F389944

General Info

Members Datasets Scaffolds Average Seq Length
290 188 580 323

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0061769|Ga0495580_0061769_598_1800
Length 386
Sequence MLRETGSQLPRANSETFGNLKWQVSRFRGVESGYSQADISRETMTTAWANVFDTVTRWKGAPMRNIAFVLTLAGVTSLLAQPSSSYRVTHTYTLGGDGSWDYVVPDPPNHRLFIARQTRVMVVDENNGTLLGEVTGIDGAHGTAVAEGTGHGFATSGNDKSVVMFDLKTFKVLGRIPAAEDADAIIYDSPSNRVFTFNGDAHSSTVIDPRAGSLITNIPLGGKPEYGASAGDGKVYANLTDSSEVVEIDAKTATVARRWSTGACKQPVAMAIDTAHHRLFSGCRSGVMAISDYQAGKVVATVPIGKGVDGADGTLTVIHQDAPDQYHVVENLQTPQGSRNMGLDPTNHRVFLVSAKFGPVPAGARRGPVLPGSFTLMTIERYPAAR

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.17
Rhizosphere 94.14
Stem 0
Stem Tuber 0
Unclassified 19.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0061769 3300046472 Bacteria 2630
2 Ga0065715_10200796 3300005293 Bacteria 1300
3 Ga0070676_10037004 3300005328 Unclassified 2813
4 Ga0070683_100078314 3300005329 Bacteria 3092
5 Ga0070683_100121038 3300005329 Bacteria 2473
6 Ga0070683_100460960 3300005329 Bacteria 1213
7 Ga0070690_100063800 3300005330 Bacteria 2378
8 Ga0070666_10086511 3300005335 Bacteria 2148
9 Ga0070689_100032462 3300005340 Bacteria 3971
10 Ga0070661_100026543 3300005344 Unclassified 4166
11 Ga0070671_100045200 3300005355 Bacteria 3661
12 Ga0070671_100110799 3300005355 Bacteria 2306
13 Ga0070671_100144189 3300005355 Bacteria 2010
14 Ga0070673_100001880 3300005364 Bacteria 12581
15 Ga0070688_100116417 3300005365 Bacteria 1784
16 Ga0070659_100157555 3300005366 Unclassified 1855
17 Ga0070667_100057158 3300005367 Bacteria 3296
18 Ga0070709_10000033 3300005434 Bacteria 116407
19 Ga0070713_100150270 3300005436 Bacteria 2071
20 Ga0070701_10039351 3300005438 Bacteria 2398
21 Ga0070711_100049400 3300005439 Bacteria 2881
22 Ga0070708_100073122 3300005445 Bacteria 3089
23 Ga0070708_100075359 3300005445 Bacteria 3045
24 Ga0070678_100310529 3300005456 Unclassified 1343
25 Ga0070681_10013575 3300005458 Bacteria 8103
26 Ga0070681_10032771 3300005458 Bacteria 5217
27 Ga0070681_10177158 3300005458 Unclassified 2054
28 Ga0070681_10390206 3300005458 Bacteria 1303
29 Ga0068867_100008615 3300005459 Bacteria 7201
30 Ga0070698_100195069 3300005471 Bacteria 1962
31 Ga0070679_100176322 3300005530 Bacteria 2110
32 Ga0070684_100087317 3300005535 Bacteria 2769
33 Ga0070684_100124718 3300005535 Bacteria 2319
34 Ga0070684_100178219 3300005535 Unclassified 1932
35 Ga0068853_100097137 3300005539 Bacteria 2600
36 Ga0070672_100236365 3300005543 Bacteria 1536
37 Ga0070686_100005437 3300005544 Bacteria 7050
38 Ga0070686_100216048 3300005544 Unclassified 1383
39 Ga0068855_100039926 3300005563 Bacteria 5571
40 Ga0068855_100135520 3300005563 Bacteria 2810
41 Ga0070664_100040054 3300005564 Bacteria 3949
42 Ga0068857_100055518 3300005577 Bacteria 3515
43 Ga0068854_100030787 3300005578 Bacteria 3724
44 Ga0068856_100032631 3300005614 Bacteria 5099
45 Ga0068856_100119152 3300005614 Unclassified 2640
46 Ga0068859_100013611 3300005617 Bacteria 8156
47 Ga0068864_100019042 3300005618 Bacteria 5738
48 Ga0068864_100263224 3300005618 Unclassified 1605
49 Ga0068866_10088830 3300005718 Bacteria 1678
50 Ga0068863_100144885 3300005841 Bacteria 2271
51 Ga0068858_100094707 3300005842 Archaea 2782
52 Ga0068858_100170769 3300005842 Bacteria 2050
53 Ga0068858_100253798 3300005842 Bacteria 1671
54 Ga0068860_100186725 3300005843 Unclassified 2005
55 Ga0070717_10064347 3300006028 Unclassified 3046
56 Ga0097621_100056618 3300006237 Bacteria 3203
57 Ga0097621_100092962 3300006237 Bacteria 2527
58 Ga0097621_100433763 3300006237 Unclassified 1181
59 Ga0068871_100019085 3300006358 Bacteria 5228
60 Ga0068871_100083286 3300006358 Bacteria 2653
61 Ga0075433_10173236 3300006852 Bacteria 1920
62 Ga0075434_100152201 3300006871 Bacteria 2334
63 Ga0097620_100013611 3300006931 Bacteria 8156
64 Ga0075435_100068563 3300007076 Bacteria 2890
65 Ga0105240_10015541 3300009093 Bacteria 10347
66 Ga0105240_10079305 3300009093 Bacteria 4041
67 Ga0111539_10029638 3300009094 Bacteria 6661
68 Ga0111539_10044941 3300009094 Bacteria 5289
69 Ga0111539_10070105 3300009094 Unclassified 4138
70 Ga0105245_10147607 3300009098 Bacteria 2220
71 Ga0105247_10045297 3300009101 Bacteria 2698
72 Ga0114129_10074647 3300009147 Unclassified 4724
73 Ga0114129_10092326 3300009147 Bacteria 4194
74 Ga0105241_10011322 3300009174 Bacteria 6539
75 Ga0105241_10076055 3300009174 Bacteria 2617
76 Ga0105241_10140480 3300009174 Bacteria 1966
77 Ga0105242_10126007 3300009176 Unclassified 2204
78 Ga0105242_10358702 3300009176 Unclassified 1349
79 Ga0105248_10015982 3300009177 Bacteria 8263
80 Ga0105248_10037467 3300009177 Bacteria 5426
81 Ga0105248_10062504 3300009177 Bacteria 4181
82 Ga0105248_10170271 3300009177 Bacteria 2454
83 Ga0105248_10533106 3300009177 Unclassified 1324
84 Ga0105237_10283448 3300009545 Bacteria 1659
85 Ga0105238_10003840 3300009551 Bacteria 14925
86 Ga0105238_10027087 3300009551 Bacteria 5842
87 Ga0105238_10185066 3300009551 Bacteria 2059
88 Ga0105249_10025531 3300009553 Bacteria 5320
89 Ga0105249_10649546 3300009553 Bacteria 1112
90 Ga0105239_10029153 3300010375 Bacteria 6067
91 Ga0105239_10040224 3300010375 Bacteria 5123
92 Ga0105246_10011999 3300011119 Bacteria 5396
93 Ga0105246_10039605 3300011119 Bacteria 3176
94 Ga0157370_10001412 3300013104 Bacteria 29803
95 Ga0157369_10002676 3300013105 Bacteria 21247
96 Ga0157369_10124001 3300013105 Unclassified 2740
97 Ga0157374_10012262 3300013296 Bacteria 7453
98 Ga0163162_10295330 3300013306 Unclassified 1752
99 Ga0163162_10413970 3300013306 Bacteria 1480
100 Ga0157372_10032654 3300013307 Bacteria 5709
101 Ga0157375_10056599 3300013308 Bacteria 3873
102 Ga0157375_10112033 3300013308 Bacteria 2828
103 Ga0157375_10175627 3300013308 Bacteria 2291
104 Ga0157375_10345429 3300013308 Bacteria 1654
105 Ga0163163_10000009 3300014325 Bacteria 268331
106 Ga0163163_10002917 3300014325 Bacteria 14460
107 Ga0163163_10298823 3300014325 Bacteria 1662
108 Ga0157379_10070981 3300014968 Unclassified 3116
109 Ga0157379_10137275 3300014968 Bacteria 2203
110 Ga0157376_10008455 3300014969 Bacteria 7431
111 Ga0157376_10174545 3300014969 Unclassified 1959
112 Ga0157376_10278435 3300014969 Bacteria 1574
113 Ga0207642_10082590 3300025899 Bacteria 1565
114 Ga0207710_10110173 3300025900 Bacteria 1307
115 Ga0207699_10000002 3300025906 Bacteria 662194
116 Ga0207645_10057635 3300025907 Unclassified 2480
117 Ga0207654_10064779 3300025911 Bacteria 2150
118 Ga0207707_10054979 3300025912 Bacteria 3464
119 Ga0207707_10072727 3300025912 Bacteria 2997
120 Ga0207707_10370967 3300025912 Bacteria 1231
121 Ga0207695_10035503 3300025913 Bacteria 5405
122 Ga0207695_10078697 3300025913 Bacteria 3344
123 Ga0207695_10148794 3300025913 Unclassified 2282
124 Ga0207695_10279793 3300025913 Bacteria 1562
125 Ga0207663_10115208 3300025916 Bacteria 1831
126 Ga0207649_10053003 3300025920 Bacteria 2519
127 Ga0207694_10015413 3300025924 Bacteria 5764
128 Ga0207694_10055262 3300025924 Bacteria 3082
129 Ga0207694_10126966 3300025924 Bacteria 2041
130 Ga0207650_10114303 3300025925 Bacteria 2094
131 Ga0207687_10000329 3300025927 Bacteria 32111
132 Ga0207687_10009236 3300025927 Bacteria 6451
133 Ga0207644_10148931 3300025931 Bacteria 1809
134 Ga0207690_10101113 3300025932 Unclassified 2059
135 Ga0207706_10067838 3300025933 Bacteria 3139
136 Ga0207686_10020244 3300025934 Bacteria 3798
137 Ga0207686_10045989 3300025934 Bacteria 2689
138 Ga0207670_10019177 3300025936 Bacteria 4171
139 Ga0207670_10118463 3300025936 Bacteria 1920
140 Ga0207704_10229505 3300025938 Unclassified 1379
141 Ga0207691_10059074 3300025940 Unclassified 3488
142 Ga0207711_10001748 3300025941 Bacteria 19926
143 Ga0207711_10012844 3300025941 Bacteria 6958
144 Ga0207711_10021998 3300025941 Bacteria 5328
145 Ga0207711_10130803 3300025941 Unclassified 2250
146 Ga0207711_10426821 3300025941 Unclassified 1233
147 Ga0207661_10093853 3300025944 Unclassified 2505
148 Ga0207679_10265682 3300025945 Unclassified 1465
149 Ga0207667_10108240 3300025949 Bacteria 2868
150 Ga0207667_10153624 3300025949 Unclassified 2368
151 Ga0207651_10015592 3300025960 Bacteria 4422
152 Ga0207658_10044074 3300025986 Bacteria 3247
153 Ga0207677_10014439 3300026023 Bacteria 4613
154 Ga0207677_10116855 3300026023 Bacteria 1998
155 Ga0207703_10049254 3300026035 Bacteria 3405
156 Ga0207703_10089916 3300026035 Bacteria 2579
157 Ga0207639_10070804 3300026041 Unclassified 2725
158 Ga0207639_10119857 3300026041 Bacteria 2160
159 Ga0207702_10112134 3300026078 Unclassified 2427
160 Ga0207641_10069946 3300026088 Bacteria 3015
161 Ga0207648_10005535 3300026089 Bacteria 12719
162 Ga0207676_10064654 3300026095 Bacteria 2910
163 Ga0207683_10336697 3300026121 Bacteria 1383
164 Ga0207698_10040980 3300026142 Unclassified 3447
165 Ga0207698_10073990 3300026142 Bacteria 2715
166 Ga0265336_10012029 3300028666 Bacteria 2922
167 Ga0265320_10001507 3300031240 Bacteria 16966
168 Ga0265316_10005351 3300031344 Bacteria 12499
169 Ga0265316_10006078 3300031344 Bacteria 11585
170 Ga0265316_10015073 3300031344 Bacteria 6774
171 Ga0265316_10025299 3300031344 Bacteria 4956
172 Ga0265316_10069021 3300031344 Bacteria 2728
173 Ga0265316_10106412 3300031344 Bacteria 2127
174 Ga0265316_10114380 3300031344 Unclassified 2041
175 Ga0265316_10225741 3300031344 Bacteria 1381
176 Ga0265314_10006070 3300031711 Bacteria 10738
177 Ga0265342_10018702 3300031712 Bacteria 4480
178 Ga0373926_0009930 3300035083 Bacteria 3186
179 Ga0373923_0008805 3300035111 Bacteria 3619
180 Ga0373953_0113904 3300035117 Unclassified 1145
181 Ga0373954_0032329 3300035118 Bacteria 2418
182 Ga0373943_0123524 3300035170 Unclassified 1378
183 Ga0373927_0003822 3300035695 Bacteria 10687
184 Ga0373927_0005860 3300035695 Bacteria 8426
185 Ga0373927_0218886 3300035695 Unclassified 1251
186 Ga0373933_0087974 3300035724 Unclassified 1914
187 Ga0373947_0033695 3300035725 Bacteria 3026
188 Ga0373937_0038777 3300036401 Bacteria 4341
189 Ga0373937_0235434 3300036401 Unclassified 1725
190 Ga0373937_0423852 3300036401 Unclassified 1263
191 Ga0373925_0019353 3300037068 Bacteria 4952
192 Ga0373925_0164160 3300037068 Bacteria 1751
193 Ga0436364_0987195 3300037853 Bacteria 1448
194 Ga0436360_0053449 3300039438 Unclassified 1163
195 Ga0436363_1581730 3300039450 Unclassified 1695
196 Ga0466959_0210538 3300045049 Bacteria 1351
197 Ga0451576_0099236 3300045051 Bacteria 3029
198 Ga0495592_0015517 3300046454 Bacteria 5780
199 Ga0495592_0040586 3300046454 Unclassified 3492
200 Ga0495603_0027361 3300046455 Bacteria 3442
201 Ga0495651_0026310 3300046462 Bacteria 4532
202 Ga0495651_0197905 3300046462 Unclassified 1409
203 Ga0495580_0021203 3300046472 Unclassified 4797
204 Ga0495582_0010244 3300046473 Bacteria 5162
205 Ga0495582_0079036 3300046473 Bacteria 1825
206 Ga0495639_0004809 3300046475 Bacteria 5807
207 Ga0495662_0001414 3300046476 Bacteria 11891
208 Ga0495662_0042624 3300046476 Bacteria 2190
209 Ga0495664_0011280 3300046477 Bacteria 5035
210 Ga0495664_0039958 3300046477 Bacteria 2772
211 Ga0495664_0057157 3300046477 Bacteria 2320
212 Ga0495664_0237980 3300046477 Unclassified 1101
213 Ga0495594_0091920 3300046499 Bacteria 1701
214 Ga0495608_0041886 3300046511 Bacteria 3063
215 Ga0495618_0045700 3300046514 Bacteria 2763
216 Ga0495628_0267490 3300046516 Bacteria 1272
217 Ga0495666_0112577 3300046526 Bacteria 1277
218 Ga0495652_0042736 3300046529 Bacteria 3907
219 Ga0495665_0001883 3300046531 Bacteria 11334
220 Ga0495640_0025718 3300046533 Bacteria 4264
221 Ga0495587_0009189 3300046536 Bacteria 6343
222 Ga0495621_0033549 3300046539 Bacteria 1770
223 Ga0495645_0000916 3300046543 Bacteria 20098
224 Ga0495645_0045723 3300046543 Bacteria 3194
225 Ga0495645_0140367 3300046543 Unclassified 1686
226 Ga0495645_0183213 3300046543 Unclassified 1433
227 Ga0495667_0151172 3300046559 Bacteria 1495
228 Ga0495634_0030513 3300046642 Bacteria 3722
229 Ga0495634_0124532 3300046642 Unclassified 1648
230 Ga0495635_0006518 3300046663 Bacteria 8143
231 Ga0495635_0033394 3300046663 Bacteria 3569
232 Ga0495635_0170709 3300046663 Bacteria 1479
233 Ga0495599_0000566 3300046678 Bacteria 21148
234 Ga0495623_0018870 3300046679 Bacteria 4453
235 Ga0495646_0146704 3300046680 Bacteria 1315
236 Ga0495613_0192844 3300046689 Unclassified 1439
237 Ga0495581_0002611 3300047315 Bacteria 10247
238 Ga0495604_0026732 3300047317 Bacteria 4593
239 Ga0495604_0032023 3300047317 Unclassified 4168
240 Ga0495604_0048499 3300047317 Bacteria 3303
241 Ga0495604_0169802 3300047317 Bacteria 1535
242 Ga0495676_0009463 3300047321 Bacteria 8874
243 Ga0495676_0198111 3300047321 Unclassified 1397
244 Ga0495675_0006276 3300047444 Bacteria 7276
245 Ga0495675_0087028 3300047444 Unclassified 1963
246 Ga0495684_0140548 3300047471 Unclassified 1810
247 Ga0495602_0001067 3300048088 Bacteria 26884
248 Ga0496101_0081633 3300048904 Bacteria 2392
249 Ga0496102_0050822 3300048905 Bacteria 3775
250 Ga0496104_0145911 3300048907 Unclassified 2272
251 Ga0496106_0046986 3300048909 Bacteria 3247
252 Ga0496106_0071618 3300048909 Bacteria 2650
253 Ga0496108_0005747 3300048911 Bacteria 10046
254 Ga0496109_0002979 3300048912 Bacteria 14159
255 Ga0496110_0022146 3300048913 Bacteria 5392
256 Ga0496110_0142449 3300048913 Bacteria 2167
257 Ga0496112_0008862 3300048915 Bacteria 9027
258 Ga0496112_0057864 3300048915 Bacteria 3817
259 Ga0496112_0252760 3300048915 Bacteria 1713
260 Ga0496113_0091048 3300048916 Bacteria 2350
261 Ga0496115_0120270 3300048918 Bacteria 2161
262 Ga0496115_0194367 3300048918 Bacteria 1676
263 Ga0501032_0004523 3300049569 Bacteria 10460
264 Ga0501033_0027365 3300049570 Bacteria 4286
265 Ga0501034_0010960 3300049571 Bacteria 9415
266 Ga0501036_0012859 3300049572 Bacteria 6948
267 Ga0501037_0009270 3300049573 Bacteria 7216
268 Ga0501038_0006998 3300049574 Bacteria 10418
269 Ga0501043_0020462 3300049579 Bacteria 5191
270 Ga0501046_0003935 3300049580 Bacteria 13580
271 Ga0501047_0004875 3300049581 Bacteria 12604
272 Ga0501048_0022133 3300049582 Bacteria 4651
273 Ga0501068_0005244 3300049584 Bacteria 7075
274 Ga0501069_0001169 3300049585 Bacteria 12726
275 Ga0501072_0005636 3300049588 Bacteria 9531
276 Ga0501073_0005824 3300049589 Bacteria 9205
277 Ga0501074_0013428 3300049590 Bacteria 5954
278 Ga0501076_0109224 3300049592 Bacteria 2235
279 Ga0501079_0004202 3300049741 Bacteria 10675
280 Ga0501080_0000018 3300049742 Bacteria 95463
281 Ga0501045_0185701 3300049824 Bacteria 1549
282 nmdc:mga05p37_350_c1 3300050507 Bacteria 46341
283 nmdc:mga06r32_131354_c1 3300050510 Bacteria 2476
284 nmdc:mga08y16_218559_c1 3300050511 Bacteria 1973
285 nmdc:mga08y16_27617_c1 3300050511 Bacteria 5979
286 nmdc:mga0rr50_75952_c1 3300050513 Bacteria 2577
287 nmdc:mga0rr50_9647_c1 3300050513 Bacteria 6084
288 nmdc:mga0a205_10701_c1 3300050515 Bacteria 8435
289 Ga0501084_0024160 3300054114 Bacteria 5069
290 Ga0501082_0024804 3300060353 Bacteria 5168
291 Ga0495580_0061769
292 Ga0065715_10200796
293 Ga0070676_10037004
294 Ga0070683_100078314
295 Ga0070683_100121038
296 Ga0070683_100460960
297 Ga0070690_100063800
298 Ga0070666_10086511
299 Ga0070689_100032462
300 Ga0070661_100026543
301 Ga0070671_100045200
302 Ga0070671_100110799
303 Ga0070671_100144189
304 Ga0070673_100001880
305 Ga0070688_100116417
306 Ga0070659_100157555
307 Ga0070667_100057158
308 Ga0070709_10000033
309 Ga0070713_100150270
310 Ga0070701_10039351
311 Ga0070711_100049400
312 Ga0070708_100073122
313 Ga0070708_100075359
314 Ga0070678_100310529
315 Ga0070681_10013575
316 Ga0070681_10032771
317 Ga0070681_10177158
318 Ga0070681_10390206
319 Ga0068867_100008615
320 Ga0070698_100195069
321 Ga0070679_100176322
322 Ga0070684_100087317
323 Ga0070684_100124718
324 Ga0070684_100178219
325 Ga0068853_100097137
326 Ga0070672_100236365
327 Ga0070686_100005437
328 Ga0070686_100216048
329 Ga0068855_100039926
330 Ga0068855_100135520
331 Ga0070664_100040054
332 Ga0068857_100055518
333 Ga0068854_100030787
334 Ga0068856_100032631
335 Ga0068856_100119152
336 Ga0068859_100013611
337 Ga0068864_100019042
338 Ga0068864_100263224
339 Ga0068866_10088830
340 Ga0068863_100144885
341 Ga0068858_100094707
342 Ga0068858_100170769
343 Ga0068858_100253798
344 Ga0068860_100186725
345 Ga0070717_10064347
346 Ga0097621_100056618
347 Ga0097621_100092962
348 Ga0097621_100433763
349 Ga0068871_100019085
350 Ga0068871_100083286
351 Ga0075433_10173236
352 Ga0075434_100152201
353 Ga0097620_100013611
354 Ga0075435_100068563
355 Ga0105240_10015541
356 Ga0105240_10079305
357 Ga0111539_10029638
358 Ga0111539_10044941
359 Ga0111539_10070105
360 Ga0105245_10147607
361 Ga0105247_10045297
362 Ga0114129_10074647
363 Ga0114129_10092326
364 Ga0105241_10011322
365 Ga0105241_10076055
366 Ga0105241_10140480
367 Ga0105242_10126007
368 Ga0105242_10358702
369 Ga0105248_10015982
370 Ga0105248_10037467
371 Ga0105248_10062504
372 Ga0105248_10170271
373 Ga0105248_10533106
374 Ga0105237_10283448
375 Ga0105238_10003840
376 Ga0105238_10027087
377 Ga0105238_10185066
378 Ga0105249_10025531
379 Ga0105249_10649546
380 Ga0105239_10029153
381 Ga0105239_10040224
382 Ga0105246_10011999
383 Ga0105246_10039605
384 Ga0157370_10001412
385 Ga0157369_10002676
386 Ga0157369_10124001
387 Ga0157374_10012262
388 Ga0163162_10295330
389 Ga0163162_10413970
390 Ga0157372_10032654
391 Ga0157375_10056599
392 Ga0157375_10112033
393 Ga0157375_10175627
394 Ga0157375_10345429
395 Ga0163163_10000009
396 Ga0163163_10002917
397 Ga0163163_10298823
398 Ga0157379_10070981
399 Ga0157379_10137275
400 Ga0157376_10008455
401 Ga0157376_10174545
402 Ga0157376_10278435
403 Ga0207642_10082590
404 Ga0207710_10110173
405 Ga0207699_10000002
406 Ga0207645_10057635
407 Ga0207654_10064779
408 Ga0207707_10054979
409 Ga0207707_10072727
410 Ga0207707_10370967
411 Ga0207695_10035503
412 Ga0207695_10078697
413 Ga0207695_10148794
414 Ga0207695_10279793
415 Ga0207663_10115208
416 Ga0207649_10053003
417 Ga0207694_10015413
418 Ga0207694_10055262
419 Ga0207694_10126966
420 Ga0207650_10114303
421 Ga0207687_10000329
422 Ga0207687_10009236
423 Ga0207644_10148931
424 Ga0207690_10101113
425 Ga0207706_10067838
426 Ga0207686_10020244
427 Ga0207686_10045989
428 Ga0207670_10019177
429 Ga0207670_10118463
430 Ga0207704_10229505
431 Ga0207691_10059074
432 Ga0207711_10001748
433 Ga0207711_10012844
434 Ga0207711_10021998
435 Ga0207711_10130803
436 Ga0207711_10426821
437 Ga0207661_10093853
438 Ga0207679_10265682
439 Ga0207667_10108240
440 Ga0207667_10153624
441 Ga0207651_10015592
442 Ga0207658_10044074
443 Ga0207677_10014439
444 Ga0207677_10116855
445 Ga0207703_10049254
446 Ga0207703_10089916
447 Ga0207639_10070804
448 Ga0207639_10119857
449 Ga0207702_10112134
450 Ga0207641_10069946
451 Ga0207648_10005535
452 Ga0207676_10064654
453 Ga0207683_10336697
454 Ga0207698_10040980
455 Ga0207698_10073990
456 Ga0265336_10012029
457 Ga0265320_10001507
458 Ga0265316_10005351
459 Ga0265316_10006078
460 Ga0265316_10015073
461 Ga0265316_10025299
462 Ga0265316_10069021
463 Ga0265316_10106412
464 Ga0265316_10114380
465 Ga0265316_10225741
466 Ga0265314_10006070
467 Ga0265342_10018702
468 Ga0373926_0009930
469 Ga0373923_0008805
470 Ga0373953_0113904
471 Ga0373954_0032329
472 Ga0373943_0123524
473 Ga0373927_0003822
474 Ga0373927_0005860
475 Ga0373927_0218886
476 Ga0373933_0087974
477 Ga0373947_0033695
478 Ga0373937_0038777
479 Ga0373937_0235434
480 Ga0373937_0423852
481 Ga0373925_0019353
482 Ga0373925_0164160
483 Ga0436364_0987195
484 Ga0436360_0053449
485 Ga0436363_1581730
486 Ga0466959_0210538
487 Ga0451576_0099236
488 Ga0495592_0015517
489 Ga0495592_0040586
490 Ga0495603_0027361
491 Ga0495651_0026310
492 Ga0495651_0197905
493 Ga0495580_0021203
494 Ga0495582_0010244
495 Ga0495582_0079036
496 Ga0495639_0004809
497 Ga0495662_0001414
498 Ga0495662_0042624
499 Ga0495664_0011280
500 Ga0495664_0039958
501 Ga0495664_0057157
502 Ga0495664_0237980
503 Ga0495594_0091920
504 Ga0495608_0041886
505 Ga0495618_0045700
506 Ga0495628_0267490
507 Ga0495666_0112577
508 Ga0495652_0042736
509 Ga0495665_0001883
510 Ga0495640_0025718
511 Ga0495587_0009189
512 Ga0495621_0033549
513 Ga0495645_0000916
514 Ga0495645_0045723
515 Ga0495645_0140367
516 Ga0495645_0183213
517 Ga0495667_0151172
518 Ga0495634_0030513
519 Ga0495634_0124532
520 Ga0495635_0006518
521 Ga0495635_0033394
522 Ga0495635_0170709
523 Ga0495599_0000566
524 Ga0495623_0018870
525 Ga0495646_0146704
526 Ga0495613_0192844
527 Ga0495581_0002611
528 Ga0495604_0026732
529 Ga0495604_0032023
530 Ga0495604_0048499
531 Ga0495604_0169802
532 Ga0495676_0009463
533 Ga0495676_0198111
534 Ga0495675_0006276
535 Ga0495675_0087028
536 Ga0495684_0140548
537 Ga0495602_0001067
538 Ga0496101_0081633
539 Ga0496102_0050822
540 Ga0496104_0145911
541 Ga0496106_0046986
542 Ga0496106_0071618
543 Ga0496108_0005747
544 Ga0496109_0002979
545 Ga0496110_0022146
546 Ga0496110_0142449
547 Ga0496112_0008862
548 Ga0496112_0057864
549 Ga0496112_0252760
550 Ga0496113_0091048
551 Ga0496115_0120270
552 Ga0496115_0194367
553 Ga0501032_0004523
554 Ga0501033_0027365
555 Ga0501034_0010960
556 Ga0501036_0012859
557 Ga0501037_0009270
558 Ga0501038_0006998
559 Ga0501043_0020462
560 Ga0501046_0003935
561 Ga0501047_0004875
562 Ga0501048_0022133
563 Ga0501068_0005244
564 Ga0501069_0001169
565 Ga0501072_0005636
566 Ga0501073_0005824
567 Ga0501074_0013428
568 Ga0501076_0109224
569 Ga0501079_0004202
570 Ga0501080_0000018
571 Ga0501045_0185701
572 nmdc:mga05p37_350_c1
573 nmdc:mga06r32_131354_c1
574 nmdc:mga08y16_218559_c1
575 nmdc:mga08y16_27617_c1
576 nmdc:mga0rr50_75952_c1
577 nmdc:mga0rr50_9647_c1
578 nmdc:mga0a205_10701_c1
579 Ga0501084_0024160
580 Ga0501082_0024804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mqf-assembly1.cif.gz_E cryo-em structure of a human spliceosome activated for step 2 of splicing (c* complex) 0.8589 24 224
6zqd-assembly1.cif.gz_JP cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state post-a1 0.8335 30 217
1fwx-assembly2.cif.gz_D crystal structure of nitrous oxide reductase from p. denitrificans 0.8329 33 241
8q9y-assembly1.cif.gz_B the structure of thiocyanate dehydrogenase from pelomicrobium methylotrophicum in complex with inhibitor thiourea at 1.10 a resolution 0.8304 34 194
7n61-assembly1.cif.gz_0B structure of c2 projections and mips 0.8278 22 312
ID Description Score Start End Superfamily
af_Q79FU2_202_331_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9109 61 182 2.40.10.500
af_Q9Y0T2_1042_1160_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8895 127 229 2.130.10.10
1l0qD01 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8885 33 240 2.130.10.10
af_A0A1D6JNW9_551_722_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8868 77 226 2.130.10.10
af_Q54GJ0_210_362_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.883 119 225 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V7ZUQ5-F1-model_v4 Uncharacterized protein 0.983 28 136
AF-A0A2V8SBZ9-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.9768 55 243
AF-A0A2V8TK33-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.9708 20 315
AF-A0A2V7IPK8-F1-model_v4 YVTN family beta-propeller domain-containing protein 0.9688 26 315
AF-A0A4Q3QQG3-F1-model_v4 deleted 0.967 21 142

Map