga0207681_10003582 3300025923 Bacteria 9670
97 Ga0207681_10059028 3300025923 Bacteria 2629
98 Ga0207681_10353983 3300025923 Bacteria 1176
99 Ga0207650_10052193 3300025925 Bacteria 3028
100 Ga0207650_10320707 3300025925 Bacteria 1269
101 Ga0207659_10283878 3300025926 Bacteria 1354
102 Ga0207644_10000125 3300025931 Bacteria 56447
103 Ga0207644_10004486 3300025931 Bacteria 9064
104 Ga0207644_10004676 3300025931 Bacteria 8901
105 Ga0207644_10006854 3300025931 Bacteria 7422
106 Ga0207669_10207985 3300025937 Bacteria 1426
107 Ga0207711_10019004 3300025941 Bacteria 5717
108 Ga0207711_10020863 3300025941 Bacteria 5468
109 Ga0207711_10065527 3300025941 Bacteria 3140
110 Ga0207712_10221058 3300025961 Bacteria 1514
111 Ga0207668_10000076 3300025972 Bacteria 75056
112 Ga0207668_10000746 3300025972 Bacteria 19869
113 Ga0207668_10017031 3300025972 Bacteria 4547
114 Ga0207658_10000075 3300025986 Bacteria 109004
115 Ga0207658_10001382 3300025986 Bacteria 18946
116 Ga0207658_10002739 3300025986 Bacteria 12726
117 Ga0207658_10005000 3300025986 Bacteria 9134
118 Ga0207658_10041579 3300025986 Bacteria 3329
119 Ga0207703_10001073 3300026035 Bacteria 26059
120 Ga0207703_10017723 3300026035 Bacteria 5560
121 Ga0207703_10168040 3300026035 Bacteria 1927
122 Ga0207641_10000004 3300026088 Bacteria 481088
123 Ga0207641_10000042 3300026088 Bacteria 186384
124 Ga0207641_10004191 3300026088 Bacteria 12564
125 Ga0207676_10029432 3300026095 Bacteria 4112
126 Ga0209371_1038290 3300027312 Bacteria 990
127 Ga0209813_10000082 3300027866 Bacteria 34870
128 Ga0268266_10001471 3300028379 Bacteria 27988
129 Ga0268266_10002431 3300028379 Bacteria 20016
130 Ga0268266_10142959 3300028379 Bacteria 2148
131 Ga0268265_10007903 3300028380 Bacteria 7177
132 Ga0268265_10019467 3300028380 Bacteria 4719
133 Ga0268265_10036208 3300028380 Bacteria 3613
134 Ga0268264_10000087 3300028381 Bacteria 236696
135 Ga0268264_10000134 3300028381 Bacteria 179475
136 Ga0268264_10031281 3300028381 Bacteria 4364
137 Ga0268264_10101581 3300028381 Bacteria 2500
138 Ga0265331_10054944 3300031250 Bacteria 1895
139 Ga0307408_100065755 3300031548 Bacteria 2660
140 Ga0307508_10009433 3300031616 Bacteria 8978
141 Ga0307405_10013513 3300031731 Bacteria 4358
142 Ga0307413_10024961 3300031824 Bacteria 3267
143 Ga0307413_10120353 3300031824 Bacteria 1777
144 Ga0307413_10492905 3300031824 Bacteria 982
145 Ga0307410_10035501 3300031852 Bacteria 3238
146 Ga0307410_10092571 3300031852 Bacteria 2149
147 Ga0307406_10254132 3300031901 Bacteria 1326
148 Ga0307407_10005829 3300031903 Bacteria 5397
149 Ga0307407_10343815 3300031903 Bacteria 1054
150 Ga0307412_10158341 3300031911 Bacteria 1679
151 Ga0307409_100050473 3300031995 Bacteria 3177
152 Ga0307409_100205918 3300031995 Bacteria 1764
153 Ga0307416_100849844 3300032002 Bacteria 1011
154 Ga0307415_100069016 3300032126 Bacteria 2477
155 Ga0373931_0012105 3300035691 Bacteria 4176
156 Ga0436365_0192103 3300039437 Bacteria 182879
157 Ga0436361_0411004 3300039447 Bacteria 4672
158 Ga0436362_0383697 3300039453 Bacteria 74416
159 Ga0466970_0161648 3300044765 Bacteria 1239
160 Ga0495627_000372 3300046453 Bacteria 41499
161 Ga0495650_0001266 3300046471 Bacteria 26037
162 Ga0495596_0000008 3300046500 Bacteria 150860
163 Ga0495596_0003454 3300046500 Bacteria 7990
164 Ga0495607_0004625 3300046501 Bacteria 10074
165 Ga0495607_0012033 3300046501 Bacteria 5726
166 Ga0495583_0016829 3300046506 Bacteria 3909
167 Ga0495583_0129284 3300046506 Bacteria 1058
168 Ga0495606_0003149 3300046507 Bacteria 17878
169 Ga0495606_0009831 3300046507 Bacteria 8029
170 Ga0495610_0000033 3300046512 Bacteria 204151
171 Ga0495610_0000756 3300046512 Bacteria 30516
172 Ga0495610_0003356 3300046512 Bacteria 12554
173 Ga0495610_0092849 3300046512 Bacteria 1365
174 Ga0495620_0003995 3300046515 Bacteria 8381
175 Ga0495632_0000309 3300046519 Bacteria 47211
176 Ga0495643_0000048 3300046522 Bacteria 212788
177 Ga0495643_0002195 3300046522 Bacteria 15959
178 Ga0495643_0036318 3300046522 Bacteria 2708
179 Ga0495643_0054520 3300046522 Bacteria 2139
180 Ga0495609_0002388 3300046538 Bacteria 11560
181 Ga0495633_0031026 3300046558 Bacteria 2594
182 Ga0495668_0096658 3300046616 Bacteria 1616
183 Ga0495625_0012995 3300046660 Bacteria 6718
184 Ga0495625_0037180 3300046660 Bacteria 3574
185 Ga0495625_0141433 3300046660 Bacteria 1623
186 Ga0495681_0000041 3300047470 Bacteria 119251
187 Ga0495681_0098089 3300047470 Bacteria 1285
188 Ga0495615_0000287 3300048090 Bacteria 9004
189 Ga0495626_0002802 3300048091 Bacteria 11691
190 Ga0496101_0058355 3300048904 Bacteria 2794
191 Ga0496102_0002022 3300048905 Bacteria 17516
192 Ga0496103_0000581 3300048906 Bacteria 28917
193 Ga0496103_0036666 3300048906 Bacteria 3003
194 Ga0496104_0001657 3300048907 Bacteria 19233
195 Ga0496104_0055124 3300048907 Bacteria 3758
196 Ga0496105_0002144 3300048908 Bacteria 14295
197 Ga0496105_0402062 3300048908 Bacteria 1087
198 Ga0496107_0236516 3300048910 Bacteria 1359
199 Ga0496110_0022610 3300048913 Bacteria 5341
200 Ga0496111_0057600 3300048914 Bacteria 2813
201 Ga0496112_0341085 3300048915 Bacteria 1442
202 Ga0496116_0000062 3300048919 Bacteria 271104
203 Ga0496116_0143972 3300048919 Bacteria 1335
204 Ga0496117_0014507 3300048920 Bacteria 6783
205 Ga0496117_0016703 3300048920 Bacteria 6173
206 Ga0496117_0023122 3300048920 Bacteria 4965
207 Ga0496117_0024307 3300048920 Bacteria 4797
208 Ga0496118_0020501 3300048921 Bacteria 5857
209 Ga0496118_0027419 3300048921 Bacteria 4820
210 Ga0496118_0040683 3300048921 Bacteria 3693
211 Ga0496118_0157837 3300048921 Bacteria 1408
212 Ga0496119_0072596 3300048922 Bacteria 2010
213 Ga0496121_0000087 3300048924 Bacteria 222451
214 Ga0496121_0000196 3300048924 Bacteria 135812
215 Ga0496121_0015255 3300048924 Bacteria 8071
216 Ga0496121_0049171 3300048924 Bacteria 3579
217 Ga0496121_0150887 3300048924 Bacteria 1710
218 Ga0496122_0004355 3300048925 Bacteria 17692
219 Ga0496122_0167563 3300048925 Bacteria 1329
220 Ga0496123_0000545 3300048926 Bacteria 64687
221 Ga0496123_0006948 3300048926 Bacteria 10811
222 Ga0496123_0044829 3300048926 Bacteria 3020
223 Ga0496124_0001905 3300048927 Bacteria 28630
224 Ga0496124_0014784 3300048927 Bacteria 7527
225 Ga0496124_0026937 3300048927 Bacteria 5173
226 Ga0496124_0061735 3300048927 Bacteria 3140
227 Ga0496124_0086022 3300048927 Bacteria 2574
228 Ga0496125_0013648 3300048928 Bacteria 7974
229 Ga0496125_0034978 3300048928 Bacteria 4418
230 Ga0496125_0053313 3300048928 Bacteria 3316
231 Ga0496126_0000801 3300048929 Bacteria 56279
232 Ga0496126_0002590 3300048929 Bacteria 24120
233 Ga0496126_0007548 3300048929 Bacteria 11899
234 Ga0496126_0046811 3300048929 Bacteria 3963
235 Ga0501038_0432939 3300049574 Bacteria 1013
236 Ga0501224_006481 3300049664 Bacteria 1697
237 Ga0501249_042593 3300049679 Bacteria 1032
238 Ga0501044_0000290 3300049823 Bacteria 63934
239 nmdc:mga03683_1345_c1 3300050489 Bacteria 7284
240 nmdc:mga03683_16768_c1 3300050489 Bacteria 2759
241 nmdc:mga03683_55_c1 3300050489 Bacteria 47333
242 nmdc:mga03n38_9585_c1 3300050490 Bacteria 3529
243 nmdc:mga00v17_10632_c1 3300050491 Bacteria 5033
244 nmdc:mga00v17_16647_c1 3300050491 Bacteria 4146
245 nmdc:mga0yw44_122740_c1 3300050492 Bacteria 1675
246 nmdc:mga0k408_159100_c1 3300050493 Bacteria 1345
247 nmdc:mga0k408_45398_c1 3300050493 Bacteria 2535
248 nmdc:mga0k408_6795_c1 3300050493 Bacteria 6101
249 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
250 nmdc:mga06z11_770_c1 3300050494 Bacteria 11686
251 nmdc:mga04h51_339_c1 3300050495 Bacteria 11749
252 nmdc:mga07m45_1849_c1 3300050496 Bacteria 9777
253 nmdc:mga07m45_35_c1 3300050496 Bacteria 74486
254 nmdc:mga07m45_37166_c1 3300050496 Bacteria 2715
255 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
256 nmdc:mga0sz30_303_c1 3300050516 Bacteria 18938
257 nmdc:mga0sz30_34815_c1 3300050516 Bacteria 2099
258 nmdc:mga0sz30_41_c1 3300050516 Bacteria 46173
259 Ga0500643_006007 3300053087 Bacteria 5141
260 Ga0500643_027917 3300053087 Bacteria 1749
261 Ga0500592_009625 3300053116 Bacteria 1538
262 Ga0500607_000077 3300053121 Bacteria 71543
263 Ga0500607_000763 3300053121 Bacteria 30989
264 Ga0500608_000074 3300053122 Bacteria 42636
265 Ga0500614_006488 3300053123 Bacteria 2461
266 Ga0500618_001872 3300053125 Bacteria 8758
267 Ga0500559_0000782 3300053136 Bacteria 20805
268 Ga0500559_0001165 3300053136 Bacteria 15792
269 Ga0500564_000068 3300053138 Bacteria 27518
270 Ga0500573_0000029 3300053140 Bacteria 135595
271 Ga0500590_001145 3300053148 Bacteria 10463
272 Ga0500622_0000119 3300053156 Bacteria 82219
273 Ga0500637_0006374 3300053178 Bacteria 5803
274 Ga0500625_000004 3300053729 Bacteria 245905
275 Ga0500645_003231 3300053730 Bacteria 6744
276 2511126452 2510917021 Bacteria 5705459
277 2738710376 2738541275 Bacteria 4830863
278 2738848801 2738541301 Bacteria 4834102
279 2738864530 2738541304 Bacteria 4833665
280 2739297048 2738543022 Bacteria 4835059
281 2739358726 2738543033 Bacteria 4833336
282 2739650620 2739367664 Bacteria 4114334
283 2740029093 2739367865 Bacteria 4114482
284 2819554692 2818991438 Bacteria 5793701
285 2919142105 2919138771 Bacteria 5281312
286 2928100473 2928100450 Bacteria 4837635
287 2928960538 2928959182 Bacteria 4725774
288 8054305089 8054302542 Bacteria 5698134
289 Ga0495620_0003612
290 SwRhRL2b_contig_2092658
291 SwRhRL2b_contig_3207873
292 JGI24748J21848_1000454
293 Ga0065704_10070205
294 Ga0065704_10070413
295 Ga0070666_10025171
296 Ga0070666_10100240
297 Ga0070666_10134578
298 Ga0070668_100000028
299 Ga0070668_100000927
300 Ga0070668_100004618
301 Ga0070668_100083773
302 Ga0070669_100000776
303 Ga0070669_100001504
304 Ga0070669_100249763
305 Ga0070675_100029966
306 Ga0070671_100000829
307 Ga0070671_100001575
308 Ga0070671_100010845
309 Ga0070674_100183647
310 Ga0070667_100000626
311 Ga0070667_100001140
312 Ga0070667_100016515
313 Ga0070663_100049466
314 Ga0070665_100000070
315 Ga0070665_100008683
316 Ga0068859_100055617
317 Ga0068859_100095478
318 Ga0068864_100001835
319 Ga0068863_100000052
320 Ga0068863_100000092
321 Ga0068863_100002981
322 Ga0068858_100002691
323 Ga0068858_100073903
324 Ga0068860_100000007
325 Ga0068860_100000196
326 Ga0068860_100029952
327 Ga0068860_100042994
328 Ga0068860_100128610
329 Ga0068862_100001863
330 Ga0068862_100024968
331 Ga0068862_100034343
332 Ga0068862_100090810
333 Ga0075368_10000152
334 Ga0075363_100000467
335 Ga0075364_10013287
336 Ga0075364_10020634
337 Ga0075364_10097135
338 Ga0075364_10235055
339 Ga0075362_10000066
340 Ga0075362_10000596
341 Ga0075369_10004971
342 Ga0075369_10071245
343 Ga0075369_10112666
344 Ga0075366_10000145
345 Ga0075366_10007378
346 Ga0075366_10069721
347 Ga0075366_10200385
348 Ga0075370_10000055
349 Ga0075370_10004306
350 Ga0075370_10008006
351 Ga0075370_10049565
352 Ga0097620_100055618
353 Ga0097620_100095482
354 Ga0079104_1028204
355 Ga0079104_1034343
356 Ga0105251_10003158
357 Ga0105251_10123116
358 Ga0105247_10184413
359 Ga0105247_10246694
360 Ga0105248_10012649
361 Ga0105248_10013983
362 Ga0105248_10076069
363 Ga0105249_10032567
364 Ga0157371_10057495
365 Ga0163162_10021575
366 Ga0163162_10024944
367 Ga0157380_10074423
368 Ga0163161_10001840
369 Ga0163161_10353331
370 Ga0213873_10000009
371 Ga0213872_10000285
372 Ga0213872_10028123
373 Ga0213876_10000004
374 Ga0209050_1000262
375 Ga0207696_1001953
376 Ga0207713_1004906
377 Ga0207713_1018913
378 Ga0207710_10085132
379 Ga0207710_10095852
380 Ga0207680_10037075
381 Ga0207680_10096216
382 Ga0207680_10141006
383 Ga0207681_10002329
384 Ga0207681_10003582
385 Ga0207681_10059028
386 Ga0207681_10353983
387 Ga0207650_10052193
388 Ga0207650_10320707
389 Ga0207659_10283878
390 Ga0207644_10000125
391 Ga0207644_10004486
392 Ga0207644_10004676
393 Ga0207644_10006854
394 Ga0207669_10207985
395 Ga0207711_10019004
396 Ga0207711_10020863
397 Ga0207711_10065527
398 Ga0207712_10221058
399 Ga0207668_10000076
400 Ga0207668_10000746
401 Ga0207668_10017031
402 Ga0207658_10000075
403 Ga0207658_10001382
404 Ga0207658_10002739
405 Ga0207658_10005000
406 Ga0207658_10041579
407 Ga0207703_10001073
408 Ga0207703_10017723
409 Ga0207703_10168040
410 Ga0207641_10000004
411 Ga0207641_10000042
412 Ga0207641_10004191
413 Ga0207676_10029432
414 Ga0209371_1038290
415 Ga0209813_10000082
416 Ga0268266_10001471
417 Ga0268266_10002431
418 Ga0268266_10142959
419 Ga0268265_10007903
420 Ga0268265_10019467
421 Ga0268265_10036208
422 Ga0268264_10000087
423 Ga0268264_10000134
424 Ga0268264_10031281
425 Ga0268264_10101581
426 Ga0265331_10054944
427 Ga0307408_100065755
428 Ga0307508_10009433
429 Ga0307405_10013513
430 Ga0307413_10024961
431 Ga0307413_10120353
432 Ga0307413_10492905
433 Ga0307410_10035501
434 Ga0307410_10092571
435 Ga0307406_10254132
436 Ga0307407_10005829
437 Ga0307407_10343815
438 Ga0307412_10158341
439 Ga0307409_100050473
440 Ga0307409_100205918
441 Ga0307416_100849844
442 Ga0307415_100069016
443 Ga0373931_0012105
444 Ga0436365_0192103
445 Ga0436361_0411004
446 Ga0436362_0383697
447 Ga0466970_0161648
448 Ga0495627_000372
449 Ga0495650_0001266
450 Ga0495596_0000008
451 Ga0495596_0003454
452 Ga0495607_0004625
453 Ga0495607_0012033
454 Ga0495583_0016829
455 Ga0495583_0129284
456 Ga0495606_0003149
457 Ga0495606_0009831
458 Ga0495610_0000033
459 Ga0495610_0000756
460 Ga0495610_0003356
461 Ga0495610_0092849
462 Ga0495620_0003995
463 Ga0495632_0000309
464 Ga0495643_0000048
465 Ga0495643_0002195
466 Ga0495643_0036318
467 Ga0495643_0054520
468 Ga0495609_0002388
469 Ga0495633_0031026
470 Ga0495668_0096658
471 Ga0495625_0012995
472 Ga0495625_0037180
473 Ga0495625_0141433
474 Ga0495681_0000041
475 Ga0495681_0098089
476 Ga0495615_0000287
477 Ga0495626_0002802
478 Ga0496101_0058355
479 Ga0496102_0002022
480 Ga0496103_0000581
481 Ga0496103_0036666
482 Ga0496104_0001657
483 Ga0496104_0055124
484 Ga0496105_0002144
485 Ga0496105_0402062
486 Ga0496107_0236516
487 Ga0496110_0022610
488 Ga0496111_0057600
489 Ga0496112_0341085
490 Ga0496116_0000062
491 Ga0496116_0143972
492 Ga0496117_0014507
493 Ga0496117_0016703
494 Ga0496117_0023122
495 Ga0496117_0024307
496 Ga0496118_0020501
497 Ga0496118_0027419
498 Ga0496118_0040683
499 Ga0496118_0157837
500 Ga0496119_0072596
501 Ga0496121_0000087
502 Ga0496121_0000196
503 Ga0496121_0015255
504 Ga0496121_0049171
505 Ga0496121_0150887
506 Ga0496122_0004355
507 Ga0496122_0167563
508 Ga0496123_0000545
509 Ga0496123_0006948
510 Ga0496123_0044829
511 Ga0496124_0001905
512 Ga0496124_0014784
513 Ga0496124_0026937
514 Ga0496124_0061735
515 Ga0496124_0086022
516 Ga0496125_0013648
517 Ga0496125_0034978
518 Ga0496125_0053313
519 Ga0496126_0000801
520 Ga0496126_0002590
521 Ga0496126_0007548
522 Ga0496126_0046811
523 Ga0501038_0432939
524 Ga0501224_006481
525 Ga0501249_042593
526 Ga0501044_0000290
527 nmdc:mga03683_1345_c1
528 nmdc:mga03683_16768_c1
529 nmdc:mga03683_55_c1
530 nmdc:mga03n38_9585_c1
531 nmdc:mga00v17_10632_c1
532 nmdc:mga00v17_16647_c1
533 nmdc:mga0yw44_122740_c1
534 nmdc:mga0k408_159100_c1
535 nmdc:mga0k408_45398_c1
536 nmdc:mga0k408_6795_c1
537 nmdc:mga0k408_7_c1
538 nmdc:mga06z11_770_c1
539 nmdc:mga04h51_339_c1
540 nmdc:mga07m45_1849_c1
541 nmdc:mga07m45_35_c1
542 nmdc:mga07m45_37166_c1
543 nmdc:mga07m45_3_c1
544 nmdc:mga0sz30_303_c1
545 nmdc:mga0sz30_34815_c1
546 nmdc:mga0sz30_41_c1
547 Ga0500643_006007
548 Ga0500643_027917
549 Ga0500592_009625
550 Ga0500607_000077
551 Ga0500607_000763
552 Ga0500608_000074
553 Ga0500614_006488
554 Ga0500618_001872
555 Ga0500559_0000782
556 Ga0500559_0001165
557 Ga0500564_000068
558 Ga0500573_0000029
559 Ga0500590_001145
560 Ga0500622_0000119
561 Ga0500637_0006374
562 Ga0500625_000004
563 Ga0500645_003231
564 2511126452
565 2738710376
566 2738848801
567 2738864530
568 2739297048
569 2739358726
570 2739650620
571 2740029093
572 2819554692
573 2919142105
574 2928100473
575 2928960538
576 8054305089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

172

264

0.98

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

42

155

0.97

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

284

311

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.9318 2 270
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.9284 2 270
1l2d-assembly1.cif.gz_A mutm (fpg)-dna estranged guanine mismatch recognition complex 0.9158 2 270
3saw-assembly1.cif.gz_A mutm slanted complex 8 with r112a mutation 0.9135 2 270
1l2d-assembly1.cif.gz_A mutm (fpg)-dna estranged guanine mismatch recognition complex 0.9124 2 270
ID Description Score Start End Superfamily
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9433 131 270 1.10.8.50
1k82C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9427 131 270 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9358 131 270 1.10.8.50
1k82C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9358 131 270 1.10.8.50
af_P05523_2_128_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9209 2 118 3.20.190.10
ID Description Score Start End GO Terms
AF-A0A352H7J1-F1-model_v4 deleted 0.9886 1 168
AF-A0A4Q5SIZ1-F1-model_v4 Bifunctional DNA-formamidopyrimidine glycosylase/DNA-(Apurinic or apyrimidinic site) lyase (EC 3.2.2.23, EC 4.2.99.18) 0.9849 1 208 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A352H7J1-F1-model_v4 deleted 0.9827 1 168
AF-A0A4Q5SIZ1-F1-model_v4 Bifunctional DNA-formamidopyrimidine glycosylase/DNA-(Apurinic or apyrimidinic site) lyase (EC 3.2.2.23, EC 4.2.99.18) 0.9755 1 208 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A257PRL7-F1-model_v4 DNA-formamidopyrimidine glycosylase 0.9745 1 218 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039

Map