F389901

General Info

Members Datasets Scaffolds Average Seq Length
290 210 580 321

Family's Representative Sequence

Representative Sequence 3300041491|Ga0451833_0464765|Ga0451833_0464765_686_1651
Length 308
Sequence MTVIASYIYRNGKRAEEVALQSQSFATRDGEFVWIGLAEPTSDEMDSLKMMFGLHPLAVEDALNGQQVPKVDVYGDQLFVVIKTAHLEGDKIAYGETCIFVGKHHLISVRHGSAKSHKGLREQLEHSPIIDFVVDGYLPMVETMEDRVLELEKHVLISFLEREQIRRIFRMRRQVIKFQRVLGPMSEVVGKLTHLDLPCVDENSKPFFRDVHDHVRRVESVVGGLRDIITSVFEASNLLEQQRQGTITRQLAAWAAILAVPTAIAGIYGMNFEHMPELGTEYGYYVVLTVIVVVCGILYSRFRKAGWL

Samples

Sample ID Description Type Environment
1 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
97 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
162 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
163 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
164 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
168 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
169 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
170 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
171 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
172 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
173 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
174 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
175 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
176 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
177 2643221723 Ensifer sp. Root278 Isolate Unclassified
178 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
179 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
180 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
181 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
182 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
183 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
184 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
185 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
186 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
187 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
188 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
189 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
190 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
191 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
192 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
193 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
194 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
195 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
196 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
197 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
198 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
199 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
200 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
201 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
202 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
203 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
204 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
205 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
206 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
207 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
208 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
209 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
210 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.41
Metatranscriptomes 0
Isolates 17.59

Biome Distribution

Category Percentage (%)
Aerial Root 2.76
Bulb 0
Endosphere 12.41
Nodule 4.48
Rhizoplane 2.41
Rhizosphere 66.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451833_0464765 3300041491 Bacteria 5110
2 MBSR1b_contig_212945 2162886012 Bacteria 1665
3 MBSR1b_contig_7766768 2162886012 Bacteria 1663
4 JGI24739J22299_10029751 3300001989 Bacteria 1896
5 JGI24034J26672_10002332 3300002239 Bacteria 2602
6 JGI24742J22300_10004332 3300002244 Bacteria 2320
7 JGI25159J45721_1000012 3300002987 Bacteria 149808
8 JGI25151J46595_10026212 3300003187 Bacteria 2357
9 rootH1_10026045 3300003323 Bacteria 6647
10 JGI25160J50197_1000042 3300003354 Bacteria 149808
11 JGI25161J50226_1000210 3300003374 Bacteria 37233
12 Ga0055526_1000834 3300003771 Bacteria 23036
13 Ga0055536_1002660 3300003781 Bacteria 9910
14 Ga0055543_1000123 3300004625 Bacteria 64977
15 Ga0065165_1000174 3300005262 Bacteria 113769
16 Ga0065165_1018856 3300005262 Bacteria 2483
17 Ga0065712_10096323 3300005290 Bacteria 2187
18 Ga0065715_10098526 3300005293 Bacteria 3535
19 Ga0065707_10132074 3300005295 Bacteria 1903
20 Ga0065707_10155045 3300005295 Bacteria 1617
21 Ga0070676_10083455 3300005328 Bacteria 1943
22 Ga0070670_100019927 3300005331 Bacteria 5758
23 Ga0070670_100026918 3300005331 Bacteria 4946
24 Ga0070677_10001278 3300005333 Bacteria 8056
25 Ga0070677_10011230 3300005333 Bacteria 3083
26 Ga0070677_10149240 3300005333 Bacteria 1086
27 Ga0068868_100000006 3300005338 Bacteria 123358
28 Ga0070660_100000448 3300005339 Bacteria 27431
29 Ga0070668_100036110 3300005347 Bacteria 3771
30 Ga0070668_100151724 3300005347 Bacteria 1874
31 Ga0070668_100197877 3300005347 Bacteria 1649
32 Ga0070669_100016851 3300005353 Bacteria 5216
33 Ga0070675_100007206 3300005354 Bacteria 8573
34 Ga0070675_100009549 3300005354 Bacteria 7547
35 Ga0070675_100030882 3300005354 Bacteria 4327
36 Ga0070671_100037218 3300005355 Bacteria 4035
37 Ga0070671_100039683 3300005355 Bacteria 3908
38 Ga0070671_100155318 3300005355 Bacteria 1933
39 Ga0070674_100036180 3300005356 Bacteria 3311
40 Ga0070673_100020951 3300005364 Bacteria 4726
41 Ga0070659_100000005 3300005366 Bacteria 259902
42 Ga0070701_10072544 3300005438 Bacteria 1844
43 Ga0070678_100027699 3300005456 Bacteria 3852
44 Ga0070662_100005727 3300005457 Bacteria 7961
45 Ga0068853_100083069 3300005539 Bacteria 2806
46 Ga0068853_100227757 3300005539 Bacteria 1704
47 Ga0070672_100436059 3300005543 Bacteria 1127
48 Ga0070686_100001878 3300005544 Bacteria 11700
49 Ga0070686_100067416 3300005544 Bacteria 2331
50 Ga0070665_100000038 3300005548 Bacteria 309230
51 Ga0070664_100101284 3300005564 Bacteria 2505
52 Ga0068854_100065327 3300005578 Bacteria 2645
53 Ga0068859_100004778 3300005617 Bacteria 13781
54 Ga0068859_100400125 3300005617 Bacteria 1469
55 Ga0068864_100011441 3300005618 Bacteria 7330
56 Ga0068864_100062643 3300005618 Bacteria 3223
57 Ga0068866_10100736 3300005718 Bacteria 1593
58 Ga0068861_100108314 3300005719 Bacteria 2222
59 Ga0068870_10137175 3300005840 Bacteria 1428
60 Ga0068863_100008473 3300005841 Bacteria 10043
61 Ga0068863_100045965 3300005841 Bacteria 4144
62 Ga0068860_100013059 3300005843 Bacteria 8151
63 Ga0068860_100069207 3300005843 Bacteria 3354
64 Ga0068860_100230896 3300005843 Bacteria 1798
65 Ga0068862_100000074 3300005844 Bacteria 118036
66 Ga0068862_100020793 3300005844 Bacteria 5482
67 Ga0075367_10000044 3300006178 Bacteria 28305
68 Ga0075428_100149850 3300006844 Bacteria 2534
69 Ga0097620_100004778 3300006931 Bacteria 13781
70 Ga0097620_100400200 3300006931 Bacteria 1469
71 Ga0105245_10015502 3300009098 Bacteria 6645
72 Ga0105247_10016490 3300009101 Bacteria 4429
73 Ga0105249_10000167 3300009553 Bacteria 77350
74 Ga0105249_10037701 3300009553 Bacteria 4386
75 Ga0157373_10050737 3300013100 Bacteria 2954
76 Ga0157371_10176204 3300013102 Bacteria 1529
77 Ga0157370_10052632 3300013104 Bacteria 3887
78 Ga0157369_10020532 3300013105 Bacteria 7384
79 Ga0157369_10035368 3300013105 Bacteria 5478
80 Ga0157372_10075574 3300013307 Bacteria 3801
81 Ga0157372_10618789 3300013307 Bacteria 1262
82 Ga0157380_10026698 3300014326 Bacteria 4386
83 Ga0157380_10056460 3300014326 Bacteria 3122
84 Ga0157380_10331810 3300014326 Bacteria 1415
85 Ga0163161_10064338 3300017792 Bacteria 2675
86 Ga0163161_10097874 3300017792 Bacteria 2180
87 Ga0209436_100140 3300025208 Bacteria 35032
88 Ga0209147_101666 3300025229 Bacteria 7306
89 Ga0207425_1013753 3300025245 Bacteria 1858
90 Ga0209130_1000075 3300025284 Bacteria 171698
91 Ga0209130_1025642 3300025284 Bacteria 1274
92 Ga0209676_1003221 3300025292 Bacteria 10310
93 Ga0209025_1001974 3300025294 Bacteria 23554
94 Ga0209564_1000278 3300025295 Bacteria 105405
95 Ga0209758_1023202 3300025297 Bacteria 2814
96 Ga0209050_1003053 3300025298 Bacteria 12906
97 Ga0209256_1000411 3300025299 Bacteria 67351
98 Ga0207426_1000163 3300025302 Bacteria 171698
99 Ga0207426_1000745 3300025302 Bacteria 36615
100 Ga0209051_1050007 3300025303 Bacteria 1403
101 Ga0209257_1009385 3300025304 Bacteria 5261
102 Ga0207697_10000837 3300025315 Bacteria 17422
103 Ga0207682_10003071 3300025893 Bacteria 7331
104 Ga0207682_10014238 3300025893 Bacteria 3098
105 Ga0207682_10139897 3300025893 Bacteria 1086
106 Ga0207710_10008191 3300025900 Bacteria 4411
107 Ga0207645_10036118 3300025907 Bacteria 3173
108 Ga0207657_10001193 3300025919 Bacteria 27632
109 Ga0207649_10068763 3300025920 Bacteria 2253
110 Ga0207681_10001762 3300025923 Bacteria 13898
111 Ga0207650_10006037 3300025925 Bacteria 8264
112 Ga0207650_10006510 3300025925 Bacteria 7962
113 Ga0207650_10062008 3300025925 Bacteria 2793
114 Ga0207659_10001025 3300025926 Bacteria 16614
115 Ga0207659_10006342 3300025926 Bacteria 7241
116 Ga0207687_10090802 3300025927 Bacteria 2227
117 Ga0207687_10285161 3300025927 Bacteria 1325
118 Ga0207644_10026854 3300025931 Bacteria 3974
119 Ga0207690_10000002 3300025932 Bacteria 807473
120 Ga0207690_10000033 3300025932 Bacteria 149705
121 Ga0207690_10355366 3300025932 Bacteria 1159
122 Ga0207706_10002424 3300025933 Bacteria 18204
123 Ga0207706_10036474 3300025933 Bacteria 4367
124 Ga0207706_10142193 3300025933 Bacteria 2111
125 Ga0207669_10042823 3300025937 Bacteria 2646
126 Ga0207679_10067078 3300025945 Bacteria 2691
127 Ga0207651_10010425 3300025960 Bacteria 5152
128 Ga0207712_10000049 3300025961 Bacteria 160026
129 Ga0207668_10000870 3300025972 Bacteria 18225
130 Ga0207640_10070132 3300025981 Bacteria 2356
131 Ga0207677_10000043 3300026023 Bacteria 110161
132 Ga0207678_10014976 3300026067 Bacteria 6823
133 Ga0207641_10007896 3300026088 Bacteria 8825
134 Ga0207641_10060208 3300026088 Bacteria 3236
135 Ga0207676_10049218 3300026095 Bacteria 3277
136 Ga0207676_10050890 3300026095 Bacteria 3232
137 Ga0209281_1000110 3300027111 Bacteria 215631
138 Ga0209371_1000035 3300027312 Bacteria 368979
139 Ga0209371_1001310 3300027312 Bacteria 17417
140 Ga0209813_10000034 3300027866 Bacteria 61259
141 Ga0268266_10000118 3300028379 Bacteria 163466
142 Ga0268265_10000113 3300028380 Bacteria 101546
143 Ga0268265_10013294 3300028380 Bacteria 5593
144 Ga0268265_10430270 3300028380 Bacteria 1228
145 Ga0268264_10009791 3300028381 Bacteria 7932
146 Ga0268264_10290645 3300028381 Bacteria 1535
147 Ga0268256_1000037 3300030500 Bacteria 367024
148 Ga0268256_1008922 3300030500 Bacteria 3384
149 Ga0307513_10016058 3300031456 Bacteria 9048
150 Ga0307513_10065093 3300031456 Bacteria 3836
151 Ga0307405_10008880 3300031731 Bacteria 5124
152 Ga0307405_10053886 3300031731 Bacteria 2508
153 Ga0307405_10150186 3300031731 Bacteria 1637
154 Ga0307413_10002762 3300031824 Bacteria 7224
155 Ga0307413_10166334 3300031824 Bacteria 1556
156 Ga0307410_10010005 3300031852 Bacteria 5351
157 Ga0307410_10202632 3300031852 Bacteria 1516
158 Ga0307406_10095785 3300031901 Bacteria 2009
159 Ga0307407_10113662 3300031903 Bacteria 1704
160 Ga0307412_10090620 3300031911 Bacteria 2138
161 Ga0307409_100005087 3300031995 Bacteria 7501
162 Ga0307409_100059207 3300031995 Bacteria 2980
163 Ga0307416_100101979 3300032002 Bacteria 2501
164 Ga0307416_100236778 3300032002 Bacteria 1765
165 Ga0307416_100321384 3300032002 Bacteria 1550
166 Ga0307414_10017063 3300032004 Bacteria 4433
167 Ga0307414_10095432 3300032004 Bacteria 2222
168 Ga0307411_10004993 3300032005 Bacteria 6451
169 Ga0307415_100039871 3300032126 Bacteria 3108
170 Ga0307415_100166268 3300032126 Bacteria 1715
171 Ga0436365_1785712 3300039437 Bacteria 1231
172 Ga0451835_0209279 3300041492 Bacteria 1855
173 Ga0451837_0875839 3300041494 Bacteria 3046
174 Ga0451849_0260183 3300041505 Bacteria 3324
175 Ga0451843_0275338 3300041509 Bacteria 3267
176 Ga0451855_0167445 3300041511 Bacteria 6875
177 Ga0451853_0224927 3300041512 Bacteria 3433
178 Ga0439445_0003025 3300042004 Bacteria 3764
179 Ga0439448_0036062 3300042005 Bacteria 1585
180 Ga0439454_007687 3300042011 Bacteria 1357
181 Ga0439455_0000153 3300042012 Bacteria 7607
182 Ga0439458_0001828 3300042157 Bacteria 5295
183 Ga0439458_0011668 3300042157 Bacteria 1966
184 Ga0439464_0088565 3300042439 Bacteria 931
185 Ga0495617_007630 3300046452 Bacteria 3747
186 Ga0495627_000459 3300046453 Bacteria 35376
187 Ga0495627_000503 3300046453 Bacteria 32725
188 Ga0495584_0013745 3300046491 Bacteria 4129
189 Ga0495585_0097846 3300046492 Bacteria 1573
190 Ga0495607_0006848 3300046501 Bacteria 7953
191 Ga0495583_0004105 3300046506 Bacteria 10681
192 Ga0495610_0000043 3300046512 Bacteria 158045
193 Ga0495632_0000048 3300046519 Bacteria 137883
194 Ga0495632_0061819 3300046519 Bacteria 1817
195 Ga0495637_0001256 3300046520 Bacteria 15302
196 Ga0495637_0002774 3300046520 Bacteria 9507
197 Ga0495643_0000030 3300046522 Bacteria 260229
198 Ga0495648_0009768 3300046524 Bacteria 7391
199 Ga0495663_0000003 3300046525 Bacteria 362694
200 Ga0495663_0001552 3300046525 Bacteria 7201
201 Ga0495663_0027438 3300046525 Bacteria 1671
202 Ga0495633_0000211 3300046558 Bacteria 73547
203 Ga0495633_0000215 3300046558 Bacteria 72445
204 Ga0495633_0017847 3300046558 Bacteria 3615
205 Ga0495633_0022300 3300046558 Bacteria 3154
206 Ga0495633_0102031 3300046558 Bacteria 1332
207 Ga0495633_0117710 3300046558 Bacteria 1231
208 Ga0495625_0057763 3300046660 Bacteria 2758
209 Ga0495659_0004913 3300046664 Bacteria 4207
210 Ga0495661_0094489 3300046665 Bacteria 1695
211 Ga0495670_0043662 3300046691 Bacteria 2237
212 Ga0495670_0129625 3300046691 Bacteria 1314
213 Ga0495671_0000043 3300046692 Bacteria 163036
214 Ga0495677_0014104 3300047445 Bacteria 2911
215 Ga0495681_0000025 3300047470 Bacteria 148216
216 Ga0495681_0005953 3300047470 Bacteria 8089
217 Ga0495686_0036570 3300047472 Bacteria 3151
218 Ga0496106_0002403 3300048909 Bacteria 13950
219 Ga0496111_0001989 3300048914 Bacteria 12152
220 Ga0496115_0121618 3300048918 Bacteria 2148
221 Ga0496121_0011350 3300048924 Bacteria 9904
222 Ga0496121_0028426 3300048924 Bacteria 5204
223 Ga0496121_0267388 3300048924 Bacteria 1177
224 Ga0496123_0006828 3300048926 Bacteria 10950
225 Ga0496124_0071625 3300048927 Bacteria 2872
226 Ga0496124_0127473 3300048927 Bacteria 2026
227 Ga0496126_0080255 3300048929 Bacteria 2887
228 nmdc:mga03n38_22034_c1 3300050490 Bacteria 2572
229 nmdc:mga06z11_4_c1 3300050494 Bacteria 131352
230 nmdc:mga04h51_7_c1 3300050495 Bacteria 109425
231 nmdc:mga08y16_128747_c1 3300050511 Bacteria 2633
232 nmdc:mga0n895_160861_c1 3300050512 Bacteria 2277
233 Ga0500562_012809 3300053108 Bacteria 2135
234 Ga0500608_000685 3300053122 Bacteria 12409
235 Ga0500618_000402 3300053125 Bacteria 29508
236 Ga0500658_0012956 3300053134 Bacteria 3080
237 Ga0500568_0001141 3300053139 Bacteria 17815
238 Ga0500622_0066586 3300053156 Bacteria 1829
239 Ga0500633_0000181 3300053160 Bacteria 8695
240 2512642656 2512564014 Bacteria 4639632
241 2514002269 2513237159 Bacteria 6810126
242 2517099774 2517093000 Bacteria 7412387
243 2585233559 2582581299 Bacteria 6518058
244 2585393418 2582581866 Bacteria 6859583
245 2599336272 2599185156 Bacteria 5403036
246 2599606107 2599185210 Bacteria 5624189
247 2599718234 2599185236 Bacteria 6875203
248 2600375069 2600254933 Bacteria 4750527
249 2644672429 2643221723 Bacteria 7095460
250 2809062517 2808606401 Bacteria 4586670
251 2809078143 2808606404 Bacteria 4652788
252 2809082906 2808606405 Bacteria 4586632
253 2819561247 2818991439 Bacteria 6907412
254 2819562132 2818991439 Bacteria 6907412
255 2821126436 2821123053 Bacteria 7836056
256 2838737088 2838736955 Bacteria 5760694
257 2841842543 2841840854 Bacteria 5761912
258 2842142323 2842140634 Bacteria 5759631
259 2842311121 2842304105 Bacteria 7023636
260 2842525034 2842521101 Bacteria 6569494
261 2842927964 2842922631 Bacteria 5824079
262 2842928141 2842922631 Bacteria 5824079
263 2854900152 2854896431 Bacteria 5869725
264 2857521381 2857516855 Bacteria 7787325
265 2857532998 2857531043 Bacteria 6754041
266 2857533325 2857531043 Bacteria 6754041
267 2880522222 2880518877 Bacteria 5012590
268 2919709806 2919709256 Bacteria 4318106
269 2923560251 2923556063 Bacteria 6793593
270 2933577498 2933570622 Bacteria 7023390
271 2936372999 2936367885 Bacteria 7324495
272 2936381151 2936375103 Bacteria 6652732
273 2941506672 2941499720 Bacteria 7599444
274 2946788088 2946787523 Bacteria 4366789
275 2954011705 2954011201 Bacteria 4762601
276 2979101851 2979100975 Bacteria 5423623
277 2979103225 2979100975 Bacteria 5423623
278 2984510217 2984509177 Bacteria 5274802
279 2984514090 2984509177 Bacteria 5274802
280 2984519079 2984518228 Bacteria 5277463
281 2984523121 2984518228 Bacteria 5277463
282 2984538562 2984537506 Bacteria 5277481
283 2984542342 2984537506 Bacteria 5277481
284 2984605272 2984601300 Bacteria 5455244
285 2984606343 2984601300 Bacteria 5455244
286 3005409853 3005409236 Bacteria 7188837
287 8005378923 8005376324 Bacteria 6590079
288 8023685670 8023680758 Bacteria 7729763
289 8054465518 8054460903 Bacteria 4872905
290 8056879923 8056875544 Bacteria 4355797
291 Ga0451833_0464765
292 MBSR1b_contig_212945
293 MBSR1b_contig_7766768
294 JGI24739J22299_10029751
295 JGI24034J26672_10002332
296 JGI24742J22300_10004332
297 JGI25159J45721_1000012
298 JGI25151J46595_10026212
299 rootH1_10026045
300 JGI25160J50197_1000042
301 JGI25161J50226_1000210
302 Ga0055526_1000834
303 Ga0055536_1002660
304 Ga0055543_1000123
305 Ga0065165_1000174
306 Ga0065165_1018856
307 Ga0065712_10096323
308 Ga0065715_10098526
309 Ga0065707_10132074
310 Ga0065707_10155045
311 Ga0070676_10083455
312 Ga0070670_100019927
313 Ga0070670_100026918
314 Ga0070677_10001278
315 Ga0070677_10011230
316 Ga0070677_10149240
317 Ga0068868_100000006
318 Ga0070660_100000448
319 Ga0070668_100036110
320 Ga0070668_100151724
321 Ga0070668_100197877
322 Ga0070669_100016851
323 Ga0070675_100007206
324 Ga0070675_100009549
325 Ga0070675_100030882
326 Ga0070671_100037218
327 Ga0070671_100039683
328 Ga0070671_100155318
329 Ga0070674_100036180
330 Ga0070673_100020951
331 Ga0070659_100000005
332 Ga0070701_10072544
333 Ga0070678_100027699
334 Ga0070662_100005727
335 Ga0068853_100083069
336 Ga0068853_100227757
337 Ga0070672_100436059
338 Ga0070686_100001878
339 Ga0070686_100067416
340 Ga0070665_100000038
341 Ga0070664_100101284
342 Ga0068854_100065327
343 Ga0068859_100004778
344 Ga0068859_100400125
345 Ga0068864_100011441
346 Ga0068864_100062643
347 Ga0068866_10100736
348 Ga0068861_100108314
349 Ga0068870_10137175
350 Ga0068863_100008473
351 Ga0068863_100045965
352 Ga0068860_100013059
353 Ga0068860_100069207
354 Ga0068860_100230896
355 Ga0068862_100000074
356 Ga0068862_100020793
357 Ga0075367_10000044
358 Ga0075428_100149850
359 Ga0097620_100004778
360 Ga0097620_100400200
361 Ga0105245_10015502
362 Ga0105247_10016490
363 Ga0105249_10000167
364 Ga0105249_10037701
365 Ga0157373_10050737
366 Ga0157371_10176204
367 Ga0157370_10052632
368 Ga0157369_10020532
369 Ga0157369_10035368
370 Ga0157372_10075574
371 Ga0157372_10618789
372 Ga0157380_10026698
373 Ga0157380_10056460
374 Ga0157380_10331810
375 Ga0163161_10064338
376 Ga0163161_10097874
377 Ga0209436_100140
378 Ga0209147_101666
379 Ga0207425_1013753
380 Ga0209130_1000075
381 Ga0209130_1025642
382 Ga0209676_1003221
383 Ga0209025_1001974
384 Ga0209564_1000278
385 Ga0209758_1023202
386 Ga0209050_1003053
387 Ga0209256_1000411
388 Ga0207426_1000163
389 Ga0207426_1000745
390 Ga0209051_1050007
391 Ga0209257_1009385
392 Ga0207697_10000837
393 Ga0207682_10003071
394 Ga0207682_10014238
395 Ga0207682_10139897
396 Ga0207710_10008191
397 Ga0207645_10036118
398 Ga0207657_10001193
399 Ga0207649_10068763
400 Ga0207681_10001762
401 Ga0207650_10006037
402 Ga0207650_10006510
403 Ga0207650_10062008
404 Ga0207659_10001025
405 Ga0207659_10006342
406 Ga0207687_10090802
407 Ga0207687_10285161
408 Ga0207644_10026854
409 Ga0207690_10000002
410 Ga0207690_10000033
411 Ga0207690_10355366
412 Ga0207706_10002424
413 Ga0207706_10036474
414 Ga0207706_10142193
415 Ga0207669_10042823
416 Ga0207679_10067078
417 Ga0207651_10010425
418 Ga0207712_10000049
419 Ga0207668_10000870
420 Ga0207640_10070132
421 Ga0207677_10000043
422 Ga0207678_10014976
423 Ga0207641_10007896
424 Ga0207641_10060208
425 Ga0207676_10049218
426 Ga0207676_10050890
427 Ga0209281_1000110
428 Ga0209371_1000035
429 Ga0209371_1001310
430 Ga0209813_10000034
431 Ga0268266_10000118
432 Ga0268265_10000113
433 Ga0268265_10013294
434 Ga0268265_10430270
435 Ga0268264_10009791
436 Ga0268264_10290645
437 Ga0268256_1000037
438 Ga0268256_1008922
439 Ga0307513_10016058
440 Ga0307513_10065093
441 Ga0307405_10008880
442 Ga0307405_10053886
443 Ga0307405_10150186
444 Ga0307413_10002762
445 Ga0307413_10166334
446 Ga0307410_10010005
447 Ga0307410_10202632
448 Ga0307406_10095785
449 Ga0307407_10113662
450 Ga0307412_10090620
451 Ga0307409_100005087
452 Ga0307409_100059207
453 Ga0307416_100101979
454 Ga0307416_100236778
455 Ga0307416_100321384
456 Ga0307414_10017063
457 Ga0307414_10095432
458 Ga0307411_10004993
459 Ga0307415_100039871
460 Ga0307415_100166268
461 Ga0436365_1785712
462 Ga0451835_0209279
463 Ga0451837_0875839
464 Ga0451849_0260183
465 Ga0451843_0275338
466 Ga0451855_0167445
467 Ga0451853_0224927
468 Ga0439445_0003025
469 Ga0439448_0036062
470 Ga0439454_007687
471 Ga0439455_0000153
472 Ga0439458_0001828
473 Ga0439458_0011668
474 Ga0439464_0088565
475 Ga0495617_007630
476 Ga0495627_000459
477 Ga0495627_000503
478 Ga0495584_0013745
479 Ga0495585_0097846
480 Ga0495607_0006848
481 Ga0495583_0004105
482 Ga0495610_0000043
483 Ga0495632_0000048
484 Ga0495632_0061819
485 Ga0495637_0001256
486 Ga0495637_0002774
487 Ga0495643_0000030
488 Ga0495648_0009768
489 Ga0495663_0000003
490 Ga0495663_0001552
491 Ga0495663_0027438
492 Ga0495633_0000211
493 Ga0495633_0000215
494 Ga0495633_0017847
495 Ga0495633_0022300
496 Ga0495633_0102031
497 Ga0495633_0117710
498 Ga0495625_0057763
499 Ga0495659_0004913
500 Ga0495661_0094489
501 Ga0495670_0043662
502 Ga0495670_0129625
503 Ga0495671_0000043
504 Ga0495677_0014104
505 Ga0495681_0000025
506 Ga0495681_0005953
507 Ga0495686_0036570
508 Ga0496106_0002403
509 Ga0496111_0001989
510 Ga0496115_0121618
511 Ga0496121_0011350
512 Ga0496121_0028426
513 Ga0496121_0267388
514 Ga0496123_0006828
515 Ga0496124_0071625
516 Ga0496124_0127473
517 Ga0496126_0080255
518 nmdc:mga03n38_22034_c1
519 nmdc:mga06z11_4_c1
520 nmdc:mga04h51_7_c1
521 nmdc:mga08y16_128747_c1
522 nmdc:mga0n895_160861_c1
523 Ga0500562_012809
524 Ga0500608_000685
525 Ga0500618_000402
526 Ga0500658_0012956
527 Ga0500568_0001141
528 Ga0500622_0066586
529 Ga0500633_0000181
530 2512642656
531 2514002269
532 2517099774
533 2585233559
534 2585393418
535 2599336272
536 2599606107
537 2599718234
538 2600375069
539 2644672429
540 2809062517
541 2809078143
542 2809082906
543 2819561247
544 2819562132
545 2821126436
546 2838737088
547 2841842543
548 2842142323
549 2842311121
550 2842525034
551 2842927964
552 2842928141
553 2854900152
554 2857521381
555 2857532998
556 2857533325
557 2880522222
558 2919709806
559 2923560251
560 2933577498
561 2936372999
562 2936381151
563 2941506672
564 2946788088
565 2954011705
566 2979101851
567 2979103225
568 2984510217
569 2984514090
570 2984519079
571 2984523121
572 2984538562
573 2984542342
574 2984605272
575 2984606343
576 3005409853
577 8005378923
578 8023685670
579 8054465518
580 8056879923

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

29

304

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jcf-assembly1.cif.gz_A cryo-em structure of the magnesium channel cora in the closed symmetric magnesium-bound state 0.8764 3 322
5yny-assembly1.cif.gz_A structure of house dust mite allergen der f 21 in peg2kmme 0.8743 137 246
2bbj-assembly1.cif.gz_F crystal structure of the cora mg2+ transporter 0.869 3 318
3jcf-assembly1.cif.gz_A cryo-em structure of the magnesium channel cora in the closed symmetric magnesium-bound state 0.8688 3 322
4eeb-assembly1.cif.gz_C cora coiled-coil mutant under mg2+ absence 0.8685 6 318
ID Description Score Start End Superfamily
af_O50455_48_179_3.30.460.20 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like 0.9493 33 129 3.30.460.20
4ev6A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.948 135 262 1.20.58.340
4i0uI02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.941 136 243 1.20.58.340
4i0uJ02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9409 137 243 1.20.58.340
4i0uB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9401 136 243 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A520JCN4-F1-model_v4 Magnesium transporter 0.9857 1 225 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A520JCN4-F1-model_v4 Magnesium transporter 0.9771 1 225 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A3S4DGT1-F1-model_v4 Magnesium transport protein CorA 0.9506 2 322 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-F8UGV9-F1-model_v4 Metal ion transport protein 0.9478 3 285 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A529YH66-F1-model_v4 Magnesium transporter 0.9476 3 192 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897

Map