F389975

General Info

Members Datasets Scaffolds Average Seq Length
290 226 234 320

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0052485|Ga0495657_0052485_652_1665
Length 337
Sequence MPGSLANQEDKIGEAMFKWKKLGKVFTPQDVTDRAWLKEFAQAPATLIFDDFVRIYFSCRPPADTSGQYVSHSAYIDVDRADLFKIRRISERPVLELGGLGEFDQFGTYPISVARDGDIVRGYYAGWTRCESVPFNVGIGLALSTDEGRTFSKAGRGPVVPYSPDEPFVLSGPKIRRFGDTWYLFYIAGSKWIMADGRAEPVYKIRLAKSDDGVHWTKLNRNLIENVVEADEAQASPDVIFADGIYHMFFCYRYSTNYRGKEKGYRIGYASSDDLINWRRDDAKAGLTVSDTGWDDEMVSYPHVFELDGKTYMAYLGNQVGRNGFGLAVLDGKLGDA

Samples

Sample ID Description Type Environment
1 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
4 2643221591 Devosia sp. Root685 Isolate Unclassified
5 2718217927 Rhizobium sp. N324 Isolate Nodule
6 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
7 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
8 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
9 2718218423 Rhizobium sp. N941 Isolate Nodule
10 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
11 2721755809 Rhizobium sp. N541 Isolate Nodule
12 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
13 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
14 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
15 2838048938 Rhizobium pisi 27/80 Isolate Nodule
16 2838061910 Rhizobium phaseoli L15 Isolate Nodule
17 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
18 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
19 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
20 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
21 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
22 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
23 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
24 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
25 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
26 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
27 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
28 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
29 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
30 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
31 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
32 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
33 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
34 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
35 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
36 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
37 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
38 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
39 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
40 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
41 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
42 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
43 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
44 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
45 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
46 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
47 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
48 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
49 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
50 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
212 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
218 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
219 8005275841 Rhizobium sp. N4311 Isolate Nodule
220 8005395548 Rhizobium sp. R339 Isolate Nodule
221 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
222 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
223 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
224 8018176218 Rhizobium sp. N122 Isolate Nodule
225 8024501048 Rhizobium sp. H4 Isolate Nodule
226 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.69
Metatranscriptomes 0
Isolates 19.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 15.17
Rhizoplane 5.17
Rhizosphere 66.21
Stem 0
Stem Tuber 0.69
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002485 3300003215 Bacteria 10583
2 rootH2_10022911 3300003320 Bacteria 27500
3 rootL2_10097184 3300003322 Bacteria 6662
4 Ga0055528_1002119 3300003790 Bacteria 10953
5 Ga0065714_10097250 3300005288 Bacteria 1741
6 Ga0065714_10120863 3300005288 Bacteria 1350
7 Ga0065704_10097974 3300005289 Bacteria 2371
8 Ga0065712_10005240 3300005290 Bacteria 4288
9 Ga0070658_10000427 3300005327 Bacteria 36514
10 Ga0070658_10006490 3300005327 Bacteria 9482
11 Ga0070658_10025207 3300005327 Unclassified 4767
12 Ga0070666_10001834 3300005335 Bacteria 12941
13 Ga0070666_10028004 3300005335 Bacteria 3695
14 Ga0068868_100001999 3300005338 Bacteria 14029
15 Ga0070660_100273432 3300005339 Bacteria 1381
16 Ga0070689_100029808 3300005340 Bacteria 4135
17 Ga0070689_100086215 3300005340 Bacteria 2470
18 Ga0070669_100047295 3300005353 Bacteria 3138
19 Ga0070671_100000001 3300005355 Bacteria 1228151
20 Ga0070671_100006127 3300005355 Bacteria 9578
21 Ga0070673_100001135 3300005364 Bacteria 15323
22 Ga0070688_100003007 3300005365 Bacteria 8598
23 Ga0070659_100036364 3300005366 Bacteria 3839
24 Ga0070659_100041743 3300005366 Bacteria 3587
25 Ga0070667_100030603 3300005367 Bacteria 4489
26 Ga0070667_100044700 3300005367 Bacteria 3720
27 Ga0070678_100135475 3300005456 Bacteria 1963
28 Ga0070685_10004994 3300005466 Bacteria 6716
29 Ga0070707_100261051 3300005468 Unclassified 1685
30 Ga0070697_100040020 3300005536 Bacteria 3791
31 Ga0068853_100004714 3300005539 Bacteria 10582
32 Ga0068853_100039020 3300005539 Bacteria 4049
33 Ga0068853_100205907 3300005539 Bacteria 1792
34 Ga0068853_100311075 3300005539 Bacteria 1458
35 Ga0070672_100053776 3300005543 Bacteria 3149
36 Ga0070686_100058344 3300005544 Bacteria 2483
37 Ga0070665_100000191 3300005548 Bacteria 108807
38 Ga0070665_100073513 3300005548 Bacteria 3424
39 Ga0068855_100052223 3300005563 Bacteria 4813
40 Ga0068855_100074327 3300005563 Bacteria 3948
41 Ga0070664_100258704 3300005564 Bacteria 1566
42 Ga0068857_100336907 3300005577 Bacteria 1395
43 Ga0068856_100044344 3300005614 Bacteria 4377
44 Ga0068856_100357415 3300005614 Bacteria 1479
45 Ga0068859_100000752 3300005617 Bacteria 32637
46 Ga0068859_100038942 3300005617 Bacteria 4768
47 Ga0068864_100001479 3300005618 Bacteria 19364
48 Ga0068870_10091764 3300005840 Bacteria 1700
49 Ga0068858_100003128 3300005842 Bacteria 16565
50 Ga0068860_100005794 3300005843 Bacteria 12443
51 Ga0075363_100060059 3300006048 Bacteria 2046
52 Ga0070712_100274847 3300006175 Bacteria 1355
53 Ga0097621_100013394 3300006237 Bacteria 6113
54 Ga0068871_100002423 3300006358 Bacteria 12736
55 Ga0075434_100220595 3300006871 Bacteria 1916
56 Ga0075429_100372947 3300006880 Bacteria 1249
57 Ga0097620_100000752 3300006931 Bacteria 32637
58 Ga0097620_100038942 3300006931 Bacteria 4768
59 Ga0105244_10004943 3300009036 Bacteria 9009
60 Ga0105250_10005778 3300009092 Bacteria 5506
61 Ga0105250_10015292 3300009092 Bacteria 3143
62 Ga0105240_10013204 3300009093 Bacteria 11364
63 Ga0105240_10054529 3300009093 Bacteria 5010
64 Ga0105245_10005949 3300009098 Bacteria 10720
65 Ga0105247_10000813 3300009101 Bacteria 23797
66 Ga0105247_10032030 3300009101 Bacteria 3193
67 Ga0114129_10039716 3300009147 Bacteria 6636
68 Ga0105241_10233309 3300009174 Bacteria 1552
69 Ga0105242_10010848 3300009176 Bacteria 6998
70 Ga0105242_10123242 3300009176 Bacteria 2228
71 Ga0105242_10454179 3300009176 Bacteria 1209
72 Ga0105248_10010760 3300009177 Bacteria 10100
73 Ga0105248_10013352 3300009177 Bacteria 9040
74 Ga0105237_10018027 3300009545 Bacteria 7314
75 Ga0105237_10056227 3300009545 Bacteria 3939
76 Ga0105239_10001689 3300010375 Bacteria 29111
77 Ga0105239_10260193 3300010375 Bacteria 1950
78 Ga0105246_10013581 3300011119 Bacteria 5109
79 Ga0157371_10014810 3300013102 Bacteria 5870
80 Ga0157371_10080426 3300013102 Bacteria 2308
81 Ga0157370_10008545 3300013104 Bacteria 11036
82 Ga0157369_10084073 3300013105 Bacteria 3403
83 Ga0157374_10001973 3300013296 Bacteria 17209
84 Ga0157378_10004445 3300013297 Bacteria 12331
85 Ga0157378_10206304 3300013297 Unclassified 1861
86 Ga0163162_10000585 3300013306 Bacteria 33759
87 Ga0163162_10002465 3300013306 Bacteria 17469
88 Ga0157375_10012600 3300013308 Bacteria 7504
89 Ga0157375_10091621 3300013308 Bacteria 3102
90 Ga0157375_10332690 3300013308 Bacteria 1684
91 Ga0163163_10000541 3300014325 Bacteria 33456
92 Ga0157380_10396945 3300014326 Bacteria 1307
93 Ga0157377_10010413 3300014745 Bacteria 4599
94 Ga0157379_10000597 3300014968 Bacteria 29148
95 Ga0157376_10002086 3300014969 Bacteria 13438
96 Ga0213872_10000063 3300021361 Bacteria 97755
97 Ga0209129_1005065 3300025258 Bacteria 4838
98 Ga0209673_1002354 3300025273 Bacteria 13319
99 Ga0209758_1002328 3300025297 Bacteria 19630
100 Ga0209050_1000934 3300025298 Bacteria 38215
101 Ga0209050_1003662 3300025298 Bacteria 11100
102 Ga0209050_1015038 3300025298 Bacteria 3284
103 Ga0209256_1013915 3300025299 Bacteria 2945
104 Ga0209256_1031776 3300025299 Unclassified 1439
105 Ga0209051_1006408 3300025303 Bacteria 6634
106 Ga0209257_1000021 3300025304 Bacteria 771986
107 Ga0207696_1002629 3300025711 Bacteria 8689
108 Ga0207655_1003666 3300025728 Bacteria 11321
109 Ga0207710_10021934 3300025900 Bacteria 2739
110 Ga0207680_10000531 3300025903 Bacteria 18126
111 Ga0207680_10060901 3300025903 Bacteria 2300
112 Ga0207647_10000410 3300025904 Bacteria 35247
113 Ga0207643_10026060 3300025908 Bacteria 3235
114 Ga0207643_10154159 3300025908 Bacteria 1379
115 Ga0207705_10000057 3300025909 Bacteria 157369
116 Ga0207705_10019851 3300025909 Unclassified 4807
117 Ga0207695_10029730 3300025913 Bacteria 6029
118 Ga0207671_10132040 3300025914 Bacteria 1917
119 Ga0207671_10153250 3300025914 Unclassified 1781
120 Ga0207681_10007422 3300025923 Bacteria 6714
121 Ga0207687_10000968 3300025927 Bacteria 19507
122 Ga0207644_10000001 3300025931 Bacteria 1243214
123 Ga0207644_10004427 3300025931 Bacteria 9119
124 Ga0207690_10004780 3300025932 Bacteria 7988
125 Ga0207686_10033745 3300025934 Bacteria 3057
126 Ga0207686_10068223 3300025934 Bacteria 2278
127 Ga0207686_10173937 3300025934 Bacteria 1521
128 Ga0207670_10008880 3300025936 Bacteria 5697
129 Ga0207670_10039327 3300025936 Bacteria 3097
130 Ga0207665_10119146 3300025939 Bacteria 1863
131 Ga0207691_10097850 3300025940 Bacteria 2622
132 Ga0207711_10000970 3300025941 Bacteria 27457
133 Ga0207667_10070624 3300025949 Bacteria 3634
134 Ga0207667_10093850 3300025949 Bacteria 3099
135 Ga0207651_10011638 3300025960 Bacteria 4933
136 Ga0207651_10331373 3300025960 Bacteria 1276
137 Ga0207658_10029536 3300025986 Bacteria 3873
138 Ga0207677_10000206 3300026023 Bacteria 47813
139 Ga0207703_10001244 3300026035 Bacteria 23862
140 Ga0207639_10003427 3300026041 Bacteria 10664
141 Ga0207702_10088545 3300026078 Bacteria 2705
142 Ga0207702_10249297 3300026078 Bacteria 1667
143 Ga0207676_10000386 3300026095 Bacteria 37594
144 Ga0207674_10326759 3300026116 Bacteria 1483
145 Ga0207683_10133075 3300026121 Bacteria 2237
146 Ga0268266_10001432 3300028379 Bacteria 28461
147 Ga0268266_10011412 3300028379 Bacteria 7726
148 Ga0268266_10053925 3300028379 Bacteria 3455
149 Ga0268264_10001587 3300028381 Bacteria 21048
150 Ga0265338_10001525 3300028800 Bacteria 37363
151 Ga0265338_10036570 3300028800 Bacteria 4696
152 Ga0265331_10009181 3300031250 Bacteria 5576
153 Ga0307405_10320767 3300031731 Bacteria 1183
154 Ga0373954_0002282 3300035118 Bacteria 7988
155 Ga0373933_0084202 3300035724 Bacteria 1954
156 Ga0373947_0020648 3300035725 Bacteria 3805
157 Ga0373937_0074707 3300036401 Bacteria 3128
158 Ga0373925_0024109 3300037068 Bacteria 4441
159 Ga0436361_0811061 3300039447 Bacteria 135576
160 Ga0439452_000031 3300042010 Bacteria 196691
161 Ga0451577_0000465 3300042876 Bacteria 70232
162 Ga0451577_0182398 3300042876 Unclassified 1893
163 Ga0451577_0229436 3300042876 Bacteria 1679
164 Ga0453684_0001383 3300044712 Bacteria 70232
165 Ga0453684_0004611 3300044712 Bacteria 28699
166 Ga0453684_0023286 3300044712 Bacteria 9133
167 Ga0453684_0028773 3300044712 Bacteria 7912
168 Ga0453684_0114818 3300044712 Bacteria 3264
169 Ga0453684_0632759 3300044712 Bacteria 1169
170 Ga0451576_0442446 3300045051 Bacteria 1364
171 Ga0466967_0330604 3300045976 Bacteria 1472
172 Ga0495651_0192530 3300046462 Bacteria 1434
173 Ga0495605_0052967 3300046474 Bacteria 1970
174 Ga0495639_0009222 3300046475 Bacteria 4229
175 Ga0495584_0000511 3300046491 Bacteria 26555
176 Ga0495584_0038835 3300046491 Bacteria 2406
177 Ga0495585_0004565 3300046492 Bacteria 8956
178 Ga0495585_0006751 3300046492 Bacteria 7084
179 Ga0495607_0104262 3300046501 Bacteria 1513
180 Ga0495610_0011551 3300046512 Bacteria 5390
181 Ga0495616_0016554 3300046513 Bacteria 4078
182 Ga0495620_0040203 3300046515 Bacteria 2060
183 Ga0495643_0006006 3300046522 Bacteria 8099
184 Ga0495642_0085654 3300046528 Bacteria 1330
185 Ga0495597_0000834 3300046542 Bacteria 24225
186 Ga0495597_0040053 3300046542 Bacteria 2095
187 Ga0495622_0002744 3300046557 Bacteria 8426
188 Ga0495633_0002543 3300046558 Bacteria 12798
189 Ga0495611_0002210 3300046648 Bacteria 9045
190 Ga0495625_0064380 3300046660 Bacteria 2586
191 Ga0495661_0007280 3300046665 Bacteria 7714
192 Ga0495588_0001986 3300046674 Bacteria 8748
193 Ga0495588_0025898 3300046674 Bacteria 2926
194 Ga0495657_0052485 3300046675 Bacteria 2733
195 Ga0495658_0137043 3300046683 Bacteria 1494
196 Ga0495670_0017136 3300046691 Bacteria 3563
197 Ga0495649_0022586 3300046694 Bacteria 3520
198 Ga0495600_0006235 3300046809 Bacteria 7238
199 Ga0495676_0000093 3300047321 Bacteria 66312
200 Ga0495626_0040030 3300048091 Bacteria 2215
201 Ga0496100_0003277 3300048903 Bacteria 8413
202 Ga0496101_0006948 3300048904 Bacteria 7313
203 Ga0496102_0001727 3300048905 Bacteria 19121
204 Ga0496103_0000572 3300048906 Bacteria 29210
205 Ga0496103_0008681 3300048906 Bacteria 6034
206 Ga0496104_0002691 3300048907 Bacteria 15306
207 Ga0496104_0145860 3300048907 Bacteria 2273
208 Ga0496105_0005455 3300048908 Bacteria 9649
209 Ga0496106_0219166 3300048909 Bacteria 1517
210 Ga0496107_0024196 3300048910 Bacteria 4296
211 Ga0496109_0041663 3300048912 Bacteria 4159
212 Ga0496109_0127856 3300048912 Bacteria 2370
213 Ga0496110_0148488 3300048913 Bacteria 2121
214 Ga0496111_0011447 3300048914 Bacteria 5975
215 Ga0496112_0001534 3300048915 Bacteria 17824
216 Ga0496116_0136106 3300048919 Bacteria 1391
217 Ga0496117_0032812 3300048920 Bacteria 3938
218 Ga0496121_0005975 3300048924 Bacteria 15379
219 Ga0496121_0011434 3300048924 Bacteria 9856
220 Ga0496121_0148106 3300048924 Bacteria 1731
221 Ga0496124_0002043 3300048927 Bacteria 27439
222 Ga0496124_0014314 3300048927 Bacteria 7675
223 Ga0496126_0008482 3300048929 Bacteria 11078
224 Ga0496126_0131789 3300048929 Bacteria 2160
225 Ga0495682_0001416 3300049460 Bacteria 13012
226 Ga0501070_0035058 3300049586 Bacteria 4194
227 Ga0500578_0012282 3300053086 Bacteria 5532
228 Ga0500569_000485 3300053109 Bacteria 6577
229 Ga0500658_0034474 3300053134 Bacteria 1998
230 Ga0500559_0000584 3300053136 Bacteria 25005
231 Ga0500586_023657 3300053145 Bacteria 1962
232 Ga0500616_0003150 3300053153 Bacteria 12876
233 Ga0500633_0025326 3300053160 Bacteria 1854
234 Ga0500611_000537 3300053727 Bacteria 3838

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10119146 Ga0207665_101191462 261
2 3300009092 Ga0105250_10005778 Ga0105250_100057784 283
3 3300025711 Ga0207696_1002629 Ga0207696_10026294 283
4 3300013297 Ga0157378_10206304 Ga0157378_102063042 295
5 3300003320 rootH2_10022911 rootH2_1002291115 296
6 3300044712 Ga0453684_0023286 Ga0453684_0023286_6714_7610 298
7 3300005290 Ga0065712_10005240 Ga0065712_100052405 299
8 3300005340 Ga0070689_100086215 Ga0070689_1000862153 299
9 3300005564 Ga0070664_100258704 Ga0070664_1002587041 299
10 3300005840 Ga0068870_10091764 Ga0068870_100917642 299
11 3300006871 Ga0075434_100220595 Ga0075434_1002205953 299
12 3300006880 Ga0075429_100372947 Ga0075429_1003729472 299
13 3300009147 Ga0114129_10039716 Ga0114129_100397167 299
14 3300014745 Ga0157377_10010413 Ga0157377_100104135 299
15 3300025908 Ga0207643_10026060 Ga0207643_100260604 299
16 3300025936 Ga0207670_10039327 Ga0207670_100393273 299
17 3300048912 Ga0496109_0127856 Ga0496109_0127856_1139_2038 299
18 3300005289 Ga0065704_10097974 Ga0065704_100979742 303
19 3300005548 Ga0070665_100000191 Ga0070665_10000019164 303
20 3300028379 Ga0268266_10001432 Ga0268266_1000143220 303
21 3300042010 Ga0439452_000031 Ga0439452_000031_49378_50340 303
22 3300048924 Ga0496121_0005975 Ga0496121_0005975_12085_13047 303
23 3300048929 Ga0496126_0008482 Ga0496126_0008482_7783_8745 303
24 3300046491 Ga0495584_0000511 Ga0495584_0000511_20718_21680 306
25 3300046492 Ga0495585_0004565 Ga0495585_0004565_1327_2289 306
26 3300046501 Ga0495607_0104262 Ga0495607_0104262_29_991 306
27 3300046513 Ga0495616_0016554 Ga0495616_0016554_1742_2704 306
28 3300046558 Ga0495633_0002543 Ga0495633_0002543_3788_4750 306
29 3300046648 Ga0495611_0002210 Ga0495611_0002210_1262_2224 306
30 3300046660 Ga0495625_0064380 Ga0495625_0064380_1068_2030 306
31 3300046665 Ga0495661_0007280 Ga0495661_0007280_5652_6614 306
32 3300046691 Ga0495670_0017136 Ga0495670_0017136_1563_2525 306
33 3300049460 Ga0495682_0001416 Ga0495682_0001416_10973_11935 306
34 3300005468 Ga0070707_100261051 Ga0070707_1002610512 308
35 iso_pu_bacteria 2643221591 2643964961 315
36 iso_pu_bacteria 2855195626 2855197034 315
37 iso_pu_bacteria 2574179768 2574431872 316
38 iso_pu_bacteria 2844425489 2844428081 316
39 iso_pu_bacteria 2861691609 2861695118 316
40 iso_pu_bacteria 2929160207 2929161118 316
41 3300014326 Ga0157380_10396945 Ga0157380_103969452 317
42 iso_pu_bacteria 2871272651 2871275660 317
43 iso_pu_bacteria 2891670763 2891671334 317
44 3300003322 rootL2_10097184 rootL2_100971842 318
45 3300009093 Ga0105240_10054529 Ga0105240_100545292 318
46 3300046462 Ga0495651_0192530 Ga0495651_0192530_365_1321 318
47 iso_pu_bacteria 2516653085 2517081509 318
48 iso_pu_bacteria 2585427526 2585526597 318
49 iso_pu_bacteria 2718217927 2719384946 318
50 iso_pu_bacteria 2718217997 2719664693 318
51 iso_pu_bacteria 2718218199 2720491113 318
52 iso_pu_bacteria 2718218232 2720612480 318
53 iso_pu_bacteria 2718218423 2721398666 318
54 iso_pu_bacteria 2721755556 2723026139 318
55 iso_pu_bacteria 2721755809 2724037479 318
56 iso_pu_bacteria 2721755823 2724109403 318
57 iso_pu_bacteria 2728369352 2730107075 318
58 iso_pu_bacteria 2838048938 2838049156 318
59 iso_pu_bacteria 2838061910 2838063398 318
60 iso_pu_bacteria 2838668709 2838670921 318
61 iso_pu_bacteria 2838686498 2838688528 318
62 iso_pu_bacteria 2838701080 2838703292 318
63 iso_pu_bacteria 2838729681 2838736895 318
64 iso_pu_bacteria 2838742623 2838746797 318
65 iso_pu_bacteria 2841851746 2841852269 318
66 iso_pu_bacteria 2842146304 2842147484 318
67 iso_pu_bacteria 2842156927 2842158657 318
68 iso_pu_bacteria 2842180545 2842182271 318
69 iso_pu_bacteria 2842192696 2842198023 318
70 iso_pu_bacteria 2842229732 2842234718 318
71 iso_pu_bacteria 2842243621 2842248449 318
72 iso_pu_bacteria 2842250916 2842252550 318
73 iso_pu_bacteria 2842257432 2842262378 318
74 iso_pu_bacteria 2842271015 2842272522 318
75 iso_pu_bacteria 2842304105 2842310905 318
76 iso_pu_bacteria 2842311132 2842314819 318
77 iso_pu_bacteria 2842317721 2842318578 318
78 iso_pu_bacteria 2842395702 2842398179 318
79 iso_pu_bacteria 2842447887 2842452616 318
80 iso_pu_bacteria 2842489311 2842493831 318
81 iso_pu_bacteria 2842495871 2842497213 318
82 iso_pu_bacteria 2844454524 2844461419 318
83 iso_pu_bacteria 2933570622 2933577400 318
84 iso_pu_bacteria 2933594066 2933597152 318
85 iso_pu_bacteria 8005275841 8005279667 318
86 iso_pu_bacteria 8005395548 8005400299 318
87 iso_pu_bacteria 8005430974 8005437155 318
88 iso_pu_bacteria 8005695170 8005698702 318
89 iso_pu_bacteria 8018176218 8018182585 318
90 iso_pu_bacteria 8024501048 8024503178 318
91 iso_pu_bacteria 8056382006 8056384672 318
92 3300005327 Ga0070658_10000427 Ga0070658_1000042719 319
93 3300005327 Ga0070658_10006490 Ga0070658_100064906 319
94 3300005327 Ga0070658_10025207 Ga0070658_100252076 319
95 3300005335 Ga0070666_10001834 Ga0070666_100018347 319
96 3300005335 Ga0070666_10028004 Ga0070666_100280045 319
97 3300005338 Ga0068868_100001999 Ga0068868_1000019999 319
98 3300005339 Ga0070660_100273432 Ga0070660_1002734321 319
99 3300005340 Ga0070689_100029808 Ga0070689_1000298082 319
100 3300005355 Ga0070671_100000001 Ga0070671_1000000011119 319
101 3300005355 Ga0070671_100006127 Ga0070671_1000061276 319
102 3300005364 Ga0070673_100001135 Ga0070673_10000113511 319
103 3300005365 Ga0070688_100003007 Ga0070688_1000030074 319
104 3300005366 Ga0070659_100036364 Ga0070659_1000363642 319
105 3300005367 Ga0070667_100044700 Ga0070667_1000447004 319
106 3300005466 Ga0070685_10004994 Ga0070685_100049948 319
107 3300005536 Ga0070697_100040020 Ga0070697_1000400202 319
108 3300005544 Ga0070686_100058344 Ga0070686_1000583442 319
109 3300005548 Ga0070665_100073513 Ga0070665_1000735133 319
110 3300005563 Ga0068855_100074327 Ga0068855_1000743273 319
111 3300005614 Ga0068856_100044344 Ga0068856_1000443442 319
112 3300005617 Ga0068859_100000752 Ga0068859_1000007526 319
113 3300005617 Ga0068859_100038942 Ga0068859_1000389425 319
114 3300005618 Ga0068864_100001479 Ga0068864_10000147912 319
115 3300005842 Ga0068858_100003128 Ga0068858_10000312810 319
116 3300005843 Ga0068860_100005794 Ga0068860_1000057949 319
117 3300006175 Ga0070712_100274847 Ga0070712_1002748472 319
118 3300006237 Ga0097621_100013394 Ga0097621_1000133946 319
119 3300006358 Ga0068871_100002423 Ga0068871_1000024239 319
120 3300006931 Ga0097620_100000752 Ga0097620_1000007526 319
121 3300006931 Ga0097620_100038942 Ga0097620_1000389425 319
122 3300009098 Ga0105245_10005949 Ga0105245_100059496 319
123 3300009101 Ga0105247_10000813 Ga0105247_100008135 319
124 3300009101 Ga0105247_10032030 Ga0105247_100320303 319
125 3300009174 Ga0105241_10233309 Ga0105241_102333092 319
126 3300009176 Ga0105242_10010848 Ga0105242_100108485 319
127 3300009177 Ga0105248_10010760 Ga0105248_100107609 319
128 3300010375 Ga0105239_10260193 Ga0105239_102601932 319
129 3300011119 Ga0105246_10013581 Ga0105246_100135814 319
130 3300013102 Ga0157371_10014810 Ga0157371_100148107 319
131 3300013104 Ga0157370_10008545 Ga0157370_100085454 319
132 3300013296 Ga0157374_10001973 Ga0157374_100019739 319
133 3300013297 Ga0157378_10004445 Ga0157378_100044459 319
134 3300013306 Ga0163162_10002465 Ga0163162_1000246511 319
135 3300013308 Ga0157375_10012600 Ga0157375_100126008 319
136 3300013308 Ga0157375_10332690 Ga0157375_103326902 319
137 3300014325 Ga0163163_10000541 Ga0163163_100005419 319
138 3300014968 Ga0157379_10000597 Ga0157379_1000059722 319
139 3300014969 Ga0157376_10002086 Ga0157376_100020869 319
140 3300025298 Ga0209050_1003662 Ga0209050_10036622 319
141 3300025304 Ga0209257_1000021 Ga0209257_100002132 319
142 3300025900 Ga0207710_10021934 Ga0207710_100219342 319
143 3300025903 Ga0207680_10000531 Ga0207680_100005319 319
144 3300025903 Ga0207680_10060901 Ga0207680_100609011 319
145 3300025904 Ga0207647_10000410 Ga0207647_1000041017 319
146 3300025908 Ga0207643_10154159 Ga0207643_101541592 319
147 3300025909 Ga0207705_10000057 Ga0207705_10000057108 319
148 3300025909 Ga0207705_10019851 Ga0207705_100198512 319
149 3300025927 Ga0207687_10000968 Ga0207687_100009689 319
150 3300025931 Ga0207644_10000001 Ga0207644_10000001318 319
151 3300025931 Ga0207644_10004427 Ga0207644_100044275 319
152 3300025932 Ga0207690_10004780 Ga0207690_100047807 319
153 3300025934 Ga0207686_10033745 Ga0207686_100337454 319
154 3300025936 Ga0207670_10008880 Ga0207670_100088806 319
155 3300025941 Ga0207711_10000970 Ga0207711_1000097013 319
156 3300025949 Ga0207667_10093850 Ga0207667_100938503 319
157 3300025960 Ga0207651_10011638 Ga0207651_100116385 319
158 3300025960 Ga0207651_10331373 Ga0207651_103313731 319
159 3300026023 Ga0207677_10000206 Ga0207677_1000020618 319
160 3300026035 Ga0207703_10001244 Ga0207703_1000124411 319
161 3300026078 Ga0207702_10088545 Ga0207702_100885452 319
162 3300026095 Ga0207676_10000386 Ga0207676_1000038618 319
163 3300028379 Ga0268266_10053925 Ga0268266_100539253 319
164 3300028381 Ga0268264_10001587 Ga0268264_1000158714 319
165 3300028800 Ga0265338_10036570 Ga0265338_100365703 319
166 3300035118 Ga0373954_0002282 Ga0373954_0002282_5958_6950 319
167 3300035724 Ga0373933_0084202 Ga0373933_0084202_595_1587 319
168 3300035725 Ga0373947_0020648 Ga0373947_0020648_2739_3731 319
169 3300036401 Ga0373937_0074707 Ga0373937_0074707_1150_2142 319
170 3300037068 Ga0373925_0024109 Ga0373925_0024109_3342_4301 319
171 3300045976 Ga0466967_0330604 Ga0466967_0330604_106_1071 319
172 3300048905 Ga0496102_0001727 Ga0496102_0001727_11900_12859 319
173 3300048906 Ga0496103_0000572 Ga0496103_0000572_11877_12836 319
174 3300048907 Ga0496104_0145860 Ga0496104_0145860_104_1096 319
175 3300048915 Ga0496112_0001534 Ga0496112_0001534_1830_2822 319
176 3300048920 Ga0496117_0032812 Ga0496117_0032812_1488_2447 319
177 3300048924 Ga0496121_0148106 Ga0496121_0148106_647_1606 319
178 3300053727 Ga0500611_000537 Ga0500611_000537_587_1552 319
179 3300005288 Ga0065714_10097250 Ga0065714_100972502 320
180 3300005288 Ga0065714_10120863 Ga0065714_101208632 320
181 3300005353 Ga0070669_100047295 Ga0070669_1000472952 320
182 3300005366 Ga0070659_100041743 Ga0070659_1000417432 320
183 3300005367 Ga0070667_100030603 Ga0070667_1000306035 320
184 3300005456 Ga0070678_100135475 Ga0070678_1001354752 320
185 3300005539 Ga0068853_100004714 Ga0068853_1000047146 320
186 3300005539 Ga0068853_100039020 Ga0068853_1000390202 320
187 3300005539 Ga0068853_100205907 Ga0068853_1002059072 320
188 3300005539 Ga0068853_100311075 Ga0068853_1003110752 320
189 3300005543 Ga0070672_100053776 Ga0070672_1000537763 320
190 3300005563 Ga0068855_100052223 Ga0068855_1000522233 320
191 3300005577 Ga0068857_100336907 Ga0068857_1003369072 320
192 3300005614 Ga0068856_100357415 Ga0068856_1003574152 320
193 3300009036 Ga0105244_10004943 Ga0105244_100049434 320
194 3300009092 Ga0105250_10015292 Ga0105250_100152923 320
195 3300009093 Ga0105240_10013204 Ga0105240_100132047 320
196 3300009176 Ga0105242_10123242 Ga0105242_101232423 320
197 3300009176 Ga0105242_10454179 Ga0105242_104541791 320
198 3300009177 Ga0105248_10013352 Ga0105248_1001335210 320
199 3300009545 Ga0105237_10018027 Ga0105237_100180272 320
200 3300009545 Ga0105237_10056227 Ga0105237_100562275 320
201 3300010375 Ga0105239_10001689 Ga0105239_1000168910 320
202 3300013102 Ga0157371_10080426 Ga0157371_100804262 320
203 3300013105 Ga0157369_10084073 Ga0157369_100840733 320
204 3300013306 Ga0163162_10000585 Ga0163162_1000058527 320
205 3300013308 Ga0157375_10091621 Ga0157375_100916213 320
206 3300021361 Ga0213872_10000063 Ga0213872_1000006324 320
207 3300025298 Ga0209050_1000934 Ga0209050_100093434 320
208 3300025298 Ga0209050_1015038 Ga0209050_10150382 320
209 3300025728 Ga0207655_1003666 Ga0207655_10036663 320
210 3300025913 Ga0207695_10029730 Ga0207695_100297305 320
211 3300025914 Ga0207671_10132040 Ga0207671_101320402 320
212 3300025914 Ga0207671_10153250 Ga0207671_101532502 320
213 3300025923 Ga0207681_10007422 Ga0207681_100074222 320
214 3300025934 Ga0207686_10068223 Ga0207686_100682232 320
215 3300025934 Ga0207686_10173937 Ga0207686_101739372 320
216 3300025940 Ga0207691_10097850 Ga0207691_100978502 320
217 3300025949 Ga0207667_10070624 Ga0207667_100706244 320
218 3300025986 Ga0207658_10029536 Ga0207658_100295365 320
219 3300026041 Ga0207639_10003427 Ga0207639_100034279 320
220 3300026078 Ga0207702_10249297 Ga0207702_102492972 320
221 3300026116 Ga0207674_10326759 Ga0207674_103267592 320
222 3300026121 Ga0207683_10133075 Ga0207683_101330752 320
223 3300028379 Ga0268266_10011412 Ga0268266_100114127 320
224 3300028800 Ga0265338_10001525 Ga0265338_100015257 320
225 3300031250 Ga0265331_10009181 Ga0265331_100091813 320
226 3300031731 Ga0307405_10320767 Ga0307405_103207672 320
227 3300039447 Ga0436361_0811061 Ga0436361_0811061_129763_130725 320
228 3300042876 Ga0451577_0182398 Ga0451577_0182398_19_993 320
229 3300042876 Ga0451577_0229436 Ga0451577_0229436_499_1461 320
230 3300044712 Ga0453684_0004611 Ga0453684_0004611_22955_23929 320
231 3300044712 Ga0453684_0028773 Ga0453684_0028773_3433_4395 320
232 3300044712 Ga0453684_0114818 Ga0453684_0114818_1844_2806 320
233 3300044712 Ga0453684_0632759 Ga0453684_0632759_150_1112 320
234 3300045051 Ga0451576_0442446 Ga0451576_0442446_63_1025 320
235 3300046474 Ga0495605_0052967 Ga0495605_0052967_685_1647 320
236 3300046475 Ga0495639_0009222 Ga0495639_0009222_3157_4119 320
237 3300046491 Ga0495584_0038835 Ga0495584_0038835_549_1511 320
238 3300046492 Ga0495585_0006751 Ga0495585_0006751_5596_6558 320
239 3300046528 Ga0495642_0085654 Ga0495642_0085654_19_981 320
240 3300046542 Ga0495597_0000834 Ga0495597_0000834_10420_11382 320
241 3300046557 Ga0495622_0002744 Ga0495622_0002744_1213_2175 320
242 3300046674 Ga0495588_0001986 Ga0495588_0001986_6966_7928 320
243 3300046674 Ga0495588_0025898 Ga0495588_0025898_1459_2421 320
244 3300046683 Ga0495658_0137043 Ga0495658_0137043_46_1008 320
245 3300046694 Ga0495649_0022586 Ga0495649_0022586_453_1415 320
246 3300047321 Ga0495676_0000093 Ga0495676_0000093_15215_16177 320
247 3300048091 Ga0495626_0040030 Ga0495626_0040030_1097_2059 320
248 3300048903 Ga0496100_0003277 Ga0496100_0003277_5853_6815 320
249 3300048904 Ga0496101_0006948 Ga0496101_0006948_2368_3330 320
250 3300048906 Ga0496103_0008681 Ga0496103_0008681_3250_4212 320
251 3300048907 Ga0496104_0002691 Ga0496104_0002691_412_1374 320
252 3300048908 Ga0496105_0005455 Ga0496105_0005455_2240_3202 320
253 3300048909 Ga0496106_0219166 Ga0496106_0219166_170_1132 320
254 3300048910 Ga0496107_0024196 Ga0496107_0024196_1470_2432 320
255 3300048912 Ga0496109_0041663 Ga0496109_0041663_1132_2094 320
256 3300048913 Ga0496110_0148488 Ga0496110_0148488_286_1248 320
257 3300048914 Ga0496111_0011447 Ga0496111_0011447_2320_3282 320
258 3300048919 Ga0496116_0136106 Ga0496116_0136106_378_1340 320
259 3300048924 Ga0496121_0011434 Ga0496121_0011434_6964_7953 320
260 3300048927 Ga0496124_0002043 Ga0496124_0002043_1153_2115 320
261 3300048927 Ga0496124_0014314 Ga0496124_0014314_3874_4836 320
262 3300048929 Ga0496126_0131789 Ga0496126_0131789_801_1763 320
263 3300049586 Ga0501070_0035058 Ga0501070_0035058_827_1816 320
264 3300053136 Ga0500559_0000584 Ga0500559_0000584_14644_15606 320
265 3300053145 Ga0500586_023657 Ga0500586_023657_324_1286 320
266 3300053160 Ga0500633_0025326 Ga0500633_0025326_533_1495 320
267 iso_pu_bacteria 2939642701 2939643296 320
268 3300003215 JGI25153J46596_10002485 JGI25153J46596_1000248510 322
269 3300003790 Ga0055528_1002119 Ga0055528_10021199 322
270 3300006048 Ga0075363_100060059 Ga0075363_1000600592 322
271 3300025258 Ga0209129_1005065 Ga0209129_10050653 322
272 3300025273 Ga0209673_1002354 Ga0209673_100235410 322
273 3300025297 Ga0209758_1002328 Ga0209758_100232820 322
274 3300025299 Ga0209256_1013915 Ga0209256_10139152 322
275 3300025299 Ga0209256_1031776 Ga0209256_10317762 322
276 3300025303 Ga0209051_1006408 Ga0209051_10064083 322
277 3300042876 Ga0451577_0000465 Ga0451577_0000465_58300_59274 322
278 3300044712 Ga0453684_0001383 Ga0453684_0001383_10959_11933 322
279 3300046512 Ga0495610_0011551 Ga0495610_0011551_894_1862 322
280 3300046515 Ga0495620_0040203 Ga0495620_0040203_454_1422 322
281 3300046522 Ga0495643_0006006 Ga0495643_0006006_6112_7080 322
282 3300046542 Ga0495597_0040053 Ga0495597_0040053_1003_1971 322
283 3300046675 Ga0495657_0052485 Ga0495657_0052485_652_1665 322
284 3300046809 Ga0495600_0006235 Ga0495600_0006235_3619_4632 322
285 3300053086 Ga0500578_0012282 Ga0500578_0012282_1031_1999 322
286 3300053109 Ga0500569_000485 Ga0500569_000485_3835_4803 322
287 3300053134 Ga0500658_0034474 Ga0500658_0034474_905_1873 322
288 3300053153 Ga0500616_0003150 Ga0500616_0003150_10878_11846 322
289 iso_pu_bacteria 2838016132 2838017362 322
290 iso_pu_bacteria 8005619151 8005620602 322

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mui-assembly1.cif.gz_A glycoside hydrolase bt_0996 0.773 6 314
8spo-assembly1.cif.gz_A tetramerized activation of mapsparta bound with nad+ 0.7718 160 202
5muj-assembly1.cif.gz_A bt0996 rgii chain b complex 0.757 6 322
5muj-assembly1.cif.gz_A bt0996 rgii chain b complex 0.7439 6 322
5mui-assembly1.cif.gz_A glycoside hydrolase bt_0996 0.7418 6 314
ID Description Score Start End Superfamily
af_P9WLW7_145_299_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9133 153 317 2.115.10.20
af_P9WLW7_145_299_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9078 153 317 2.115.10.20
af_P9WLW7_1_144_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8647 4 152 2.115.10.20
af_P9WLW7_1_144_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8479 4 152 2.115.10.20
af_K7K7P2_351_492_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.7846 191 320 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A859PSC3-F1-model_v4 deleted 0.9938 1 319
AF-A0A679IWS5-F1-model_v4 Glycosylase 0.9937 41 319
AF-A0A377LX51-F1-model_v4 Uncharacterized protein 0.9888 1 235
AF-A0A2E4YRK4-F1-model_v4 Glycosylase 0.9884 1 317
AF-A0A859PSC3-F1-model_v4 deleted 0.9876 1 319

Feature Viewer

pLDDT pTM Quality
94.78 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map