F389975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 226 | 234 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300046675|Ga0495657_0052485|Ga0495657_0052485_652_1665 |
| Length | 337 |
| Sequence | MPGSLANQEDKIGEAMFKWKKLGKVFTPQDVTDRAWLKEFAQAPATLIFDDFVRIYFSCRPPADTSGQYVSHSAYIDVDRADLFKIRRISERPVLELGGLGEFDQFGTYPISVARDGDIVRGYYAGWTRCESVPFNVGIGLALSTDEGRTFSKAGRGPVVPYSPDEPFVLSGPKIRRFGDTWYLFYIAGSKWIMADGRAEPVYKIRLAKSDDGVHWTKLNRNLIENVVEADEAQASPDVIFADGIYHMFFCYRYSTNYRGKEKGYRIGYASSDDLINWRRDDAKAGLTVSDTGWDDEMVSYPHVFELDGKTYMAYLGNQVGRNGFGLAVLDGKLGDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 2 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 3 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 4 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 5 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 6 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 7 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 8 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 9 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 10 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 11 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 12 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 13 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 14 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 15 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 16 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 17 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 18 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 19 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 20 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 21 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 22 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 23 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 24 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 25 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 26 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 27 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 28 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 29 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 30 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 31 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 32 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 33 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 34 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 35 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 36 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 37 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 38 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 39 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 40 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 41 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 42 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 43 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 44 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 45 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 46 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 47 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 48 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 49 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 50 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 51 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 52 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 162 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 163 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 164 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 202 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 205 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 208 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 209 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 212 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 213 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 214 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 215 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 216 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 218 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 219 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 220 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 221 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 222 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 223 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 224 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 225 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 226 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.69 |
| Metatranscriptomes | 0 |
| Isolates | 19.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.24 |
| Nodule | 15.17 |
| Rhizoplane | 5.17 |
| Rhizosphere | 66.21 |
| Stem | 0 |
| Stem Tuber | 0.69 |
| Unclassified | 5.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10002485 | 3300003215 | Bacteria | 10583 |
| 2 | rootH2_10022911 | 3300003320 | Bacteria | 27500 |
| 3 | rootL2_10097184 | 3300003322 | Bacteria | 6662 |
| 4 | Ga0055528_1002119 | 3300003790 | Bacteria | 10953 |
| 5 | Ga0065714_10097250 | 3300005288 | Bacteria | 1741 |
| 6 | Ga0065714_10120863 | 3300005288 | Bacteria | 1350 |
| 7 | Ga0065704_10097974 | 3300005289 | Bacteria | 2371 |
| 8 | Ga0065712_10005240 | 3300005290 | Bacteria | 4288 |
| 9 | Ga0070658_10000427 | 3300005327 | Bacteria | 36514 |
| 10 | Ga0070658_10006490 | 3300005327 | Bacteria | 9482 |
| 11 | Ga0070658_10025207 | 3300005327 | Unclassified | 4767 |
| 12 | Ga0070666_10001834 | 3300005335 | Bacteria | 12941 |
| 13 | Ga0070666_10028004 | 3300005335 | Bacteria | 3695 |
| 14 | Ga0068868_100001999 | 3300005338 | Bacteria | 14029 |
| 15 | Ga0070660_100273432 | 3300005339 | Bacteria | 1381 |
| 16 | Ga0070689_100029808 | 3300005340 | Bacteria | 4135 |
| 17 | Ga0070689_100086215 | 3300005340 | Bacteria | 2470 |
| 18 | Ga0070669_100047295 | 3300005353 | Bacteria | 3138 |
| 19 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 20 | Ga0070671_100006127 | 3300005355 | Bacteria | 9578 |
| 21 | Ga0070673_100001135 | 3300005364 | Bacteria | 15323 |
| 22 | Ga0070688_100003007 | 3300005365 | Bacteria | 8598 |
| 23 | Ga0070659_100036364 | 3300005366 | Bacteria | 3839 |
| 24 | Ga0070659_100041743 | 3300005366 | Bacteria | 3587 |
| 25 | Ga0070667_100030603 | 3300005367 | Bacteria | 4489 |
| 26 | Ga0070667_100044700 | 3300005367 | Bacteria | 3720 |
| 27 | Ga0070678_100135475 | 3300005456 | Bacteria | 1963 |
| 28 | Ga0070685_10004994 | 3300005466 | Bacteria | 6716 |
| 29 | Ga0070707_100261051 | 3300005468 | Unclassified | 1685 |
| 30 | Ga0070697_100040020 | 3300005536 | Bacteria | 3791 |
| 31 | Ga0068853_100004714 | 3300005539 | Bacteria | 10582 |
| 32 | Ga0068853_100039020 | 3300005539 | Bacteria | 4049 |
| 33 | Ga0068853_100205907 | 3300005539 | Bacteria | 1792 |
| 34 | Ga0068853_100311075 | 3300005539 | Bacteria | 1458 |
| 35 | Ga0070672_100053776 | 3300005543 | Bacteria | 3149 |
| 36 | Ga0070686_100058344 | 3300005544 | Bacteria | 2483 |
| 37 | Ga0070665_100000191 | 3300005548 | Bacteria | 108807 |
| 38 | Ga0070665_100073513 | 3300005548 | Bacteria | 3424 |
| 39 | Ga0068855_100052223 | 3300005563 | Bacteria | 4813 |
| 40 | Ga0068855_100074327 | 3300005563 | Bacteria | 3948 |
| 41 | Ga0070664_100258704 | 3300005564 | Bacteria | 1566 |
| 42 | Ga0068857_100336907 | 3300005577 | Bacteria | 1395 |
| 43 | Ga0068856_100044344 | 3300005614 | Bacteria | 4377 |
| 44 | Ga0068856_100357415 | 3300005614 | Bacteria | 1479 |
| 45 | Ga0068859_100000752 | 3300005617 | Bacteria | 32637 |
| 46 | Ga0068859_100038942 | 3300005617 | Bacteria | 4768 |
| 47 | Ga0068864_100001479 | 3300005618 | Bacteria | 19364 |
| 48 | Ga0068870_10091764 | 3300005840 | Bacteria | 1700 |
| 49 | Ga0068858_100003128 | 3300005842 | Bacteria | 16565 |
| 50 | Ga0068860_100005794 | 3300005843 | Bacteria | 12443 |
| 51 | Ga0075363_100060059 | 3300006048 | Bacteria | 2046 |
| 52 | Ga0070712_100274847 | 3300006175 | Bacteria | 1355 |
| 53 | Ga0097621_100013394 | 3300006237 | Bacteria | 6113 |
| 54 | Ga0068871_100002423 | 3300006358 | Bacteria | 12736 |
| 55 | Ga0075434_100220595 | 3300006871 | Bacteria | 1916 |
| 56 | Ga0075429_100372947 | 3300006880 | Bacteria | 1249 |
| 57 | Ga0097620_100000752 | 3300006931 | Bacteria | 32637 |
| 58 | Ga0097620_100038942 | 3300006931 | Bacteria | 4768 |
| 59 | Ga0105244_10004943 | 3300009036 | Bacteria | 9009 |
| 60 | Ga0105250_10005778 | 3300009092 | Bacteria | 5506 |
| 61 | Ga0105250_10015292 | 3300009092 | Bacteria | 3143 |
| 62 | Ga0105240_10013204 | 3300009093 | Bacteria | 11364 |
| 63 | Ga0105240_10054529 | 3300009093 | Bacteria | 5010 |
| 64 | Ga0105245_10005949 | 3300009098 | Bacteria | 10720 |
| 65 | Ga0105247_10000813 | 3300009101 | Bacteria | 23797 |
| 66 | Ga0105247_10032030 | 3300009101 | Bacteria | 3193 |
| 67 | Ga0114129_10039716 | 3300009147 | Bacteria | 6636 |
| 68 | Ga0105241_10233309 | 3300009174 | Bacteria | 1552 |
| 69 | Ga0105242_10010848 | 3300009176 | Bacteria | 6998 |
| 70 | Ga0105242_10123242 | 3300009176 | Bacteria | 2228 |
| 71 | Ga0105242_10454179 | 3300009176 | Bacteria | 1209 |
| 72 | Ga0105248_10010760 | 3300009177 | Bacteria | 10100 |
| 73 | Ga0105248_10013352 | 3300009177 | Bacteria | 9040 |
| 74 | Ga0105237_10018027 | 3300009545 | Bacteria | 7314 |
| 75 | Ga0105237_10056227 | 3300009545 | Bacteria | 3939 |
| 76 | Ga0105239_10001689 | 3300010375 | Bacteria | 29111 |
| 77 | Ga0105239_10260193 | 3300010375 | Bacteria | 1950 |
| 78 | Ga0105246_10013581 | 3300011119 | Bacteria | 5109 |
| 79 | Ga0157371_10014810 | 3300013102 | Bacteria | 5870 |
| 80 | Ga0157371_10080426 | 3300013102 | Bacteria | 2308 |
| 81 | Ga0157370_10008545 | 3300013104 | Bacteria | 11036 |
| 82 | Ga0157369_10084073 | 3300013105 | Bacteria | 3403 |
| 83 | Ga0157374_10001973 | 3300013296 | Bacteria | 17209 |
| 84 | Ga0157378_10004445 | 3300013297 | Bacteria | 12331 |
| 85 | Ga0157378_10206304 | 3300013297 | Unclassified | 1861 |
| 86 | Ga0163162_10000585 | 3300013306 | Bacteria | 33759 |
| 87 | Ga0163162_10002465 | 3300013306 | Bacteria | 17469 |
| 88 | Ga0157375_10012600 | 3300013308 | Bacteria | 7504 |
| 89 | Ga0157375_10091621 | 3300013308 | Bacteria | 3102 |
| 90 | Ga0157375_10332690 | 3300013308 | Bacteria | 1684 |
| 91 | Ga0163163_10000541 | 3300014325 | Bacteria | 33456 |
| 92 | Ga0157380_10396945 | 3300014326 | Bacteria | 1307 |
| 93 | Ga0157377_10010413 | 3300014745 | Bacteria | 4599 |
| 94 | Ga0157379_10000597 | 3300014968 | Bacteria | 29148 |
| 95 | Ga0157376_10002086 | 3300014969 | Bacteria | 13438 |
| 96 | Ga0213872_10000063 | 3300021361 | Bacteria | 97755 |
| 97 | Ga0209129_1005065 | 3300025258 | Bacteria | 4838 |
| 98 | Ga0209673_1002354 | 3300025273 | Bacteria | 13319 |
| 99 | Ga0209758_1002328 | 3300025297 | Bacteria | 19630 |
| 100 | Ga0209050_1000934 | 3300025298 | Bacteria | 38215 |
| 101 | Ga0209050_1003662 | 3300025298 | Bacteria | 11100 |
| 102 | Ga0209050_1015038 | 3300025298 | Bacteria | 3284 |
| 103 | Ga0209256_1013915 | 3300025299 | Bacteria | 2945 |
| 104 | Ga0209256_1031776 | 3300025299 | Unclassified | 1439 |
| 105 | Ga0209051_1006408 | 3300025303 | Bacteria | 6634 |
| 106 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 107 | Ga0207696_1002629 | 3300025711 | Bacteria | 8689 |
| 108 | Ga0207655_1003666 | 3300025728 | Bacteria | 11321 |
| 109 | Ga0207710_10021934 | 3300025900 | Bacteria | 2739 |
| 110 | Ga0207680_10000531 | 3300025903 | Bacteria | 18126 |
| 111 | Ga0207680_10060901 | 3300025903 | Bacteria | 2300 |
| 112 | Ga0207647_10000410 | 3300025904 | Bacteria | 35247 |
| 113 | Ga0207643_10026060 | 3300025908 | Bacteria | 3235 |
| 114 | Ga0207643_10154159 | 3300025908 | Bacteria | 1379 |
| 115 | Ga0207705_10000057 | 3300025909 | Bacteria | 157369 |
| 116 | Ga0207705_10019851 | 3300025909 | Unclassified | 4807 |
| 117 | Ga0207695_10029730 | 3300025913 | Bacteria | 6029 |
| 118 | Ga0207671_10132040 | 3300025914 | Bacteria | 1917 |
| 119 | Ga0207671_10153250 | 3300025914 | Unclassified | 1781 |
| 120 | Ga0207681_10007422 | 3300025923 | Bacteria | 6714 |
| 121 | Ga0207687_10000968 | 3300025927 | Bacteria | 19507 |
| 122 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 123 | Ga0207644_10004427 | 3300025931 | Bacteria | 9119 |
| 124 | Ga0207690_10004780 | 3300025932 | Bacteria | 7988 |
| 125 | Ga0207686_10033745 | 3300025934 | Bacteria | 3057 |
| 126 | Ga0207686_10068223 | 3300025934 | Bacteria | 2278 |
| 127 | Ga0207686_10173937 | 3300025934 | Bacteria | 1521 |
| 128 | Ga0207670_10008880 | 3300025936 | Bacteria | 5697 |
| 129 | Ga0207670_10039327 | 3300025936 | Bacteria | 3097 |
| 130 | Ga0207665_10119146 | 3300025939 | Bacteria | 1863 |
| 131 | Ga0207691_10097850 | 3300025940 | Bacteria | 2622 |
| 132 | Ga0207711_10000970 | 3300025941 | Bacteria | 27457 |
| 133 | Ga0207667_10070624 | 3300025949 | Bacteria | 3634 |
| 134 | Ga0207667_10093850 | 3300025949 | Bacteria | 3099 |
| 135 | Ga0207651_10011638 | 3300025960 | Bacteria | 4933 |
| 136 | Ga0207651_10331373 | 3300025960 | Bacteria | 1276 |
| 137 | Ga0207658_10029536 | 3300025986 | Bacteria | 3873 |
| 138 | Ga0207677_10000206 | 3300026023 | Bacteria | 47813 |
| 139 | Ga0207703_10001244 | 3300026035 | Bacteria | 23862 |
| 140 | Ga0207639_10003427 | 3300026041 | Bacteria | 10664 |
| 141 | Ga0207702_10088545 | 3300026078 | Bacteria | 2705 |
| 142 | Ga0207702_10249297 | 3300026078 | Bacteria | 1667 |
| 143 | Ga0207676_10000386 | 3300026095 | Bacteria | 37594 |
| 144 | Ga0207674_10326759 | 3300026116 | Bacteria | 1483 |
| 145 | Ga0207683_10133075 | 3300026121 | Bacteria | 2237 |
| 146 | Ga0268266_10001432 | 3300028379 | Bacteria | 28461 |
| 147 | Ga0268266_10011412 | 3300028379 | Bacteria | 7726 |
| 148 | Ga0268266_10053925 | 3300028379 | Bacteria | 3455 |
| 149 | Ga0268264_10001587 | 3300028381 | Bacteria | 21048 |
| 150 | Ga0265338_10001525 | 3300028800 | Bacteria | 37363 |
| 151 | Ga0265338_10036570 | 3300028800 | Bacteria | 4696 |
| 152 | Ga0265331_10009181 | 3300031250 | Bacteria | 5576 |
| 153 | Ga0307405_10320767 | 3300031731 | Bacteria | 1183 |
| 154 | Ga0373954_0002282 | 3300035118 | Bacteria | 7988 |
| 155 | Ga0373933_0084202 | 3300035724 | Bacteria | 1954 |
| 156 | Ga0373947_0020648 | 3300035725 | Bacteria | 3805 |
| 157 | Ga0373937_0074707 | 3300036401 | Bacteria | 3128 |
| 158 | Ga0373925_0024109 | 3300037068 | Bacteria | 4441 |
| 159 | Ga0436361_0811061 | 3300039447 | Bacteria | 135576 |
| 160 | Ga0439452_000031 | 3300042010 | Bacteria | 196691 |
| 161 | Ga0451577_0000465 | 3300042876 | Bacteria | 70232 |
| 162 | Ga0451577_0182398 | 3300042876 | Unclassified | 1893 |
| 163 | Ga0451577_0229436 | 3300042876 | Bacteria | 1679 |
| 164 | Ga0453684_0001383 | 3300044712 | Bacteria | 70232 |
| 165 | Ga0453684_0004611 | 3300044712 | Bacteria | 28699 |
| 166 | Ga0453684_0023286 | 3300044712 | Bacteria | 9133 |
| 167 | Ga0453684_0028773 | 3300044712 | Bacteria | 7912 |
| 168 | Ga0453684_0114818 | 3300044712 | Bacteria | 3264 |
| 169 | Ga0453684_0632759 | 3300044712 | Bacteria | 1169 |
| 170 | Ga0451576_0442446 | 3300045051 | Bacteria | 1364 |
| 171 | Ga0466967_0330604 | 3300045976 | Bacteria | 1472 |
| 172 | Ga0495651_0192530 | 3300046462 | Bacteria | 1434 |
| 173 | Ga0495605_0052967 | 3300046474 | Bacteria | 1970 |
| 174 | Ga0495639_0009222 | 3300046475 | Bacteria | 4229 |
| 175 | Ga0495584_0000511 | 3300046491 | Bacteria | 26555 |
| 176 | Ga0495584_0038835 | 3300046491 | Bacteria | 2406 |
| 177 | Ga0495585_0004565 | 3300046492 | Bacteria | 8956 |
| 178 | Ga0495585_0006751 | 3300046492 | Bacteria | 7084 |
| 179 | Ga0495607_0104262 | 3300046501 | Bacteria | 1513 |
| 180 | Ga0495610_0011551 | 3300046512 | Bacteria | 5390 |
| 181 | Ga0495616_0016554 | 3300046513 | Bacteria | 4078 |
| 182 | Ga0495620_0040203 | 3300046515 | Bacteria | 2060 |
| 183 | Ga0495643_0006006 | 3300046522 | Bacteria | 8099 |
| 184 | Ga0495642_0085654 | 3300046528 | Bacteria | 1330 |
| 185 | Ga0495597_0000834 | 3300046542 | Bacteria | 24225 |
| 186 | Ga0495597_0040053 | 3300046542 | Bacteria | 2095 |
| 187 | Ga0495622_0002744 | 3300046557 | Bacteria | 8426 |
| 188 | Ga0495633_0002543 | 3300046558 | Bacteria | 12798 |
| 189 | Ga0495611_0002210 | 3300046648 | Bacteria | 9045 |
| 190 | Ga0495625_0064380 | 3300046660 | Bacteria | 2586 |
| 191 | Ga0495661_0007280 | 3300046665 | Bacteria | 7714 |
| 192 | Ga0495588_0001986 | 3300046674 | Bacteria | 8748 |
| 193 | Ga0495588_0025898 | 3300046674 | Bacteria | 2926 |
| 194 | Ga0495657_0052485 | 3300046675 | Bacteria | 2733 |
| 195 | Ga0495658_0137043 | 3300046683 | Bacteria | 1494 |
| 196 | Ga0495670_0017136 | 3300046691 | Bacteria | 3563 |
| 197 | Ga0495649_0022586 | 3300046694 | Bacteria | 3520 |
| 198 | Ga0495600_0006235 | 3300046809 | Bacteria | 7238 |
| 199 | Ga0495676_0000093 | 3300047321 | Bacteria | 66312 |
| 200 | Ga0495626_0040030 | 3300048091 | Bacteria | 2215 |
| 201 | Ga0496100_0003277 | 3300048903 | Bacteria | 8413 |
| 202 | Ga0496101_0006948 | 3300048904 | Bacteria | 7313 |
| 203 | Ga0496102_0001727 | 3300048905 | Bacteria | 19121 |
| 204 | Ga0496103_0000572 | 3300048906 | Bacteria | 29210 |
| 205 | Ga0496103_0008681 | 3300048906 | Bacteria | 6034 |
| 206 | Ga0496104_0002691 | 3300048907 | Bacteria | 15306 |
| 207 | Ga0496104_0145860 | 3300048907 | Bacteria | 2273 |
| 208 | Ga0496105_0005455 | 3300048908 | Bacteria | 9649 |
| 209 | Ga0496106_0219166 | 3300048909 | Bacteria | 1517 |
| 210 | Ga0496107_0024196 | 3300048910 | Bacteria | 4296 |
| 211 | Ga0496109_0041663 | 3300048912 | Bacteria | 4159 |
| 212 | Ga0496109_0127856 | 3300048912 | Bacteria | 2370 |
| 213 | Ga0496110_0148488 | 3300048913 | Bacteria | 2121 |
| 214 | Ga0496111_0011447 | 3300048914 | Bacteria | 5975 |
| 215 | Ga0496112_0001534 | 3300048915 | Bacteria | 17824 |
| 216 | Ga0496116_0136106 | 3300048919 | Bacteria | 1391 |
| 217 | Ga0496117_0032812 | 3300048920 | Bacteria | 3938 |
| 218 | Ga0496121_0005975 | 3300048924 | Bacteria | 15379 |
| 219 | Ga0496121_0011434 | 3300048924 | Bacteria | 9856 |
| 220 | Ga0496121_0148106 | 3300048924 | Bacteria | 1731 |
| 221 | Ga0496124_0002043 | 3300048927 | Bacteria | 27439 |
| 222 | Ga0496124_0014314 | 3300048927 | Bacteria | 7675 |
| 223 | Ga0496126_0008482 | 3300048929 | Bacteria | 11078 |
| 224 | Ga0496126_0131789 | 3300048929 | Bacteria | 2160 |
| 225 | Ga0495682_0001416 | 3300049460 | Bacteria | 13012 |
| 226 | Ga0501070_0035058 | 3300049586 | Bacteria | 4194 |
| 227 | Ga0500578_0012282 | 3300053086 | Bacteria | 5532 |
| 228 | Ga0500569_000485 | 3300053109 | Bacteria | 6577 |
| 229 | Ga0500658_0034474 | 3300053134 | Bacteria | 1998 |
| 230 | Ga0500559_0000584 | 3300053136 | Bacteria | 25005 |
| 231 | Ga0500586_023657 | 3300053145 | Bacteria | 1962 |
| 232 | Ga0500616_0003150 | 3300053153 | Bacteria | 12876 |
| 233 | Ga0500633_0025326 | 3300053160 | Bacteria | 1854 |
| 234 | Ga0500611_000537 | 3300053727 | Bacteria | 3838 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10119146 | Ga0207665_101191462 | 261 |
| 2 | 3300009092 | Ga0105250_10005778 | Ga0105250_100057784 | 283 |
| 3 | 3300025711 | Ga0207696_1002629 | Ga0207696_10026294 | 283 |
| 4 | 3300013297 | Ga0157378_10206304 | Ga0157378_102063042 | 295 |
| 5 | 3300003320 | rootH2_10022911 | rootH2_1002291115 | 296 |
| 6 | 3300044712 | Ga0453684_0023286 | Ga0453684_0023286_6714_7610 | 298 |
| 7 | 3300005290 | Ga0065712_10005240 | Ga0065712_100052405 | 299 |
| 8 | 3300005340 | Ga0070689_100086215 | Ga0070689_1000862153 | 299 |
| 9 | 3300005564 | Ga0070664_100258704 | Ga0070664_1002587041 | 299 |
| 10 | 3300005840 | Ga0068870_10091764 | Ga0068870_100917642 | 299 |
| 11 | 3300006871 | Ga0075434_100220595 | Ga0075434_1002205953 | 299 |
| 12 | 3300006880 | Ga0075429_100372947 | Ga0075429_1003729472 | 299 |
| 13 | 3300009147 | Ga0114129_10039716 | Ga0114129_100397167 | 299 |
| 14 | 3300014745 | Ga0157377_10010413 | Ga0157377_100104135 | 299 |
| 15 | 3300025908 | Ga0207643_10026060 | Ga0207643_100260604 | 299 |
| 16 | 3300025936 | Ga0207670_10039327 | Ga0207670_100393273 | 299 |
| 17 | 3300048912 | Ga0496109_0127856 | Ga0496109_0127856_1139_2038 | 299 |
| 18 | 3300005289 | Ga0065704_10097974 | Ga0065704_100979742 | 303 |
| 19 | 3300005548 | Ga0070665_100000191 | Ga0070665_10000019164 | 303 |
| 20 | 3300028379 | Ga0268266_10001432 | Ga0268266_1000143220 | 303 |
| 21 | 3300042010 | Ga0439452_000031 | Ga0439452_000031_49378_50340 | 303 |
| 22 | 3300048924 | Ga0496121_0005975 | Ga0496121_0005975_12085_13047 | 303 |
| 23 | 3300048929 | Ga0496126_0008482 | Ga0496126_0008482_7783_8745 | 303 |
| 24 | 3300046491 | Ga0495584_0000511 | Ga0495584_0000511_20718_21680 | 306 |
| 25 | 3300046492 | Ga0495585_0004565 | Ga0495585_0004565_1327_2289 | 306 |
| 26 | 3300046501 | Ga0495607_0104262 | Ga0495607_0104262_29_991 | 306 |
| 27 | 3300046513 | Ga0495616_0016554 | Ga0495616_0016554_1742_2704 | 306 |
| 28 | 3300046558 | Ga0495633_0002543 | Ga0495633_0002543_3788_4750 | 306 |
| 29 | 3300046648 | Ga0495611_0002210 | Ga0495611_0002210_1262_2224 | 306 |
| 30 | 3300046660 | Ga0495625_0064380 | Ga0495625_0064380_1068_2030 | 306 |
| 31 | 3300046665 | Ga0495661_0007280 | Ga0495661_0007280_5652_6614 | 306 |
| 32 | 3300046691 | Ga0495670_0017136 | Ga0495670_0017136_1563_2525 | 306 |
| 33 | 3300049460 | Ga0495682_0001416 | Ga0495682_0001416_10973_11935 | 306 |
| 34 | 3300005468 | Ga0070707_100261051 | Ga0070707_1002610512 | 308 |
| 35 | iso_pu_bacteria | 2643221591 | 2643964961 | 315 |
| 36 | iso_pu_bacteria | 2855195626 | 2855197034 | 315 |
| 37 | iso_pu_bacteria | 2574179768 | 2574431872 | 316 |
| 38 | iso_pu_bacteria | 2844425489 | 2844428081 | 316 |
| 39 | iso_pu_bacteria | 2861691609 | 2861695118 | 316 |
| 40 | iso_pu_bacteria | 2929160207 | 2929161118 | 316 |
| 41 | 3300014326 | Ga0157380_10396945 | Ga0157380_103969452 | 317 |
| 42 | iso_pu_bacteria | 2871272651 | 2871275660 | 317 |
| 43 | iso_pu_bacteria | 2891670763 | 2891671334 | 317 |
| 44 | 3300003322 | rootL2_10097184 | rootL2_100971842 | 318 |
| 45 | 3300009093 | Ga0105240_10054529 | Ga0105240_100545292 | 318 |
| 46 | 3300046462 | Ga0495651_0192530 | Ga0495651_0192530_365_1321 | 318 |
| 47 | iso_pu_bacteria | 2516653085 | 2517081509 | 318 |
| 48 | iso_pu_bacteria | 2585427526 | 2585526597 | 318 |
| 49 | iso_pu_bacteria | 2718217927 | 2719384946 | 318 |
| 50 | iso_pu_bacteria | 2718217997 | 2719664693 | 318 |
| 51 | iso_pu_bacteria | 2718218199 | 2720491113 | 318 |
| 52 | iso_pu_bacteria | 2718218232 | 2720612480 | 318 |
| 53 | iso_pu_bacteria | 2718218423 | 2721398666 | 318 |
| 54 | iso_pu_bacteria | 2721755556 | 2723026139 | 318 |
| 55 | iso_pu_bacteria | 2721755809 | 2724037479 | 318 |
| 56 | iso_pu_bacteria | 2721755823 | 2724109403 | 318 |
| 57 | iso_pu_bacteria | 2728369352 | 2730107075 | 318 |
| 58 | iso_pu_bacteria | 2838048938 | 2838049156 | 318 |
| 59 | iso_pu_bacteria | 2838061910 | 2838063398 | 318 |
| 60 | iso_pu_bacteria | 2838668709 | 2838670921 | 318 |
| 61 | iso_pu_bacteria | 2838686498 | 2838688528 | 318 |
| 62 | iso_pu_bacteria | 2838701080 | 2838703292 | 318 |
| 63 | iso_pu_bacteria | 2838729681 | 2838736895 | 318 |
| 64 | iso_pu_bacteria | 2838742623 | 2838746797 | 318 |
| 65 | iso_pu_bacteria | 2841851746 | 2841852269 | 318 |
| 66 | iso_pu_bacteria | 2842146304 | 2842147484 | 318 |
| 67 | iso_pu_bacteria | 2842156927 | 2842158657 | 318 |
| 68 | iso_pu_bacteria | 2842180545 | 2842182271 | 318 |
| 69 | iso_pu_bacteria | 2842192696 | 2842198023 | 318 |
| 70 | iso_pu_bacteria | 2842229732 | 2842234718 | 318 |
| 71 | iso_pu_bacteria | 2842243621 | 2842248449 | 318 |
| 72 | iso_pu_bacteria | 2842250916 | 2842252550 | 318 |
| 73 | iso_pu_bacteria | 2842257432 | 2842262378 | 318 |
| 74 | iso_pu_bacteria | 2842271015 | 2842272522 | 318 |
| 75 | iso_pu_bacteria | 2842304105 | 2842310905 | 318 |
| 76 | iso_pu_bacteria | 2842311132 | 2842314819 | 318 |
| 77 | iso_pu_bacteria | 2842317721 | 2842318578 | 318 |
| 78 | iso_pu_bacteria | 2842395702 | 2842398179 | 318 |
| 79 | iso_pu_bacteria | 2842447887 | 2842452616 | 318 |
| 80 | iso_pu_bacteria | 2842489311 | 2842493831 | 318 |
| 81 | iso_pu_bacteria | 2842495871 | 2842497213 | 318 |
| 82 | iso_pu_bacteria | 2844454524 | 2844461419 | 318 |
| 83 | iso_pu_bacteria | 2933570622 | 2933577400 | 318 |
| 84 | iso_pu_bacteria | 2933594066 | 2933597152 | 318 |
| 85 | iso_pu_bacteria | 8005275841 | 8005279667 | 318 |
| 86 | iso_pu_bacteria | 8005395548 | 8005400299 | 318 |
| 87 | iso_pu_bacteria | 8005430974 | 8005437155 | 318 |
| 88 | iso_pu_bacteria | 8005695170 | 8005698702 | 318 |
| 89 | iso_pu_bacteria | 8018176218 | 8018182585 | 318 |
| 90 | iso_pu_bacteria | 8024501048 | 8024503178 | 318 |
| 91 | iso_pu_bacteria | 8056382006 | 8056384672 | 318 |
| 92 | 3300005327 | Ga0070658_10000427 | Ga0070658_1000042719 | 319 |
| 93 | 3300005327 | Ga0070658_10006490 | Ga0070658_100064906 | 319 |
| 94 | 3300005327 | Ga0070658_10025207 | Ga0070658_100252076 | 319 |
| 95 | 3300005335 | Ga0070666_10001834 | Ga0070666_100018347 | 319 |
| 96 | 3300005335 | Ga0070666_10028004 | Ga0070666_100280045 | 319 |
| 97 | 3300005338 | Ga0068868_100001999 | Ga0068868_1000019999 | 319 |
| 98 | 3300005339 | Ga0070660_100273432 | Ga0070660_1002734321 | 319 |
| 99 | 3300005340 | Ga0070689_100029808 | Ga0070689_1000298082 | 319 |
| 100 | 3300005355 | Ga0070671_100000001 | Ga0070671_1000000011119 | 319 |
| 101 | 3300005355 | Ga0070671_100006127 | Ga0070671_1000061276 | 319 |
| 102 | 3300005364 | Ga0070673_100001135 | Ga0070673_10000113511 | 319 |
| 103 | 3300005365 | Ga0070688_100003007 | Ga0070688_1000030074 | 319 |
| 104 | 3300005366 | Ga0070659_100036364 | Ga0070659_1000363642 | 319 |
| 105 | 3300005367 | Ga0070667_100044700 | Ga0070667_1000447004 | 319 |
| 106 | 3300005466 | Ga0070685_10004994 | Ga0070685_100049948 | 319 |
| 107 | 3300005536 | Ga0070697_100040020 | Ga0070697_1000400202 | 319 |
| 108 | 3300005544 | Ga0070686_100058344 | Ga0070686_1000583442 | 319 |
| 109 | 3300005548 | Ga0070665_100073513 | Ga0070665_1000735133 | 319 |
| 110 | 3300005563 | Ga0068855_100074327 | Ga0068855_1000743273 | 319 |
| 111 | 3300005614 | Ga0068856_100044344 | Ga0068856_1000443442 | 319 |
| 112 | 3300005617 | Ga0068859_100000752 | Ga0068859_1000007526 | 319 |
| 113 | 3300005617 | Ga0068859_100038942 | Ga0068859_1000389425 | 319 |
| 114 | 3300005618 | Ga0068864_100001479 | Ga0068864_10000147912 | 319 |
| 115 | 3300005842 | Ga0068858_100003128 | Ga0068858_10000312810 | 319 |
| 116 | 3300005843 | Ga0068860_100005794 | Ga0068860_1000057949 | 319 |
| 117 | 3300006175 | Ga0070712_100274847 | Ga0070712_1002748472 | 319 |
| 118 | 3300006237 | Ga0097621_100013394 | Ga0097621_1000133946 | 319 |
| 119 | 3300006358 | Ga0068871_100002423 | Ga0068871_1000024239 | 319 |
| 120 | 3300006931 | Ga0097620_100000752 | Ga0097620_1000007526 | 319 |
| 121 | 3300006931 | Ga0097620_100038942 | Ga0097620_1000389425 | 319 |
| 122 | 3300009098 | Ga0105245_10005949 | Ga0105245_100059496 | 319 |
| 123 | 3300009101 | Ga0105247_10000813 | Ga0105247_100008135 | 319 |
| 124 | 3300009101 | Ga0105247_10032030 | Ga0105247_100320303 | 319 |
| 125 | 3300009174 | Ga0105241_10233309 | Ga0105241_102333092 | 319 |
| 126 | 3300009176 | Ga0105242_10010848 | Ga0105242_100108485 | 319 |
| 127 | 3300009177 | Ga0105248_10010760 | Ga0105248_100107609 | 319 |
| 128 | 3300010375 | Ga0105239_10260193 | Ga0105239_102601932 | 319 |
| 129 | 3300011119 | Ga0105246_10013581 | Ga0105246_100135814 | 319 |
| 130 | 3300013102 | Ga0157371_10014810 | Ga0157371_100148107 | 319 |
| 131 | 3300013104 | Ga0157370_10008545 | Ga0157370_100085454 | 319 |
| 132 | 3300013296 | Ga0157374_10001973 | Ga0157374_100019739 | 319 |
| 133 | 3300013297 | Ga0157378_10004445 | Ga0157378_100044459 | 319 |
| 134 | 3300013306 | Ga0163162_10002465 | Ga0163162_1000246511 | 319 |
| 135 | 3300013308 | Ga0157375_10012600 | Ga0157375_100126008 | 319 |
| 136 | 3300013308 | Ga0157375_10332690 | Ga0157375_103326902 | 319 |
| 137 | 3300014325 | Ga0163163_10000541 | Ga0163163_100005419 | 319 |
| 138 | 3300014968 | Ga0157379_10000597 | Ga0157379_1000059722 | 319 |
| 139 | 3300014969 | Ga0157376_10002086 | Ga0157376_100020869 | 319 |
| 140 | 3300025298 | Ga0209050_1003662 | Ga0209050_10036622 | 319 |
| 141 | 3300025304 | Ga0209257_1000021 | Ga0209257_100002132 | 319 |
| 142 | 3300025900 | Ga0207710_10021934 | Ga0207710_100219342 | 319 |
| 143 | 3300025903 | Ga0207680_10000531 | Ga0207680_100005319 | 319 |
| 144 | 3300025903 | Ga0207680_10060901 | Ga0207680_100609011 | 319 |
| 145 | 3300025904 | Ga0207647_10000410 | Ga0207647_1000041017 | 319 |
| 146 | 3300025908 | Ga0207643_10154159 | Ga0207643_101541592 | 319 |
| 147 | 3300025909 | Ga0207705_10000057 | Ga0207705_10000057108 | 319 |
| 148 | 3300025909 | Ga0207705_10019851 | Ga0207705_100198512 | 319 |
| 149 | 3300025927 | Ga0207687_10000968 | Ga0207687_100009689 | 319 |
| 150 | 3300025931 | Ga0207644_10000001 | Ga0207644_10000001318 | 319 |
| 151 | 3300025931 | Ga0207644_10004427 | Ga0207644_100044275 | 319 |
| 152 | 3300025932 | Ga0207690_10004780 | Ga0207690_100047807 | 319 |
| 153 | 3300025934 | Ga0207686_10033745 | Ga0207686_100337454 | 319 |
| 154 | 3300025936 | Ga0207670_10008880 | Ga0207670_100088806 | 319 |
| 155 | 3300025941 | Ga0207711_10000970 | Ga0207711_1000097013 | 319 |
| 156 | 3300025949 | Ga0207667_10093850 | Ga0207667_100938503 | 319 |
| 157 | 3300025960 | Ga0207651_10011638 | Ga0207651_100116385 | 319 |
| 158 | 3300025960 | Ga0207651_10331373 | Ga0207651_103313731 | 319 |
| 159 | 3300026023 | Ga0207677_10000206 | Ga0207677_1000020618 | 319 |
| 160 | 3300026035 | Ga0207703_10001244 | Ga0207703_1000124411 | 319 |
| 161 | 3300026078 | Ga0207702_10088545 | Ga0207702_100885452 | 319 |
| 162 | 3300026095 | Ga0207676_10000386 | Ga0207676_1000038618 | 319 |
| 163 | 3300028379 | Ga0268266_10053925 | Ga0268266_100539253 | 319 |
| 164 | 3300028381 | Ga0268264_10001587 | Ga0268264_1000158714 | 319 |
| 165 | 3300028800 | Ga0265338_10036570 | Ga0265338_100365703 | 319 |
| 166 | 3300035118 | Ga0373954_0002282 | Ga0373954_0002282_5958_6950 | 319 |
| 167 | 3300035724 | Ga0373933_0084202 | Ga0373933_0084202_595_1587 | 319 |
| 168 | 3300035725 | Ga0373947_0020648 | Ga0373947_0020648_2739_3731 | 319 |
| 169 | 3300036401 | Ga0373937_0074707 | Ga0373937_0074707_1150_2142 | 319 |
| 170 | 3300037068 | Ga0373925_0024109 | Ga0373925_0024109_3342_4301 | 319 |
| 171 | 3300045976 | Ga0466967_0330604 | Ga0466967_0330604_106_1071 | 319 |
| 172 | 3300048905 | Ga0496102_0001727 | Ga0496102_0001727_11900_12859 | 319 |
| 173 | 3300048906 | Ga0496103_0000572 | Ga0496103_0000572_11877_12836 | 319 |
| 174 | 3300048907 | Ga0496104_0145860 | Ga0496104_0145860_104_1096 | 319 |
| 175 | 3300048915 | Ga0496112_0001534 | Ga0496112_0001534_1830_2822 | 319 |
| 176 | 3300048920 | Ga0496117_0032812 | Ga0496117_0032812_1488_2447 | 319 |
| 177 | 3300048924 | Ga0496121_0148106 | Ga0496121_0148106_647_1606 | 319 |
| 178 | 3300053727 | Ga0500611_000537 | Ga0500611_000537_587_1552 | 319 |
| 179 | 3300005288 | Ga0065714_10097250 | Ga0065714_100972502 | 320 |
| 180 | 3300005288 | Ga0065714_10120863 | Ga0065714_101208632 | 320 |
| 181 | 3300005353 | Ga0070669_100047295 | Ga0070669_1000472952 | 320 |
| 182 | 3300005366 | Ga0070659_100041743 | Ga0070659_1000417432 | 320 |
| 183 | 3300005367 | Ga0070667_100030603 | Ga0070667_1000306035 | 320 |
| 184 | 3300005456 | Ga0070678_100135475 | Ga0070678_1001354752 | 320 |
| 185 | 3300005539 | Ga0068853_100004714 | Ga0068853_1000047146 | 320 |
| 186 | 3300005539 | Ga0068853_100039020 | Ga0068853_1000390202 | 320 |
| 187 | 3300005539 | Ga0068853_100205907 | Ga0068853_1002059072 | 320 |
| 188 | 3300005539 | Ga0068853_100311075 | Ga0068853_1003110752 | 320 |
| 189 | 3300005543 | Ga0070672_100053776 | Ga0070672_1000537763 | 320 |
| 190 | 3300005563 | Ga0068855_100052223 | Ga0068855_1000522233 | 320 |
| 191 | 3300005577 | Ga0068857_100336907 | Ga0068857_1003369072 | 320 |
| 192 | 3300005614 | Ga0068856_100357415 | Ga0068856_1003574152 | 320 |
| 193 | 3300009036 | Ga0105244_10004943 | Ga0105244_100049434 | 320 |
| 194 | 3300009092 | Ga0105250_10015292 | Ga0105250_100152923 | 320 |
| 195 | 3300009093 | Ga0105240_10013204 | Ga0105240_100132047 | 320 |
| 196 | 3300009176 | Ga0105242_10123242 | Ga0105242_101232423 | 320 |
| 197 | 3300009176 | Ga0105242_10454179 | Ga0105242_104541791 | 320 |
| 198 | 3300009177 | Ga0105248_10013352 | Ga0105248_1001335210 | 320 |
| 199 | 3300009545 | Ga0105237_10018027 | Ga0105237_100180272 | 320 |
| 200 | 3300009545 | Ga0105237_10056227 | Ga0105237_100562275 | 320 |
| 201 | 3300010375 | Ga0105239_10001689 | Ga0105239_1000168910 | 320 |
| 202 | 3300013102 | Ga0157371_10080426 | Ga0157371_100804262 | 320 |
| 203 | 3300013105 | Ga0157369_10084073 | Ga0157369_100840733 | 320 |
| 204 | 3300013306 | Ga0163162_10000585 | Ga0163162_1000058527 | 320 |
| 205 | 3300013308 | Ga0157375_10091621 | Ga0157375_100916213 | 320 |
| 206 | 3300021361 | Ga0213872_10000063 | Ga0213872_1000006324 | 320 |
| 207 | 3300025298 | Ga0209050_1000934 | Ga0209050_100093434 | 320 |
| 208 | 3300025298 | Ga0209050_1015038 | Ga0209050_10150382 | 320 |
| 209 | 3300025728 | Ga0207655_1003666 | Ga0207655_10036663 | 320 |
| 210 | 3300025913 | Ga0207695_10029730 | Ga0207695_100297305 | 320 |
| 211 | 3300025914 | Ga0207671_10132040 | Ga0207671_101320402 | 320 |
| 212 | 3300025914 | Ga0207671_10153250 | Ga0207671_101532502 | 320 |
| 213 | 3300025923 | Ga0207681_10007422 | Ga0207681_100074222 | 320 |
| 214 | 3300025934 | Ga0207686_10068223 | Ga0207686_100682232 | 320 |
| 215 | 3300025934 | Ga0207686_10173937 | Ga0207686_101739372 | 320 |
| 216 | 3300025940 | Ga0207691_10097850 | Ga0207691_100978502 | 320 |
| 217 | 3300025949 | Ga0207667_10070624 | Ga0207667_100706244 | 320 |
| 218 | 3300025986 | Ga0207658_10029536 | Ga0207658_100295365 | 320 |
| 219 | 3300026041 | Ga0207639_10003427 | Ga0207639_100034279 | 320 |
| 220 | 3300026078 | Ga0207702_10249297 | Ga0207702_102492972 | 320 |
| 221 | 3300026116 | Ga0207674_10326759 | Ga0207674_103267592 | 320 |
| 222 | 3300026121 | Ga0207683_10133075 | Ga0207683_101330752 | 320 |
| 223 | 3300028379 | Ga0268266_10011412 | Ga0268266_100114127 | 320 |
| 224 | 3300028800 | Ga0265338_10001525 | Ga0265338_100015257 | 320 |
| 225 | 3300031250 | Ga0265331_10009181 | Ga0265331_100091813 | 320 |
| 226 | 3300031731 | Ga0307405_10320767 | Ga0307405_103207672 | 320 |
| 227 | 3300039447 | Ga0436361_0811061 | Ga0436361_0811061_129763_130725 | 320 |
| 228 | 3300042876 | Ga0451577_0182398 | Ga0451577_0182398_19_993 | 320 |
| 229 | 3300042876 | Ga0451577_0229436 | Ga0451577_0229436_499_1461 | 320 |
| 230 | 3300044712 | Ga0453684_0004611 | Ga0453684_0004611_22955_23929 | 320 |
| 231 | 3300044712 | Ga0453684_0028773 | Ga0453684_0028773_3433_4395 | 320 |
| 232 | 3300044712 | Ga0453684_0114818 | Ga0453684_0114818_1844_2806 | 320 |
| 233 | 3300044712 | Ga0453684_0632759 | Ga0453684_0632759_150_1112 | 320 |
| 234 | 3300045051 | Ga0451576_0442446 | Ga0451576_0442446_63_1025 | 320 |
| 235 | 3300046474 | Ga0495605_0052967 | Ga0495605_0052967_685_1647 | 320 |
| 236 | 3300046475 | Ga0495639_0009222 | Ga0495639_0009222_3157_4119 | 320 |
| 237 | 3300046491 | Ga0495584_0038835 | Ga0495584_0038835_549_1511 | 320 |
| 238 | 3300046492 | Ga0495585_0006751 | Ga0495585_0006751_5596_6558 | 320 |
| 239 | 3300046528 | Ga0495642_0085654 | Ga0495642_0085654_19_981 | 320 |
| 240 | 3300046542 | Ga0495597_0000834 | Ga0495597_0000834_10420_11382 | 320 |
| 241 | 3300046557 | Ga0495622_0002744 | Ga0495622_0002744_1213_2175 | 320 |
| 242 | 3300046674 | Ga0495588_0001986 | Ga0495588_0001986_6966_7928 | 320 |
| 243 | 3300046674 | Ga0495588_0025898 | Ga0495588_0025898_1459_2421 | 320 |
| 244 | 3300046683 | Ga0495658_0137043 | Ga0495658_0137043_46_1008 | 320 |
| 245 | 3300046694 | Ga0495649_0022586 | Ga0495649_0022586_453_1415 | 320 |
| 246 | 3300047321 | Ga0495676_0000093 | Ga0495676_0000093_15215_16177 | 320 |
| 247 | 3300048091 | Ga0495626_0040030 | Ga0495626_0040030_1097_2059 | 320 |
| 248 | 3300048903 | Ga0496100_0003277 | Ga0496100_0003277_5853_6815 | 320 |
| 249 | 3300048904 | Ga0496101_0006948 | Ga0496101_0006948_2368_3330 | 320 |
| 250 | 3300048906 | Ga0496103_0008681 | Ga0496103_0008681_3250_4212 | 320 |
| 251 | 3300048907 | Ga0496104_0002691 | Ga0496104_0002691_412_1374 | 320 |
| 252 | 3300048908 | Ga0496105_0005455 | Ga0496105_0005455_2240_3202 | 320 |
| 253 | 3300048909 | Ga0496106_0219166 | Ga0496106_0219166_170_1132 | 320 |
| 254 | 3300048910 | Ga0496107_0024196 | Ga0496107_0024196_1470_2432 | 320 |
| 255 | 3300048912 | Ga0496109_0041663 | Ga0496109_0041663_1132_2094 | 320 |
| 256 | 3300048913 | Ga0496110_0148488 | Ga0496110_0148488_286_1248 | 320 |
| 257 | 3300048914 | Ga0496111_0011447 | Ga0496111_0011447_2320_3282 | 320 |
| 258 | 3300048919 | Ga0496116_0136106 | Ga0496116_0136106_378_1340 | 320 |
| 259 | 3300048924 | Ga0496121_0011434 | Ga0496121_0011434_6964_7953 | 320 |
| 260 | 3300048927 | Ga0496124_0002043 | Ga0496124_0002043_1153_2115 | 320 |
| 261 | 3300048927 | Ga0496124_0014314 | Ga0496124_0014314_3874_4836 | 320 |
| 262 | 3300048929 | Ga0496126_0131789 | Ga0496126_0131789_801_1763 | 320 |
| 263 | 3300049586 | Ga0501070_0035058 | Ga0501070_0035058_827_1816 | 320 |
| 264 | 3300053136 | Ga0500559_0000584 | Ga0500559_0000584_14644_15606 | 320 |
| 265 | 3300053145 | Ga0500586_023657 | Ga0500586_023657_324_1286 | 320 |
| 266 | 3300053160 | Ga0500633_0025326 | Ga0500633_0025326_533_1495 | 320 |
| 267 | iso_pu_bacteria | 2939642701 | 2939643296 | 320 |
| 268 | 3300003215 | JGI25153J46596_10002485 | JGI25153J46596_1000248510 | 322 |
| 269 | 3300003790 | Ga0055528_1002119 | Ga0055528_10021199 | 322 |
| 270 | 3300006048 | Ga0075363_100060059 | Ga0075363_1000600592 | 322 |
| 271 | 3300025258 | Ga0209129_1005065 | Ga0209129_10050653 | 322 |
| 272 | 3300025273 | Ga0209673_1002354 | Ga0209673_100235410 | 322 |
| 273 | 3300025297 | Ga0209758_1002328 | Ga0209758_100232820 | 322 |
| 274 | 3300025299 | Ga0209256_1013915 | Ga0209256_10139152 | 322 |
| 275 | 3300025299 | Ga0209256_1031776 | Ga0209256_10317762 | 322 |
| 276 | 3300025303 | Ga0209051_1006408 | Ga0209051_10064083 | 322 |
| 277 | 3300042876 | Ga0451577_0000465 | Ga0451577_0000465_58300_59274 | 322 |
| 278 | 3300044712 | Ga0453684_0001383 | Ga0453684_0001383_10959_11933 | 322 |
| 279 | 3300046512 | Ga0495610_0011551 | Ga0495610_0011551_894_1862 | 322 |
| 280 | 3300046515 | Ga0495620_0040203 | Ga0495620_0040203_454_1422 | 322 |
| 281 | 3300046522 | Ga0495643_0006006 | Ga0495643_0006006_6112_7080 | 322 |
| 282 | 3300046542 | Ga0495597_0040053 | Ga0495597_0040053_1003_1971 | 322 |
| 283 | 3300046675 | Ga0495657_0052485 | Ga0495657_0052485_652_1665 | 322 |
| 284 | 3300046809 | Ga0495600_0006235 | Ga0495600_0006235_3619_4632 | 322 |
| 285 | 3300053086 | Ga0500578_0012282 | Ga0500578_0012282_1031_1999 | 322 |
| 286 | 3300053109 | Ga0500569_000485 | Ga0500569_000485_3835_4803 | 322 |
| 287 | 3300053134 | Ga0500658_0034474 | Ga0500658_0034474_905_1873 | 322 |
| 288 | 3300053153 | Ga0500616_0003150 | Ga0500616_0003150_10878_11846 | 322 |
| 289 | iso_pu_bacteria | 2838016132 | 2838017362 | 322 |
| 290 | iso_pu_bacteria | 8005619151 | 8005620602 | 322 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mui-assembly1.cif.gz_A | glycoside hydrolase bt_0996 | 0.773 | 6 | 314 |
| 8spo-assembly1.cif.gz_A | tetramerized activation of mapsparta bound with nad+ | 0.7718 | 160 | 202 |
| 5muj-assembly1.cif.gz_A | bt0996 rgii chain b complex | 0.757 | 6 | 322 |
| 5muj-assembly1.cif.gz_A | bt0996 rgii chain b complex | 0.7439 | 6 | 322 |
| 5mui-assembly1.cif.gz_A | glycoside hydrolase bt_0996 | 0.7418 | 6 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLW7_145_299_2.115.10.20 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.9133 | 153 | 317 | 2.115.10.20 |
| af_P9WLW7_145_299_2.115.10.20 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.9078 | 153 | 317 | 2.115.10.20 |
| af_P9WLW7_1_144_2.115.10.20 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8647 | 4 | 152 | 2.115.10.20 |
| af_P9WLW7_1_144_2.115.10.20 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.8479 | 4 | 152 | 2.115.10.20 |
| af_K7K7P2_351_492_2.115.10.20 | Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 | 0.7846 | 191 | 320 | 2.115.10.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A859PSC3-F1-model_v4 | deleted | 0.9938 | 1 | 319 |
|
| AF-A0A679IWS5-F1-model_v4 | Glycosylase | 0.9937 | 41 | 319 |
|
| AF-A0A377LX51-F1-model_v4 | Uncharacterized protein | 0.9888 | 1 | 235 |
|
| AF-A0A2E4YRK4-F1-model_v4 | Glycosylase | 0.9884 | 1 | 317 |
|
| AF-A0A859PSC3-F1-model_v4 | deleted | 0.9876 | 1 | 319 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar