F389728

General Info

Members Datasets Scaffolds Average Seq Length
290 203 580 283

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10080170|Ga0105251_100801702
Length 315
Sequence MFPFVEIFFSILRSKGDFYFKFVSKHASMITYNTKDWFTFIFHFHKSDTVRKLFTIMIAIGIYATIVCYLELQYFKVTKNDYIHNIPMMHGMLGFVISLLLVFRTNTAYDRWWEGRKLWGGLVNNSRNLAIKLSAILKDENDRKFFRKYIPMYADILNIHLKDEETSKQLFEDVDLEIDHHKHKPNQLKRIMYHKINDLYDAGKITGDQLITLNDELVAFTDICGACERIKNTPIPYSYSAFIKKFIFFYTMTLPFGYSVSLGYLVAPVVVFIFYVLASLELIAEEIEDPFGNDENDLPTRKIAENIKKHVEELI

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
72 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
74 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
76 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
77 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
78 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
93 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
115 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
116 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
117 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
118 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
124 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
125 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
126 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
127 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
128 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
129 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
130 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
131 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
132 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
133 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
137 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
138 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
139 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
140 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
141 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
142 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
143 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
144 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
145 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
146 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
147 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
148 2738541284 Pedobacter sp. YR016 Isolate Unclassified
149 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
150 2738541302 Pedobacter sp. CF074 Isolate Unclassified
151 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
152 2738543023 Pedobacter sp. OK628 Isolate Unclassified
153 2739367651 Pedobacter sp. OK291 Isolate Unclassified
154 2739367656 Pedobacter sp. CF523 Isolate Unclassified
155 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
156 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
157 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
158 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
159 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
160 2818991437 Pedobacter terrae 518 Isolate Unclassified
161 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
162 2818991444 Filimonas endophytica 3197 Isolate Unclassified
163 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
164 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
165 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
166 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
167 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
168 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
169 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
170 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
171 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
172 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
173 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
174 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
175 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
176 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
177 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
178 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
179 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
180 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
181 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
182 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
183 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
184 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
185 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
186 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
187 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
188 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
189 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
190 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
191 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
192 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
193 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
194 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
195 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
196 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
197 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
198 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
199 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
200 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
201 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
202 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
203 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.93
Metatranscriptomes 0
Isolates 22.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.38
Nodule 2.07
Rhizoplane 0
Rhizosphere 54.48
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10080170 3300009011 Bacteria 1510
2 SwRhRL2b_contig_2154591 2162886007 Bacteria 1444
3 SwRhRL2b_contig_2686671 2162886007 Bacteria 2904
4 SwRhRL2b_contig_695650 2162886007 Bacteria 23790
5 SwRhRL2b_contig_872587 2162886007 Bacteria 2684
6 JGI24740J21852_10004754 3300001979 Bacteria 5803
7 JGI24739J22299_10001585 3300001989 Bacteria 8607
8 JGI25154J39366_1000007 3300002738 Bacteria 335932
9 JGI25152J39213_1000075 3300002773 Bacteria 66427
10 JGI25150J39212_1000009 3300002774 Bacteria 249509
11 JGI25151J46595_10000017 3300003187 Bacteria 249509
12 JGI25153J46596_10000023 3300003215 Bacteria 249509
13 JGI25153J46596_10001476 3300003215 Bacteria 14022
14 rootH2_10006633 3300003320 Bacteria 2226
15 rootH2_10006635 3300003320 Bacteria 1691
16 rootH2_10154957 3300003320 Bacteria 1866
17 rootL2_10010975 3300003322 Bacteria 9635
18 rootL2_10010976 3300003322 Bacteria 4533
19 rootL2_10110612 3300003322 Bacteria 2867
20 rootL2_10133542 3300003322 Bacteria 1472
21 rootH1_10040488 3300003323 Bacteria 5122
22 rootH1_10070778 3300003323 Bacteria 2986
23 rootH1_10112786 3300003323 Bacteria 18142
24 rootH1_10122254 3300003323 Bacteria 2742
25 JGI25160J50197_1002370 3300003354 Bacteria 8802
26 JGI25160J50197_1012404 3300003354 Bacteria 2961
27 Ga0055535_1001870 3300003761 Bacteria 8930
28 Ga0055536_1000011 3300003781 Bacteria 275969
29 Ga0055528_1000164 3300003790 Bacteria 55729
30 Ga0055530_10002929 3300003791 Bacteria 10337
31 Ga0055530_10018810 3300003791 Bacteria 2115
32 Ga0055531_10000020 3300003794 Bacteria 170186
33 Ga0055531_10015001 3300003794 Bacteria 3447
34 Ga0065165_1000010 3300005262 Bacteria 323737
35 Ga0065165_1034648 3300005262 Unclassified 1559
36 Ga0065714_10002244 3300005288 Bacteria 38170
37 Ga0065714_10006509 3300005288 Bacteria 5323
38 Ga0065714_10010078 3300005288 Bacteria 3042
39 Ga0065714_10064511 3300005288 Bacteria 45172
40 Ga0065714_10072961 3300005288 Bacteria 3268
41 Ga0065714_10153750 3300005288 Bacteria 1091
42 Ga0065704_10000193 3300005289 Bacteria 203271
43 Ga0065704_10071082 3300005289 Bacteria 13322
44 Ga0065704_10083591 3300005289 Bacteria 3421
45 Ga0065704_10092989 3300005289 Bacteria 2623
46 Ga0065704_10166419 3300005289 Bacteria 1319
47 Ga0070677_10015640 3300005333 Bacteria 2689
48 Ga0070677_10057655 3300005333 Unclassified 1592
49 Ga0070668_100023750 3300005347 Bacteria 4641
50 Ga0070675_100021837 3300005354 Bacteria 5113
51 Ga0070673_100065360 3300005364 Bacteria 2901
52 Ga0070672_100099268 3300005543 Bacteria 2359
53 Ga0081455_10227323 3300005937 Bacteria 1379
54 Ga0075370_10258706 3300006353 Bacteria 1032
55 Ga0099824_1015783 3300006942 Bacteria 7039
56 Ga0079104_1000005 3300006946 Bacteria 407099
57 Ga0099826_10014855 3300006948 Bacteria 5881
58 Ga0105250_10073709 3300009092 Bacteria 1381
59 Ga0105239_10037999 3300010375 Bacteria 5276
60 Ga0157373_10000002 3300013100 Bacteria 750094
61 Ga0157373_10000121 3300013100 Bacteria 60158
62 Ga0157373_10031659 3300013100 Bacteria 3807
63 Ga0157373_10050158 3300013100 Bacteria 2973
64 Ga0157373_10145198 3300013100 Bacteria 1669
65 Ga0157371_10000009 3300013102 Bacteria 392895
66 Ga0157371_10000426 3300013102 Bacteria 51710
67 Ga0157371_10014081 3300013102 Bacteria 6050
68 Ga0157371_10062832 3300013102 Bacteria 2632
69 Ga0157371_10207270 3300013102 Bacteria 1406
70 Ga0157370_10000061 3300013104 Bacteria 115933
71 Ga0157370_10000545 3300013104 Bacteria 46921
72 Ga0157370_10002651 3300013104 Bacteria 21486
73 Ga0157370_10004402 3300013104 Bacteria 16159
74 Ga0157370_10008288 3300013104 Bacteria 11216
75 Ga0157370_10011278 3300013104 Bacteria 9369
76 Ga0157370_10029250 3300013104 Bacteria 5412
77 Ga0157370_10152840 3300013104 Bacteria 2147
78 Ga0157370_10274763 3300013104 Bacteria 1557
79 Ga0157369_10000006 3300013105 Bacteria 412230
80 Ga0157369_10023024 3300013105 Bacteria 6944
81 Ga0157369_10421885 3300013105 Bacteria 1383
82 Ga0163162_10000178 3300013306 Bacteria 58523
83 Ga0157375_10209675 3300013308 Bacteria 2105
84 Ga0157380_10096975 3300014326 Bacteria 2446
85 Ga0182008_10000018 3300014497 Bacteria 230609
86 Ga0182008_10001546 3300014497 Bacteria 15298
87 Ga0182008_10073024 3300014497 Bacteria 1688
88 Ga0182006_1000308 3300015261 Bacteria 42741
89 Ga0182006_1000595 3300015261 Bacteria 26459
90 Ga0182006_1000689 3300015261 Bacteria 23570
91 Ga0182007_10000001 3300015262 Bacteria 1127301
92 Ga0182005_1000131 3300015265 Bacteria 53401
93 Ga0183373_1006 3300015682 Bacteria 328276
94 Ga0163161_10000012 3300017792 Bacteria 264639
95 Ga0163161_10000717 3300017792 Bacteria 26160
96 Ga0163161_10000934 3300017792 Bacteria 22533
97 Ga0209436_105448 3300025208 Bacteria 2928
98 Ga0209258_100219 3300025242 Bacteria 108974
99 Ga0207425_1000007 3300025245 Bacteria 777411
100 Ga0209646_1000002 3300025246 Bacteria 1425781
101 Ga0209026_1001142 3300025250 Bacteria 12492
102 Ga0209148_1000283 3300025254 Bacteria 77780
103 Ga0209129_1000006 3300025258 Bacteria 777761
104 Ga0209673_1000082 3300025273 Bacteria 219716
105 Ga0209676_1000001 3300025292 Bacteria 1852142
106 Ga0209025_1000025 3300025294 Bacteria 524454
107 Ga0209564_1006278 3300025295 Bacteria 6475
108 Ga0209564_1007804 3300025295 Bacteria 5433
109 Ga0209758_1000016 3300025297 Bacteria 778557
110 Ga0209758_1011135 3300025297 Bacteria 5253
111 Ga0209758_1013256 3300025297 Bacteria 4517
112 Ga0209050_1000016 3300025298 Bacteria 729149
113 Ga0209050_1000555 3300025298 Bacteria 61428
114 Ga0207426_1000493 3300025302 Bacteria 59050
115 Ga0207426_1000514 3300025302 Bacteria 56462
116 Ga0207426_1004603 3300025302 Bacteria 6649
117 Ga0209257_1000001 3300025304 Bacteria 2274655
118 Ga0209257_1002719 3300025304 Bacteria 16820
119 Ga0207655_1000008 3300025728 Bacteria 734289
120 Ga0207681_10330359 3300025923 Bacteria 1215
121 Ga0207669_10037451 3300025937 Bacteria 2783
122 Ga0207691_10011017 3300025940 Bacteria 8674
123 Ga0207651_10037329 3300025960 Bacteria 3182
124 Ga0207668_10075678 3300025972 Bacteria 2421
125 Ga0207639_10074256 3300026041 Bacteria 2669
126 Ga0207675_100196208 3300026118 Bacteria 1938
127 Ga0209281_1000094 3300027111 Bacteria 238155
128 Ga0209489_120170 3300027361 Bacteria 1993
129 Ga0209968_1001935 3300027526 Bacteria 3148
130 Ga0209282_1047296 3300027666 Bacteria 2500
131 Ga0209974_10077676 3300027876 Bacteria 1138
132 Ga0316177_1197208 3300030731 Bacteria 15707
133 Ga0316176_1097193 3300030732 Bacteria 10090
134 Ga0316183_1100732 3300030742 Bacteria 40906
135 Ga0316181_1151138 3300030744 Bacteria 2520
136 Ga0316181_1288392 3300030744 Bacteria 3713
137 Ga0307408_100031661 3300031548 Bacteria 3685
138 Ga0307408_100068824 3300031548 Bacteria 2608
139 Ga0307508_10001286 3300031616 Bacteria 28488
140 Ga0307516_10211264 3300031730 Bacteria 1655
141 Ga0307405_10000007 3300031731 Bacteria 348101
142 Ga0307405_10000010 3300031731 Bacteria 250978
143 Ga0307410_10000062 3300031852 Bacteria 38344
144 Ga0307406_10000327 3300031901 Bacteria 27574
145 Ga0307406_10121788 3300031901 Bacteria 1815
146 Ga0307407_10000009 3300031903 Bacteria 188746
147 Ga0307407_10005225 3300031903 Bacteria 5604
148 Ga0307412_10000077 3300031911 Bacteria 96375
149 Ga0307412_10165718 3300031911 Bacteria 1647
150 Ga0307409_100028345 3300031995 Bacteria 3988
151 Ga0307416_100000019 3300032002 Bacteria 199706
152 Ga0307414_10000001 3300032004 Bacteria 1352954
153 Ga0307414_10000078 3300032004 Bacteria 90911
154 Ga0307414_10000929 3300032004 Bacteria 15007
155 Ga0307414_10003962 3300032004 Bacteria 7984
156 Ga0307414_10008236 3300032004 Bacteria 5898
157 Ga0307414_10013790 3300032004 Bacteria 4821
158 Ga0307414_10046413 3300032004 Bacteria 2982
159 Ga0307414_10110635 3300032004 Bacteria 2090
160 Ga0307414_10333289 3300032004 Bacteria 1296
161 Ga0307411_10000001 3300032005 Bacteria 931810
162 Ga0307411_10166428 3300032005 Unclassified 1658
163 Ga0307510_10040918 3300033180 Bacteria 5077
164 Ga0439447_002410 3300041407 Bacteria 6832
165 Ga0439466_0014366 3300041411 Bacteria 2884
166 Ga0439449_0035610 3300042007 Bacteria 1853
167 Ga0451577_0007599 3300042876 Bacteria 10635
168 Ga0451577_0073391 3300042876 Bacteria 3053
169 Ga0453684_0189264 3300044712 Bacteria 2409
170 Ga0466970_0105610 3300044765 Bacteria 1536
171 Ga0466957_0041475 3300044842 Bacteria 2784
172 Ga0466959_0030792 3300045049 Bacteria 3973
173 Ga0451576_0005630 3300045051 Bacteria 15634
174 Ga0495627_004441 3300046453 Bacteria 5869
175 Ga0495606_0117357 3300046507 Bacteria 1597
176 Ga0495606_0224246 3300046507 Bacteria 1057
177 Ga0495610_0000028 3300046512 Bacteria 272572
178 Ga0495637_0020869 3300046520 Bacteria 3007
179 Ga0495654_0134641 3300046530 Bacteria 1106
180 Ga0495633_0002591 3300046558 Bacteria 12658
181 Ga0496116_0000032 3300048919 Bacteria 419997
182 Ga0496118_0043663 3300048921 Bacteria 3520
183 Ga0496121_0000020 3300048924 Bacteria 498732
184 Ga0496121_0093133 3300048924 Bacteria 2347
185 Ga0496124_0018548 3300048927 Bacteria 6513
186 Ga0496124_0058628 3300048927 Bacteria 3237
187 Ga0496125_0000059 3300048928 Bacteria 264149
188 Ga0496125_0000310 3300048928 Bacteria 95700
189 Ga0496126_0009978 3300048929 Bacteria 10025
190 Ga0496126_0073786 3300048929 Bacteria 3032
191 Ga0496126_0490505 3300048929 Bacteria 983
192 Ga0501047_0032627 3300049581 Bacteria 5028
193 Ga0501238_000112 3300049671 Bacteria 12784
194 Ga0501249_000003 3300049679 Bacteria 242930
195 Ga0501241_001893 3300049758 Bacteria 4113
196 Ga0501241_006295 3300049758 Bacteria 2184
197 Ga0501266_000011 3300049763 Bacteria 197280
198 Ga0501280_000821 3300049776 Bacteria 6720
199 Ga0501035_0000027 3300049822 Bacteria 180157
200 Ga0501044_0029727 3300049823 Bacteria 5761
201 Ga0501044_0067127 3300049823 Bacteria 3655
202 nmdc:mga07m45_234322_c1 3300050496 Bacteria 1068
203 Ga0500644_0000108 3300053088 Bacteria 52348
204 Ga0500644_0060828 3300053088 Bacteria 1330
205 Ga0500646_0002773 3300053090 Bacteria 4511
206 Ga0500646_0014158 3300053090 Bacteria 2069
207 Ga0500646_0033308 3300053090 Bacteria 1425
208 Ga0500651_0000127 3300053093 Bacteria 47010
209 Ga0500641_0000017 3300053096 Bacteria 132678
210 Ga0500641_0001122 3300053096 Bacteria 9518
211 Ga0500562_000029 3300053108 Bacteria 94705
212 Ga0500569_004710 3300053109 Bacteria 2884
213 Ga0500594_0023335 3300053118 Bacteria 1567
214 Ga0500607_079547 3300053121 Bacteria 1674
215 Ga0500658_0001254 3300053134 Bacteria 10290
216 Ga0500559_0015209 3300053136 Bacteria 3250
217 Ga0500559_0040313 3300053136 Bacteria 2033
218 Ga0500577_0007490 3300053142 Bacteria 3064
219 Ga0500589_074845 3300053147 Bacteria 1524
220 Ga0500616_0007957 3300053153 Bacteria 6656
221 Ga0500622_0000077 3300053156 Bacteria 108558
222 Ga0500622_0000304 3300053156 Bacteria 50299
223 Ga0500636_0049299 3300053177 Bacteria 2478
224 Ga0500584_032980 3300053726 Bacteria 2399
225 Ga0500645_041363 3300053730 Unclassified 1361
226 Ga0500661_006478 3300055283 Bacteria 2177
227 2513234431 2513020052 Bacteria 5120511
228 2520879346 2519899754 Bacteria 5336938
229 2586206562 2585427687 Bacteria 5544917
230 2644013123 2643221600 Bacteria 5530138
231 2644372443 2643221667 Bacteria 5627472
232 2644642544 2643221716 Bacteria 4986332
233 2644684914 2643221725 Bacteria 5087956
234 2738732391 2738541279 Bacteria 6149495
235 2738760961 2738541284 Bacteria 5199923
236 2738764956 2738541285 Bacteria 6150075
237 2738853854 2738541302 Bacteria 5944758
238 2739213971 2738543007 Bacteria 6149845
239 2739301225 2738543023 Bacteria 6767879
240 2739588525 2739367651 Bacteria 6359826
241 2739616098 2739367656 Bacteria 5152243
242 2740001260 2739367857 Bacteria 5433684
243 2740006076 2739367858 Bacteria 5432813
244 2776613147 2775506987 Bacteria 5373360
245 2802653835 2802428842 Bacteria 4926114
246 2817416209 2816332280 Bacteria 5109718
247 2819549877 2818991437 Bacteria 5805520
248 2819573802 2818991442 Bacteria 8318214
249 2819588681 2818991444 Bacteria 6968812
250 2821137137 2821136567 Bacteria 8080116
251 2833642894 2833640130 Bacteria 4858325
252 2842723668 2842722452 Bacteria 6263924
253 2842905050 2842903701 Bacteria 6986368
254 2842910174 2842909656 Bacteria 6185908
255 2849285197 2849281842 Bacteria 6065644
256 2852631297 2852627209 Bacteria 5896285
257 2857614886 2857613821 Bacteria 4917088
258 2857618599 2857618242 Bacteria 5635925
259 2857629106 2857627736 Bacteria 5625397
260 2881248166 2881247448 Bacteria 3717788
261 2881363050 2881359912 Bacteria 4935907
262 2902050964 2902048731 Bacteria 4976191
263 2903896959 2903895155 Bacteria 5258610
264 2904424288 2904419702 Bacteria 5166287
265 2904445814 2904445276 Bacteria 5310396
266 2904468121 2904467357 Bacteria 8057758
267 2904557002 2904555929 Bacteria 5218588
268 2904783938 2904780799 Bacteria 5840761
269 2911140144 2911138879 Bacteria 5811561
270 2919181876 2919177583 Bacteria 5641607
271 2919187263 2919186247 Bacteria 6244071
272 2919195372 2919191525 Bacteria 5765973
273 2919511350 2919509842 Bacteria 4104664
274 2919685791 2919683626 Bacteria 5534354
275 2929153502 2929150217 Bacteria 5462483
276 2929157634 2929154850 Bacteria 6753285
277 2929241413 2929239360 Bacteria 7745570
278 2929923445 2929921140 Bacteria 8649150
279 2939665468 2939664404 Bacteria 6364494
280 2946000489 2945997725 Bacteria 6404843
281 2954017406 2954016120 Bacteria 6446024
282 2958463012 2958458903 Bacteria 5301041
283 2958513286 2958512119 Bacteria 4528530
284 2965320739 2965320100 Bacteria 3975600
285 2977270167 2977268062 Bacteria 5243061
286 8003152848 8003151029 Bacteria 8187759
287 8054310140 8054307821 Bacteria 5212224
288 8055421868 8055419101 Bacteria 5289643
289 8055593494 8055592153 Bacteria 5961247
290 8056442215 8056440228 Bacteria 4946504
291 Ga0105251_10080170
292 SwRhRL2b_contig_2154591
293 SwRhRL2b_contig_2686671
294 SwRhRL2b_contig_695650
295 SwRhRL2b_contig_872587
296 JGI24740J21852_10004754
297 JGI24739J22299_10001585
298 JGI25154J39366_1000007
299 JGI25152J39213_1000075
300 JGI25150J39212_1000009
301 JGI25151J46595_10000017
302 JGI25153J46596_10000023
303 JGI25153J46596_10001476
304 rootH2_10006633
305 rootH2_10006635
306 rootH2_10154957
307 rootL2_10010975
308 rootL2_10010976
309 rootL2_10110612
310 rootL2_10133542
311 rootH1_10040488
312 rootH1_10070778
313 rootH1_10112786
314 rootH1_10122254
315 JGI25160J50197_1002370
316 JGI25160J50197_1012404
317 Ga0055535_1001870
318 Ga0055536_1000011
319 Ga0055528_1000164
320 Ga0055530_10002929
321 Ga0055530_10018810
322 Ga0055531_10000020
323 Ga0055531_10015001
324 Ga0065165_1000010
325 Ga0065165_1034648
326 Ga0065714_10002244
327 Ga0065714_10006509
328 Ga0065714_10010078
329 Ga0065714_10064511
330 Ga0065714_10072961
331 Ga0065714_10153750
332 Ga0065704_10000193
333 Ga0065704_10071082
334 Ga0065704_10083591
335 Ga0065704_10092989
336 Ga0065704_10166419
337 Ga0070677_10015640
338 Ga0070677_10057655
339 Ga0070668_100023750
340 Ga0070675_100021837
341 Ga0070673_100065360
342 Ga0070672_100099268
343 Ga0081455_10227323
344 Ga0075370_10258706
345 Ga0099824_1015783
346 Ga0079104_1000005
347 Ga0099826_10014855
348 Ga0105250_10073709
349 Ga0105239_10037999
350 Ga0157373_10000002
351 Ga0157373_10000121
352 Ga0157373_10031659
353 Ga0157373_10050158
354 Ga0157373_10145198
355 Ga0157371_10000009
356 Ga0157371_10000426
357 Ga0157371_10014081
358 Ga0157371_10062832
359 Ga0157371_10207270
360 Ga0157370_10000061
361 Ga0157370_10000545
362 Ga0157370_10002651
363 Ga0157370_10004402
364 Ga0157370_10008288
365 Ga0157370_10011278
366 Ga0157370_10029250
367 Ga0157370_10152840
368 Ga0157370_10274763
369 Ga0157369_10000006
370 Ga0157369_10023024
371 Ga0157369_10421885
372 Ga0163162_10000178
373 Ga0157375_10209675
374 Ga0157380_10096975
375 Ga0182008_10000018
376 Ga0182008_10001546
377 Ga0182008_10073024
378 Ga0182006_1000308
379 Ga0182006_1000595
380 Ga0182006_1000689
381 Ga0182007_10000001
382 Ga0182005_1000131
383 Ga0183373_1006
384 Ga0163161_10000012
385 Ga0163161_10000717
386 Ga0163161_10000934
387 Ga0209436_105448
388 Ga0209258_100219
389 Ga0207425_1000007
390 Ga0209646_1000002
391 Ga0209026_1001142
392 Ga0209148_1000283
393 Ga0209129_1000006
394 Ga0209673_1000082
395 Ga0209676_1000001
396 Ga0209025_1000025
397 Ga0209564_1006278
398 Ga0209564_1007804
399 Ga0209758_1000016
400 Ga0209758_1011135
401 Ga0209758_1013256
402 Ga0209050_1000016
403 Ga0209050_1000555
404 Ga0207426_1000493
405 Ga0207426_1000514
406 Ga0207426_1004603
407 Ga0209257_1000001
408 Ga0209257_1002719
409 Ga0207655_1000008
410 Ga0207681_10330359
411 Ga0207669_10037451
412 Ga0207691_10011017
413 Ga0207651_10037329
414 Ga0207668_10075678
415 Ga0207639_10074256
416 Ga0207675_100196208
417 Ga0209281_1000094
418 Ga0209489_120170
419 Ga0209968_1001935
420 Ga0209282_1047296
421 Ga0209974_10077676
422 Ga0316177_1197208
423 Ga0316176_1097193
424 Ga0316183_1100732
425 Ga0316181_1151138
426 Ga0316181_1288392
427 Ga0307408_100031661
428 Ga0307408_100068824
429 Ga0307508_10001286
430 Ga0307516_10211264
431 Ga0307405_10000007
432 Ga0307405_10000010
433 Ga0307410_10000062
434 Ga0307406_10000327
435 Ga0307406_10121788
436 Ga0307407_10000009
437 Ga0307407_10005225
438 Ga0307412_10000077
439 Ga0307412_10165718
440 Ga0307409_100028345
441 Ga0307416_100000019
442 Ga0307414_10000001
443 Ga0307414_10000078
444 Ga0307414_10000929
445 Ga0307414_10003962
446 Ga0307414_10008236
447 Ga0307414_10013790
448 Ga0307414_10046413
449 Ga0307414_10110635
450 Ga0307414_10333289
451 Ga0307411_10000001
452 Ga0307411_10166428
453 Ga0307510_10040918
454 Ga0439447_002410
455 Ga0439466_0014366
456 Ga0439449_0035610
457 Ga0451577_0007599
458 Ga0451577_0073391
459 Ga0453684_0189264
460 Ga0466970_0105610
461 Ga0466957_0041475
462 Ga0466959_0030792
463 Ga0451576_0005630
464 Ga0495627_004441
465 Ga0495606_0117357
466 Ga0495606_0224246
467 Ga0495610_0000028
468 Ga0495637_0020869
469 Ga0495654_0134641
470 Ga0495633_0002591
471 Ga0496116_0000032
472 Ga0496118_0043663
473 Ga0496121_0000020
474 Ga0496121_0093133
475 Ga0496124_0018548
476 Ga0496124_0058628
477 Ga0496125_0000059
478 Ga0496125_0000310
479 Ga0496126_0009978
480 Ga0496126_0073786
481 Ga0496126_0490505
482 Ga0501047_0032627
483 Ga0501238_000112
484 Ga0501249_000003
485 Ga0501241_001893
486 Ga0501241_006295
487 Ga0501266_000011
488 Ga0501280_000821
489 Ga0501035_0000027
490 Ga0501044_0029727
491 Ga0501044_0067127
492 nmdc:mga07m45_234322_c1
493 Ga0500644_0000108
494 Ga0500644_0060828
495 Ga0500646_0002773
496 Ga0500646_0014158
497 Ga0500646_0033308
498 Ga0500651_0000127
499 Ga0500641_0000017
500 Ga0500641_0001122
501 Ga0500562_000029
502 Ga0500569_004710
503 Ga0500594_0023335
504 Ga0500607_079547
505 Ga0500658_0001254
506 Ga0500559_0015209
507 Ga0500559_0040313
508 Ga0500577_0007490
509 Ga0500589_074845
510 Ga0500616_0007957
511 Ga0500622_0000077
512 Ga0500622_0000304
513 Ga0500636_0049299
514 Ga0500584_032980
515 Ga0500645_041363
516 Ga0500661_006478
517 2513234431
518 2520879346
519 2586206562
520 2644013123
521 2644372443
522 2644642544
523 2644684914
524 2738732391
525 2738760961
526 2738764956
527 2738853854
528 2739213971
529 2739301225
530 2739588525
531 2739616098
532 2740001260
533 2740006076
534 2776613147
535 2802653835
536 2817416209
537 2819549877
538 2819573802
539 2819588681
540 2821137137
541 2833642894
542 2842723668
543 2842905050
544 2842910174
545 2849285197
546 2852631297
547 2857614886
548 2857618599
549 2857629106
550 2881248166
551 2881363050
552 2902050964
553 2903896959
554 2904424288
555 2904445814
556 2904468121
557 2904557002
558 2904783938
559 2911140144
560 2919181876
561 2919187263
562 2919195372
563 2919511350
564 2919685791
565 2929153502
566 2929157634
567 2929241413
568 2929923445
569 2939665468
570 2946000489
571 2954017406
572 2958463012
573 2958513286
574 2965320739
575 2977270167
576 8003152848
577 8054310140
578 8055421868
579 8055593494
580 8056442215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01062

Bestrophin

Bestrophin, RFP-TM, chloride channel

29

312

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ivn-assembly1.cif.gz_B crystal structure of a membrane protein g264a 0.8684 24 286
6ivq-assembly1.cif.gz_B crystal structure of a membrane protein s19a 0.8621 24 286
6ivk-assembly1.cif.gz_C crystal structure of a membrane protein g175a 0.8603 24 287
6ivl-assembly1.cif.gz_C crystal structure of a membrane protein l259a 0.8584 25 287
5x87-assembly1.cif.gz_B crystal structure of a bacterial bestrophin homolog from klebsiella pneumoniae with a mutation l177t 0.8564 24 286
ID Description Score Start End Superfamily
af_Q4D9T1_7_123_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6161 90 200 1.20.140.150
af_A4I1N6_7_128_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6132 90 206 1.20.140.150
af_A0A1D8PSD3_8_129_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6058 91 198 1.20.140.150
af_A4I1N6_7_128_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5893 90 206 1.20.140.150
af_Q4D9T1_7_123_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.574 90 200 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A381F6I0-F1-model_v4 Predicted membrane protein 0.939 33 287 GO:0005254
GO:0005886
AF-A0A3D1RC93-F1-model_v4 Bestrophin 0.936 1 288 GO:0005254
GO:0005886
AF-A0A3D1RC93-F1-model_v4 Bestrophin 0.9331 1 288 GO:0005254
GO:0005886
AF-A0A6J4LDJ5-F1-model_v4 Probable membrane protein STY1534 0.9316 1 287 GO:0005254
GO:0005886
AF-H7FVG0-F1-model_v4 Bestrophin, RFP-TM, chloride channel 0.9284 30 286 GO:0005254
GO:0005886

Map