F389995

General Info

Members Datasets Scaffolds Average Seq Length
290 183 290 184

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0076412|Ga0496104_0076412_430_987
Length 185
Sequence MNELIEKLLTIHEALKSQSLPHAFGGAIALAYCVEEPRGTRDLDLNIFIDAANAERALEALPEGVRVTDADIEAVKRDGQTRLFWDGVPVDLFLNNLPLHEEVAHRVVWVPAPLSKGKEIPVLDCASLVVFKSFFDRYRDWGDIEAVAQATPEDVDAAMKTVAGLVGEDAPVYRKLAELATSSRS

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
108 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
183 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 11.03
Rhizosphere 86.9
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000142 3300002074 Bacteria 12113
2 JGI24034J26672_10000275 3300002239 Bacteria 6784
3 JGI24742J22300_10005389 3300002244 Bacteria 2103
4 JGI25404J52841_10002738 3300003659 Bacteria 3383
5 JGI25405J52794_10079462 3300003911 Unclassified 721
6 Ga0070683_100002346 3300005329 Bacteria 15022
7 Ga0070683_100009632 3300005329 Bacteria 8268
8 Ga0070683_100109365 3300005329 Bacteria 2607
9 Ga0070690_100221211 3300005330 Bacteria 1327
10 Ga0070670_100587358 3300005331 Bacteria 996
11 Ga0070666_10039509 3300005335 Bacteria 3146
12 Ga0070682_100000038 3300005337 Bacteria 145670
13 Ga0070682_100000072 3300005337 Bacteria 93808
14 Ga0068868_100559554 3300005338 Unclassified 1009
15 Ga0070689_100078874 3300005340 Unclassified 2582
16 Ga0070668_100273622 3300005347 Bacteria 1408
17 Ga0070669_100342240 3300005353 Bacteria 1212
18 Ga0070675_100000008 3300005354 Bacteria 250004
19 Ga0070674_100000001 3300005356 Bacteria 277173
20 Ga0070674_100000026 3300005356 Bacteria 77168
21 Ga0070673_100031221 3300005364 Bacteria 3996
22 Ga0070688_100000018 3300005365 Bacteria 72357
23 Ga0070659_100056089 3300005366 Bacteria 3106
24 Ga0070703_10035246 3300005406 Bacteria 1531
25 Ga0070714_100029048 3300005435 Bacteria 4594
26 Ga0070714_100098529 3300005435 Bacteria 2572
27 Ga0070713_100000061 3300005436 Bacteria 68662
28 Ga0070713_100229994 3300005436 Bacteria 1685
29 Ga0070711_100390156 3300005439 Unclassified 1128
30 Ga0070700_100182333 3300005441 Archaea 1462
31 Ga0070700_100349782 3300005441 Bacteria 1095
32 Ga0070700_100700312 3300005441 Unclassified 805
33 Ga0070663_100159035 3300005455 Bacteria 1738
34 Ga0070663_100703284 3300005455 Unclassified 859
35 Ga0068867_100000246 3300005459 Bacteria 35737
36 Ga0070685_10000437 3300005466 Bacteria 24303
37 Ga0070685_10421945 3300005466 Bacteria 928
38 Ga0070706_100006320 3300005467 Bacteria 11194
39 Ga0070707_100144255 3300005468 Bacteria 2317
40 Ga0070684_100029006 3300005535 Bacteria 4685
41 Ga0070684_100035874 3300005535 Bacteria 4247
42 Ga0068853_100005229 3300005539 Bacteria 10153
43 Ga0068853_100090526 3300005539 Bacteria 2689
44 Ga0070686_100060387 3300005544 Bacteria 2446
45 Ga0070686_100100012 3300005544 Unclassified 1957
46 Ga0070686_100438786 3300005544 Bacteria 1001
47 Ga0070695_100289587 3300005545 Unclassified 1207
48 Ga0070696_100283912 3300005546 Unclassified 1263
49 Ga0070693_100001059 3300005547 Bacteria 12294
50 Ga0070693_100166310 3300005547 Bacteria 1409
51 Ga0070665_100030614 3300005548 Bacteria 5414
52 Ga0068854_100000044 3300005578 Bacteria 91882
53 Ga0068854_100056128 3300005578 Bacteria 2838
54 Ga0068854_100760935 3300005578 Unclassified 841
55 Ga0068852_100000050 3300005616 Bacteria 84306
56 Ga0068864_100000201 3300005618 Bacteria 54044
57 Ga0068866_10000006 3300005718 Bacteria 176129
58 Ga0068866_10000055 3300005718 Bacteria 44369
59 Ga0068866_10001565 3300005718 Bacteria 9730
60 Ga0068863_100000039 3300005841 Bacteria 161450
61 Ga0068860_100329495 3300005843 Bacteria 1500
62 Ga0081455_10038227 3300005937 Bacteria 4251
63 Ga0081540_1000044 3300005983 Bacteria 134269
64 Ga0081540_1127277 3300005983 Unclassified 1046
65 Ga0070715_10000003 3300006163 Bacteria 345282
66 Ga0075428_101072449 3300006844 Bacteria 851
67 Ga0068865_100489822 3300006881 Bacteria 1023
68 Ga0075435_101028528 3300007076 Unclassified 719
69 Ga0111539_10069335 3300009094 Bacteria 4163
70 Ga0105245_10000049 3300009098 Bacteria 128277
71 Ga0105245_10000508 3300009098 Bacteria 35724
72 Ga0105245_10314468 3300009098 Unclassified 1541
73 Ga0114129_10126177 3300009147 Bacteria 3518
74 Ga0105243_10112300 3300009148 Bacteria 2283
75 Ga0105243_10243920 3300009148 Bacteria 1600
76 Ga0105242_10000403 3300009176 Bacteria 34337
77 Ga0105242_10042435 3300009176 Bacteria 3673
78 Ga0105242_10149427 3300009176 Bacteria 2036
79 Ga0105242_10267866 3300009176 Bacteria 1546
80 Ga0105248_10000267 3300009177 Bacteria 61244
81 Ga0105238_10000014 3300009551 Bacteria 241954
82 Ga0105249_10731216 3300009553 Unclassified 1051
83 Ga0105239_10035301 3300010375 Bacteria 5492
84 Ga0105239_11120379 3300010375 Bacteria 906
85 Ga0105246_10159912 3300011119 Bacteria 1715
86 Ga0157370_10009506 3300013104 Bacteria 10374
87 Ga0157374_10501595 3300013296 Unclassified 1218
88 Ga0157378_10026417 3300013297 Bacteria 5118
89 Ga0157372_10694564 3300013307 Bacteria 1184
90 Ga0157375_10000942 3300013308 Bacteria 25237
91 Ga0157375_10322669 3300013308 Bacteria 1709
92 Ga0157375_10352815 3300013308 Bacteria 1637
93 Ga0157375_10385940 3300013308 Bacteria 1567
94 Ga0157375_10710843 3300013308 Unclassified 1158
95 Ga0157380_10000009 3300014326 Bacteria 142155
96 Ga0157380_10431505 3300014326 Bacteria 1260
97 Ga0157379_10136041 3300014968 Bacteria 2214
98 Ga0163161_10240963 3300017792 Bacteria 1406
99 Ga0206356_11281601 3300020070 Bacteria 4126
100 Ga0207682_10000007 3300025893 Bacteria 88967
101 Ga0207642_10000001 3300025899 Bacteria 714030
102 Ga0207642_10000003 3300025899 Bacteria 650651
103 Ga0207642_10000004 3300025899 Bacteria 407822
104 Ga0207642_10001353 3300025899 Bacteria 7604
105 Ga0207642_10049872 3300025899 Bacteria 1885
106 Ga0207680_10015963 3300025903 Bacteria 3932
107 Ga0207685_10000003 3300025905 Bacteria 344527
108 Ga0207684_10002595 3300025910 Bacteria 18094
109 Ga0207684_10225591 3300025910 Bacteria 1617
110 Ga0207663_10137799 3300025916 Unclassified 1696
111 Ga0207646_10055638 3300025922 Bacteria 3537
112 Ga0207681_10256130 3300025923 Bacteria 1368
113 Ga0207694_10000008 3300025924 Bacteria 484902
114 Ga0207650_10442349 3300025925 Bacteria 1081
115 Ga0207659_10000014 3300025926 Bacteria 168481
116 Ga0207687_10000012 3300025927 Bacteria 370729
117 Ga0207687_10001866 3300025927 Bacteria 14507
118 Ga0207687_10469116 3300025927 Bacteria 1046
119 Ga0207700_10000016 3300025928 Bacteria 202434
120 Ga0207700_10230635 3300025928 Bacteria 1574
121 Ga0207664_10033143 3300025929 Bacteria 3966
122 Ga0207690_10021359 3300025932 Bacteria 4014
123 Ga0207706_10000302 3300025933 Bacteria 53541
124 Ga0207686_10000029 3300025934 Bacteria 160239
125 Ga0207686_10001249 3300025934 Bacteria 14701
126 Ga0207686_10009233 3300025934 Bacteria 5346
127 Ga0207709_10019930 3300025935 Bacteria 3778
128 Ga0207670_10084066 3300025936 Unclassified 2234
129 Ga0207669_10000002 3300025937 Bacteria 377651
130 Ga0207669_10000041 3300025937 Bacteria 67085
131 Ga0207711_10000024 3300025941 Bacteria 293596
132 Ga0207661_10000925 3300025944 Bacteria 19251
133 Ga0207661_10009099 3300025944 Bacteria 7118
134 Ga0207661_10110161 3300025944 Bacteria 2327
135 Ga0207651_10016005 3300025960 Bacteria 4377
136 Ga0207640_10000517 3300025981 Bacteria 23263
137 Ga0207640_10043926 3300025981 Bacteria 2860
138 Ga0207677_10000671 3300026023 Bacteria 20346
139 Ga0207639_10000838 3300026041 Bacteria 20868
140 Ga0207678_10050439 3300026067 Bacteria 3595
141 Ga0207678_10287000 3300026067 Bacteria 1413
142 Ga0207708_10253446 3300026075 Unclassified 1419
143 Ga0207708_10305837 3300026075 Archaea 1294
144 Ga0207641_10000065 3300026088 Bacteria 156066
145 Ga0207648_10000783 3300026089 Bacteria 35821
146 Ga0207676_10000026 3300026095 Bacteria 248593
147 Ga0207698_10000009 3300026142 Bacteria 281300
148 Ga0268266_10011831 3300028379 Bacteria 7561
149 Ga0268266_10325560 3300028379 Bacteria 1439
150 Ga0268264_10003844 3300028381 Bacteria 12882
151 Ga0268264_10245755 3300028381 Bacteria 1660
152 Ga0265319_1000091 3300028563 Bacteria 70394
153 Ga0265338_10000752 3300028800 Bacteria 55238
154 Ga0265325_10003985 3300031241 Bacteria 9448
155 Ga0373955_0066879 3300035172 Bacteria 1999
156 Ga0373937_0086041 3300036401 Bacteria 2909
157 Ga0451789_1225635 3300041443 Bacteria 1041
158 Ga0451849_0896956 3300041505 Bacteria 1076
159 Ga0439446_0151542 3300042156 Unclassified 763
160 Ga0466957_0000824 3300044842 Bacteria 15816
161 Ga0466960_0178396 3300044901 Bacteria 1150
162 Ga0466967_0000123 3300045976 Bacteria 29223
163 Ga0495603_0001846 3300046455 Bacteria 12499
164 Ga0495591_040724 3300046458 Bacteria 1323
165 Ga0495629_0014026 3300046459 Bacteria 5775
166 Ga0495629_0093444 3300046459 Bacteria 2099
167 Ga0495641_0000095 3300046461 Bacteria 60441
168 Ga0495641_0012922 3300046461 Bacteria 4630
169 Ga0495653_0144782 3300046463 Bacteria 1667
170 Ga0495662_0001723 3300046476 Bacteria 10927
171 Ga0495662_0031586 3300046476 Bacteria 2558
172 Ga0495596_0017523 3300046500 Bacteria 2963
173 Ga0495606_0000294 3300046507 Bacteria 85998
174 Ga0495608_0000010 3300046511 Bacteria 258660
175 Ga0495608_0011638 3300046511 Bacteria 6120
176 Ga0495618_0501438 3300046514 Bacteria 732
177 Ga0495628_0019162 3300046516 Bacteria 5659
178 Ga0495628_0245954 3300046516 Bacteria 1336
179 Ga0495628_0370800 3300046516 Bacteria 1050
180 Ga0495630_0000082 3300046517 Bacteria 75280
181 Ga0495644_0001672 3300046523 Bacteria 9001
182 Ga0495652_0061979 3300046529 Bacteria 3155
183 Ga0495586_0000234 3300046535 Bacteria 36813
184 Ga0495587_0008616 3300046536 Bacteria 6557
185 Ga0495587_0391638 3300046536 Unclassified 772
186 Ga0495645_0038925 3300046543 Bacteria 3468
187 Ga0495645_0180597 3300046543 Bacteria 1446
188 Ga0495667_0369773 3300046559 Bacteria 905
189 Ga0495656_0009207 3300046615 Bacteria 3547
190 Ga0495634_0000616 3300046642 Bacteria 34537
191 Ga0495634_0028409 3300046642 Bacteria 3883
192 Ga0495625_0269260 3300046660 Bacteria 1100
193 Ga0495635_0128537 3300046663 Unclassified 1727
194 Ga0495635_0507917 3300046663 Unclassified 793
195 Ga0495588_0000218 3300046674 Bacteria 54328
196 Ga0495657_0000005 3300046675 Bacteria 254860
197 Ga0495657_0243722 3300046675 Unclassified 1084
198 Ga0495599_0027864 3300046678 Bacteria 3539
199 Ga0495599_0271058 3300046678 Bacteria 1030
200 Ga0495647_0000010 3300046681 Bacteria 94696
201 Ga0495647_0000111 3300046681 Bacteria 20557
202 Ga0495658_0000965 3300046683 Bacteria 15281
203 Ga0495613_0000131 3300046689 Bacteria 74262
204 Ga0495613_0203237 3300046689 Bacteria 1396
205 Ga0495613_0291315 3300046689 Unclassified 1132
206 Ga0495624_0000778 3300046690 Bacteria 25141
207 Ga0495624_0029189 3300046690 Bacteria 3600
208 Ga0495649_0001406 3300046694 Bacteria 18177
209 Ga0495600_0020345 3300046809 Bacteria 4245
210 Ga0495600_0085500 3300046809 Bacteria 2058
211 Ga0495600_0276381 3300046809 Bacteria 1064
212 Ga0495600_0328004 3300046809 Unclassified 962
213 Ga0495604_0035697 3300047317 Bacteria 3924
214 Ga0495604_0187293 3300047317 Bacteria 1444
215 Ga0495676_0003442 3300047321 Bacteria 14318
216 Ga0495680_0000873 3300047322 Bacteria 33510
217 Ga0495680_0009372 3300047322 Bacteria 8811
218 Ga0495680_0113850 3300047322 Bacteria 2002
219 Ga0495675_0000004 3300047444 Bacteria 211049
220 Ga0495679_022610 3300047446 Unclassified 2148
221 Ga0495673_0016617 3300047469 Bacteria 3758
222 Ga0495673_0039581 3300047469 Bacteria 2137
223 Ga0495686_0000008 3300047472 Bacteria 727479
224 Ga0495686_0024231 3300047472 Bacteria 3991
225 Ga0495686_0087808 3300047472 Bacteria 1891
226 Ga0495593_0018795 3300047673 Bacteria 3880
227 Ga0495593_0044212 3300047673 Bacteria 2383
228 Ga0495602_0000009 3300048088 Bacteria 258991
229 Ga0495602_0216455 3300048088 Bacteria 1449
230 Ga0495602_0635683 3300048088 Unclassified 730
231 Ga0496100_0234374 3300048903 Bacteria 1352
232 Ga0496102_0000132 3300048905 Bacteria 103176
233 Ga0496103_0000077 3300048906 Bacteria 112223
234 Ga0496103_0189323 3300048906 Bacteria 1323
235 Ga0496104_0000003 3300048907 Bacteria 669219
236 Ga0496104_0076412 3300048907 Bacteria 3190
237 Ga0496105_0000003 3300048908 Bacteria 713251
238 Ga0496106_0000130 3300048909 Bacteria 57887
239 Ga0496106_0200505 3300048909 Unclassified 1588
240 Ga0496107_0011520 3300048910 Bacteria 6161
241 Ga0496108_0000002 3300048911 Bacteria 700890
242 Ga0496108_0000339 3300048911 Bacteria 39428
243 Ga0496108_0014574 3300048911 Bacteria 6417
244 Ga0496109_0000001 3300048912 Bacteria 700852
245 Ga0496109_0001321 3300048912 Bacteria 20438
246 Ga0496110_0000015 3300048913 Bacteria 85373
247 Ga0496110_0016082 3300048913 Bacteria 6239
248 Ga0496110_0095743 3300048913 Bacteria 2659
249 Ga0496110_0502321 3300048913 Bacteria 1104
250 Ga0496111_0000001 3300048914 Bacteria 194837
251 Ga0496111_0036242 3300048914 Bacteria 3526
252 Ga0496111_0085263 3300048914 Bacteria 2310
253 Ga0496112_0000002 3300048915 Bacteria 782039
254 Ga0496112_0000250 3300048915 Bacteria 34271
255 Ga0496112_0788905 3300048915 Bacteria 875
256 Ga0496113_0000039 3300048916 Bacteria 55926
257 Ga0496113_0022010 3300048916 Bacteria 4503
258 Ga0496114_0084282 3300048917 Bacteria 2691
259 Ga0496114_0137284 3300048917 Bacteria 2115
260 Ga0496115_0000183 3300048918 Bacteria 58406
261 Ga0496115_0017582 3300048918 Bacteria 5471
262 Ga0501042_0021689 3300049578 Bacteria 4479
263 Ga0501042_0082073 3300049578 Bacteria 2311
264 Ga0501071_0073671 3300049587 Bacteria 2491
265 Ga0501075_0000897 3300049591 Bacteria 18804
266 Ga0501081_0749367 3300049743 Bacteria 734
267 Ga0501083_0150022 3300049744 Bacteria 1526
268 nmdc:mga05p37_199991_c1 3300050507 Bacteria 2421
269 nmdc:mga0rr50_388674_c1 3300050513 Bacteria 1177
270 Ga0495601_0000042 3300053077 Bacteria 77373
271 Ga0495601_0000296 3300053077 Bacteria 26491
272 Ga0495601_0322299 3300053077 Bacteria 1006
273 Ga0495601_0474048 3300053077 Unclassified 809
274 Ga0495612_0003776 3300053078 Bacteria 6301
275 Ga0495612_0011513 3300053078 Bacteria 3566
276 Ga0495655_0000009 3300053083 Bacteria 150662
277 Ga0495595_0000005 3300053084 Bacteria 258660
278 Ga0495595_0004027 3300053084 Bacteria 5880
279 Ga0495619_0000040 3300053085 Bacteria 118238
280 Ga0495619_0000126 3300053085 Bacteria 56169
281 Ga0495619_0002266 3300053085 Bacteria 12712
282 Ga0495619_0007234 3300053085 Bacteria 7032
283 Ga0495619_0073468 3300053085 Bacteria 2292
284 Ga0495619_0083487 3300053085 Bacteria 2155
285 Ga0495619_0581672 3300053085 Unclassified 767
286 Ga0500566_0017835 3300053094 Bacteria 4167
287 Ga0500641_0002279 3300053096 Bacteria 6808
288 Ga0500614_000806 3300053123 Bacteria 7940
289 Ga0500628_000078 3300053129 Bacteria 24490
290 Ga0500628_105812 3300053129 Bacteria 749

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0073468 Ga0495619_0073468_1083_1580 165
2 3300005539 Ga0068853_100005229 Ga0068853_1000052298 168
3 3300026041 Ga0207639_10000838 Ga0207639_100008386 168
4 3300047472 Ga0495686_0024231 Ga0495686_0024231_1967_2497 176
5 3300006844 Ga0075428_101072449 Ga0075428_1010724492 177
6 3300009094 Ga0111539_10069335 Ga0111539_100693353 177
7 3300009147 Ga0114129_10126177 Ga0114129_101261772 177
8 3300050507 nmdc:mga05p37_199991_c1 nmdc:mga05p37_199991_c1_398_931 177
9 3300005356 Ga0070674_100000001 Ga0070674_10000000171 178
10 3300005441 Ga0070700_100349782 Ga0070700_1003497821 178
11 3300005455 Ga0070663_100703284 Ga0070663_1007032842 178
12 3300005544 Ga0070686_100438786 Ga0070686_1004387861 178
13 3300005545 Ga0070695_100289587 Ga0070695_1002895872 178
14 3300005546 Ga0070696_100283912 Ga0070696_1002839122 178
15 3300005718 Ga0068866_10000055 Ga0068866_100000557 178
16 3300009148 Ga0105243_10112300 Ga0105243_101123003 178
17 3300009148 Ga0105243_10243920 Ga0105243_102439202 178
18 3300009176 Ga0105242_10042435 Ga0105242_100424354 178
19 3300009176 Ga0105242_10149427 Ga0105242_101494273 178
20 3300009553 Ga0105249_10731216 Ga0105249_107312162 178
21 3300013308 Ga0157375_10000942 Ga0157375_1000094226 178
22 3300013308 Ga0157375_10322669 Ga0157375_103226693 178
23 3300025899 Ga0207642_10001353 Ga0207642_100013537 178
24 3300025934 Ga0207686_10009233 Ga0207686_100092335 178
25 3300025935 Ga0207709_10019930 Ga0207709_100199305 178
26 3300025937 Ga0207669_10000002 Ga0207669_10000002278 178
27 3300026067 Ga0207678_10050439 Ga0207678_100504392 178
28 3300026075 Ga0207708_10253446 Ga0207708_102534461 178
29 3300042156 Ga0439446_0151542 Ga0439446_0151542_186_722 178
30 3300046615 Ga0495656_0009207 Ga0495656_0009207_1631_2167 178
31 3300046809 Ga0495600_0276381 Ga0495600_0276381_58_594 178
32 3300048911 Ga0496108_0014574 Ga0496108_0014574_38_574 178
33 3300049578 Ga0501042_0082073 Ga0501042_0082073_1399_1935 178
34 3300005618 Ga0068864_100000201 Ga0068864_10000020134 179
35 3300007076 Ga0075435_101028528 Ga0075435_1010285282 179
36 3300026095 Ga0207676_10000026 Ga0207676_10000026212 179
37 3300036401 Ga0373937_0086041 Ga0373937_0086041_284_832 179
38 3300046455 Ga0495603_0001846 Ga0495603_0001846_6575_7114 179
39 3300046514 Ga0495618_0501438 Ga0495618_0501438_127_666 179
40 3300046516 Ga0495628_0370800 Ga0495628_0370800_27_566 179
41 3300046517 Ga0495630_0000082 Ga0495630_0000082_52065_52604 179
42 3300046642 Ga0495634_0028409 Ga0495634_0028409_1491_2030 179
43 3300046678 Ga0495599_0271058 Ga0495599_0271058_244_783 179
44 3300048903 Ga0496100_0234374 Ga0496100_0234374_411_953 179
45 3300048916 Ga0496113_0022010 Ga0496113_0022010_461_1000 179
46 3300050513 nmdc:mga0rr50_388674_c1 nmdc:mga0rr50_388674_c1_526_1068 179
47 3300053077 Ga0495601_0322299 Ga0495601_0322299_42_581 179
48 3300053085 Ga0495619_0002266 Ga0495619_0002266_8944_9483 179
49 3300005467 Ga0070706_100006320 Ga0070706_10000632011 180
50 3300005468 Ga0070707_100144255 Ga0070707_1001442552 180
51 3300025910 Ga0207684_10002595 Ga0207684_100025957 180
52 3300025922 Ga0207646_10055638 Ga0207646_100556382 180
53 3300046675 Ga0495657_0243722 Ga0495657_0243722_516_1058 180
54 3300047472 Ga0495686_0000008 Ga0495686_0000008_724199_724741 180
55 3300053085 Ga0495619_0083487 Ga0495619_0083487_510_1052 180
56 3300005331 Ga0070670_100587358 Ga0070670_1005873582 181
57 3300005340 Ga0070689_100078874 Ga0070689_1000788743 181
58 3300005365 Ga0070688_100000018 Ga0070688_10000001871 181
59 3300005436 Ga0070713_100000061 Ga0070713_10000006130 181
60 3300005436 Ga0070713_100229994 Ga0070713_1002299942 181
61 3300005439 Ga0070711_100390156 Ga0070711_1003901561 181
62 3300005466 Ga0070685_10000437 Ga0070685_100004378 181
63 3300005466 Ga0070685_10421945 Ga0070685_104219452 181
64 3300025916 Ga0207663_10137799 Ga0207663_101377993 181
65 3300025925 Ga0207650_10442349 Ga0207650_104423492 181
66 3300025928 Ga0207700_10000016 Ga0207700_10000016106 181
67 3300025928 Ga0207700_10230635 Ga0207700_102306353 181
68 3300025936 Ga0207670_10084066 Ga0207670_100840663 181
69 3300003659 JGI25404J52841_10002738 JGI25404J52841_100027385 182
70 3300003911 JGI25405J52794_10079462 JGI25405J52794_100794622 182
71 3300005329 Ga0070683_100002346 Ga0070683_1000023467 182
72 3300005329 Ga0070683_100109365 Ga0070683_1001093653 182
73 3300005330 Ga0070690_100221211 Ga0070690_1002212112 182
74 3300005335 Ga0070666_10039509 Ga0070666_100395093 182
75 3300005337 Ga0070682_100000072 Ga0070682_10000007259 182
76 3300005347 Ga0070668_100273622 Ga0070668_1002736221 182
77 3300005354 Ga0070675_100000008 Ga0070675_100000008151 182
78 3300005366 Ga0070659_100056089 Ga0070659_1000560894 182
79 3300005435 Ga0070714_100029048 Ga0070714_1000290484 182
80 3300005435 Ga0070714_100098529 Ga0070714_1000985292 182
81 3300005441 Ga0070700_100700312 Ga0070700_1007003122 182
82 3300005455 Ga0070663_100159035 Ga0070663_1001590353 182
83 3300005535 Ga0070684_100029006 Ga0070684_1000290062 182
84 3300005539 Ga0068853_100090526 Ga0068853_1000905262 182
85 3300005544 Ga0070686_100060387 Ga0070686_1000603872 182
86 3300005544 Ga0070686_100100012 Ga0070686_1001000122 182
87 3300005548 Ga0070665_100030614 Ga0070665_1000306144 182
88 3300005578 Ga0068854_100000044 Ga0068854_10000004434 182
89 3300005578 Ga0068854_100760935 Ga0068854_1007609352 182
90 3300005616 Ga0068852_100000050 Ga0068852_10000005069 182
91 3300005718 Ga0068866_10001565 Ga0068866_100015657 182
92 3300005841 Ga0068863_100000039 Ga0068863_100000039117 182
93 3300005843 Ga0068860_100329495 Ga0068860_1003294953 182
94 3300005937 Ga0081455_10038227 Ga0081455_100382274 182
95 3300005983 Ga0081540_1000044 Ga0081540_100004490 182
96 3300006881 Ga0068865_100489822 Ga0068865_1004898222 182
97 3300009176 Ga0105242_10000403 Ga0105242_1000040326 182
98 3300009177 Ga0105248_10000267 Ga0105248_100002674 182
99 3300010375 Ga0105239_10035301 Ga0105239_100353017 182
100 3300010375 Ga0105239_11120379 Ga0105239_111203792 182
101 3300013104 Ga0157370_10009506 Ga0157370_100095068 182
102 3300013297 Ga0157378_10026417 Ga0157378_100264174 182
103 3300013307 Ga0157372_10694564 Ga0157372_106945642 182
104 3300013308 Ga0157375_10352815 Ga0157375_103528153 182
105 3300013308 Ga0157375_10710843 Ga0157375_107108432 182
106 3300014326 Ga0157380_10000009 Ga0157380_1000000992 182
107 3300014326 Ga0157380_10431505 Ga0157380_104315053 182
108 3300017792 Ga0163161_10240963 Ga0163161_102409632 182
109 3300020070 Ga0206356_11281601 Ga0206356_112816013 182
110 3300025899 Ga0207642_10049872 Ga0207642_100498722 182
111 3300025903 Ga0207680_10015963 Ga0207680_100159633 182
112 3300025926 Ga0207659_10000014 Ga0207659_10000014164 182
113 3300025929 Ga0207664_10033143 Ga0207664_100331434 182
114 3300025932 Ga0207690_10021359 Ga0207690_100213595 182
115 3300025934 Ga0207686_10000029 Ga0207686_1000002915 182
116 3300025941 Ga0207711_10000024 Ga0207711_10000024111 182
117 3300025944 Ga0207661_10000925 Ga0207661_100009257 182
118 3300025944 Ga0207661_10110161 Ga0207661_101101612 182
119 3300025981 Ga0207640_10000517 Ga0207640_100005176 182
120 3300026023 Ga0207677_10000671 Ga0207677_100006713 182
121 3300026067 Ga0207678_10287000 Ga0207678_102870003 182
122 3300026088 Ga0207641_10000065 Ga0207641_1000006520 182
123 3300026142 Ga0207698_10000009 Ga0207698_1000000958 182
124 3300028379 Ga0268266_10011831 Ga0268266_100118314 182
125 3300028379 Ga0268266_10325560 Ga0268266_103255603 182
126 3300028381 Ga0268264_10245755 Ga0268264_102457552 182
127 3300028563 Ga0265319_1000091 Ga0265319_100009132 182
128 3300028800 Ga0265338_10000752 Ga0265338_1000075232 182
129 3300031241 Ga0265325_10003985 Ga0265325_100039855 182
130 3300041443 Ga0451789_1225635 Ga0451789_1225635_64_612 182
131 3300041505 Ga0451849_0896956 Ga0451849_0896956_461_1009 182
132 3300044842 Ga0466957_0000824 Ga0466957_0000824_13473_14024 182
133 3300045976 Ga0466967_0000123 Ga0466967_0000123_51_602 182
134 3300046459 Ga0495629_0014026 Ga0495629_0014026_781_1329 182
135 3300046459 Ga0495629_0093444 Ga0495629_0093444_828_1376 182
136 3300046461 Ga0495641_0012922 Ga0495641_0012922_256_804 182
137 3300046476 Ga0495662_0001723 Ga0495662_0001723_7639_8196 182
138 3300046476 Ga0495662_0031586 Ga0495662_0031586_348_905 182
139 3300046500 Ga0495596_0017523 Ga0495596_0017523_253_801 182
140 3300046507 Ga0495606_0000294 Ga0495606_0000294_22599_23150 182
141 3300046511 Ga0495608_0000010 Ga0495608_0000010_29990_30541 182
142 3300046516 Ga0495628_0245954 Ga0495628_0245954_283_834 182
143 3300046523 Ga0495644_0001672 Ga0495644_0001672_4975_5523 182
144 3300046529 Ga0495652_0061979 Ga0495652_0061979_1649_2197 182
145 3300046535 Ga0495586_0000234 Ga0495586_0000234_13989_14546 182
146 3300046536 Ga0495587_0008616 Ga0495587_0008616_3048_3596 182
147 3300046536 Ga0495587_0391638 Ga0495587_0391638_146_703 182
148 3300046543 Ga0495645_0038925 Ga0495645_0038925_239_787 182
149 3300046543 Ga0495645_0180597 Ga0495645_0180597_145_693 182
150 3300046559 Ga0495667_0369773 Ga0495667_0369773_120_668 182
151 3300046642 Ga0495634_0000616 Ga0495634_0000616_21244_21792 182
152 3300046660 Ga0495625_0269260 Ga0495625_0269260_313_861 182
153 3300046663 Ga0495635_0507917 Ga0495635_0507917_206_754 182
154 3300046674 Ga0495588_0000218 Ga0495588_0000218_34127_34678 182
155 3300046675 Ga0495657_0000005 Ga0495657_0000005_224320_224871 182
156 3300046681 Ga0495647_0000010 Ga0495647_0000010_7117_7674 182
157 3300046681 Ga0495647_0000111 Ga0495647_0000111_7224_7775 182
158 3300046683 Ga0495658_0000965 Ga0495658_0000965_2576_3127 182
159 3300046689 Ga0495613_0000131 Ga0495613_0000131_27066_27617 182
160 3300046689 Ga0495613_0203237 Ga0495613_0203237_628_1176 182
161 3300046689 Ga0495613_0291315 Ga0495613_0291315_468_1016 182
162 3300046690 Ga0495624_0000778 Ga0495624_0000778_932_1483 182
163 3300046690 Ga0495624_0029189 Ga0495624_0029189_291_848 182
164 3300046809 Ga0495600_0020345 Ga0495600_0020345_3132_3683 182
165 3300046809 Ga0495600_0085500 Ga0495600_0085500_1131_1679 182
166 3300047317 Ga0495604_0035697 Ga0495604_0035697_2069_2620 182
167 3300047317 Ga0495604_0187293 Ga0495604_0187293_796_1353 182
168 3300047322 Ga0495680_0113850 Ga0495680_0113850_487_1035 182
169 3300047444 Ga0495675_0000004 Ga0495675_0000004_21130_21681 182
170 3300047469 Ga0495673_0016617 Ga0495673_0016617_2246_2794 182
171 3300047472 Ga0495686_0087808 Ga0495686_0087808_1264_1812 182
172 3300047673 Ga0495593_0018795 Ga0495593_0018795_1820_2371 182
173 3300047673 Ga0495593_0044212 Ga0495593_0044212_1063_1611 182
174 3300048088 Ga0495602_0000009 Ga0495602_0000009_189395_189946 182
175 3300048088 Ga0495602_0216455 Ga0495602_0216455_480_1028 182
176 3300048088 Ga0495602_0635683 Ga0495602_0635683_166_717 182
177 3300048905 Ga0496102_0000132 Ga0496102_0000132_58345_58893 182
178 3300048906 Ga0496103_0000077 Ga0496103_0000077_44272_44820 182
179 3300048906 Ga0496103_0189323 Ga0496103_0189323_378_926 182
180 3300048907 Ga0496104_0076412 Ga0496104_0076412_430_987 182
181 3300048909 Ga0496106_0000130 Ga0496106_0000130_21416_21973 182
182 3300048910 Ga0496107_0011520 Ga0496107_0011520_3171_3728 182
183 3300048913 Ga0496110_0000015 Ga0496110_0000015_13674_14225 182
184 3300048913 Ga0496110_0016082 Ga0496110_0016082_2789_3340 182
185 3300048913 Ga0496110_0502321 Ga0496110_0502321_463_1011 182
186 3300048914 Ga0496111_0000001 Ga0496111_0000001_160603_161154 182
187 3300048914 Ga0496111_0036242 Ga0496111_0036242_1203_1754 182
188 3300048914 Ga0496111_0085263 Ga0496111_0085263_312_860 182
189 3300048915 Ga0496112_0000250 Ga0496112_0000250_4612_5163 182
190 3300048915 Ga0496112_0788905 Ga0496112_0788905_147_698 182
191 3300048916 Ga0496113_0000039 Ga0496113_0000039_782_1333 182
192 3300048917 Ga0496114_0084282 Ga0496114_0084282_393_947 182
193 3300048917 Ga0496114_0137284 Ga0496114_0137284_858_1406 182
194 3300048918 Ga0496115_0000183 Ga0496115_0000183_21954_22502 182
195 3300048918 Ga0496115_0017582 Ga0496115_0017582_1047_1601 182
196 3300049578 Ga0501042_0021689 Ga0501042_0021689_1049_1597 182
197 3300049743 Ga0501081_0749367 Ga0501081_0749367_49_606 182
198 3300053077 Ga0495601_0000042 Ga0495601_0000042_28929_29480 182
199 3300053077 Ga0495601_0474048 Ga0495601_0474048_216_764 182
200 3300053078 Ga0495612_0003776 Ga0495612_0003776_2210_2761 182
201 3300053078 Ga0495612_0011513 Ga0495612_0011513_1383_1931 182
202 3300053083 Ga0495655_0000009 Ga0495655_0000009_21623_22171 182
203 3300053084 Ga0495595_0000005 Ga0495595_0000005_228120_228671 182
204 3300053084 Ga0495595_0004027 Ga0495595_0004027_3845_4396 182
205 3300053085 Ga0495619_0000040 Ga0495619_0000040_33018_33569 182
206 3300053085 Ga0495619_0000126 Ga0495619_0000126_25640_26191 182
207 3300053085 Ga0495619_0581672 Ga0495619_0581672_11_559 182
208 3300053094 Ga0500566_0017835 Ga0500566_0017835_2596_3144 182
209 3300053096 Ga0500641_0002279 Ga0500641_0002279_5550_6098 182
210 3300053129 Ga0500628_000078 Ga0500628_000078_22927_23475 182
211 3300053129 Ga0500628_105812 Ga0500628_105812_144_692 182
212 3300005337 Ga0070682_100000038 Ga0070682_100000038117 183
213 3300009176 Ga0105242_10267866 Ga0105242_102678662 183
214 3300009551 Ga0105238_10000014 Ga0105238_10000014116 183
215 3300013296 Ga0157374_10501595 Ga0157374_105015952 183
216 3300025910 Ga0207684_10225591 Ga0207684_102255912 183
217 3300025924 Ga0207694_10000008 Ga0207694_10000008122 183
218 3300046458 Ga0495591_040724 Ga0495591_040724_715_1275 183
219 3300046694 Ga0495649_0001406 Ga0495649_0001406_913_1473 183
220 3300047321 Ga0495676_0003442 Ga0495676_0003442_7109_7669 183
221 3300047322 Ga0495680_0009372 Ga0495680_0009372_4622_5179 183
222 3300047446 Ga0495679_022610 Ga0495679_022610_1517_2077 183
223 3300035172 Ga0373955_0066879 Ga0373955_0066879_1351_1917 185
224 3300044901 Ga0466960_0178396 Ga0466960_0178396_171_731 185
225 3300046678 Ga0495599_0027864 Ga0495599_0027864_889_1455 185
226 3300046809 Ga0495600_0328004 Ga0495600_0328004_267_833 185
227 3300048915 Ga0496112_0000002 Ga0496112_0000002_291111_291671 185
228 3300005329 Ga0070683_100009632 Ga0070683_1000096327 186
229 3300005338 Ga0068868_100559554 Ga0068868_1005595541 186
230 3300005353 Ga0070669_100342240 Ga0070669_1003422401 186
231 3300005356 Ga0070674_100000026 Ga0070674_10000002680 186
232 3300005364 Ga0070673_100031221 Ga0070673_1000312213 186
233 3300005406 Ga0070703_10035246 Ga0070703_100352461 186
234 3300005441 Ga0070700_100182333 Ga0070700_1001823332 186
235 3300005459 Ga0068867_100000246 Ga0068867_1000002462 186
236 3300005535 Ga0070684_100035874 Ga0070684_1000358745 186
237 3300005547 Ga0070693_100001059 Ga0070693_1000010595 186
238 3300005547 Ga0070693_100166310 Ga0070693_1001663102 186
239 3300005578 Ga0068854_100056128 Ga0068854_1000561282 186
240 3300005718 Ga0068866_10000006 Ga0068866_10000006127 186
241 3300005983 Ga0081540_1127277 Ga0081540_11272772 186
242 3300006163 Ga0070715_10000003 Ga0070715_10000003183 186
243 3300009098 Ga0105245_10000049 Ga0105245_10000049125 186
244 3300009098 Ga0105245_10000508 Ga0105245_1000050815 186
245 3300009098 Ga0105245_10314468 Ga0105245_103144682 186
246 3300011119 Ga0105246_10159912 Ga0105246_101599123 186
247 3300013308 Ga0157375_10385940 Ga0157375_103859402 186
248 3300014968 Ga0157379_10136041 Ga0157379_101360413 186
249 3300025893 Ga0207682_10000007 Ga0207682_1000000735 186
250 3300025899 Ga0207642_10000001 Ga0207642_1000000182 186
251 3300025899 Ga0207642_10000003 Ga0207642_1000000382 186
252 3300025899 Ga0207642_10000004 Ga0207642_1000000482 186
253 3300025905 Ga0207685_10000003 Ga0207685_10000003181 186
254 3300025923 Ga0207681_10256130 Ga0207681_102561302 186
255 3300025927 Ga0207687_10000012 Ga0207687_10000012367 186
256 3300025927 Ga0207687_10001866 Ga0207687_1000186614 186
257 3300025927 Ga0207687_10469116 Ga0207687_104691162 186
258 3300025933 Ga0207706_10000302 Ga0207706_1000030231 186
259 3300025937 Ga0207669_10000041 Ga0207669_100000415 186
260 3300025944 Ga0207661_10009099 Ga0207661_100090994 186
261 3300025960 Ga0207651_10016005 Ga0207651_100160054 186
262 3300025981 Ga0207640_10043926 Ga0207640_100439263 186
263 3300026075 Ga0207708_10305837 Ga0207708_103058372 186
264 3300026089 Ga0207648_10000783 Ga0207648_1000078339 186
265 3300028381 Ga0268264_10003844 Ga0268264_1000384412 186
266 3300046461 Ga0495641_0000095 Ga0495641_0000095_35579_36148 186
267 3300046511 Ga0495608_0011638 Ga0495608_0011638_2684_3253 186
268 3300047322 Ga0495680_0000873 Ga0495680_0000873_26985_27554 186
269 3300047469 Ga0495673_0039581 Ga0495673_0039581_1418_1987 186
270 3300048907 Ga0496104_0000003 Ga0496104_0000003_558292_558861 186
271 3300048908 Ga0496105_0000003 Ga0496105_0000003_627260_627829 186
272 3300048909 Ga0496106_0200505 Ga0496106_0200505_286_855 186
273 3300048911 Ga0496108_0000002 Ga0496108_0000002_635553_636122 186
274 3300048912 Ga0496109_0000001 Ga0496109_0000001_635515_636084 186
275 3300048913 Ga0496110_0095743 Ga0496110_0095743_1508_2077 186
276 3300049587 Ga0501071_0073671 Ga0501071_0073671_113_682 186
277 3300049591 Ga0501075_0000897 Ga0501075_0000897_5060_5632 186
278 3300053077 Ga0495601_0000296 Ga0495601_0000296_15115_15684 186
279 3300053085 Ga0495619_0007234 Ga0495619_0007234_2666_3235 186
280 3300053123 Ga0500614_000806 Ga0500614_000806_2738_3307 186
281 3300049744 Ga0501083_0150022 Ga0501083_0150022_794_1387 189
282 3300025934 Ga0207686_10001249 Ga0207686_100012496 190
283 3300046663 Ga0495635_0128537 Ga0495635_0128537_321_917 193
284 3300046463 Ga0495653_0144782 Ga0495653_0144782_44_646 195
285 3300046516 Ga0495628_0019162 Ga0495628_0019162_4584_5198 198
286 3300048911 Ga0496108_0000339 Ga0496108_0000339_37776_38393 199
287 3300048912 Ga0496109_0001321 Ga0496109_0001321_15607_16224 199
288 3300002074 JGI24748J21848_1000142 JGI24748J21848_10001426 201
289 3300002239 JGI24034J26672_10000275 JGI24034J26672_100002753 201
290 3300002244 JGI24742J22300_10005389 JGI24742J22300_100053893 201

Structural Annotation

Top 5 Hits

ID Description Score Start End
8an4-assembly1.cif.gz_A ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.7781 3 178
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.7727 3 175
8an5-assembly1.cif.gz_A menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.7695 3 178
8an4-assembly2.cif.gz_B ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.757 1 181
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.7279 3 175
ID Description Score Start End Superfamily
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7975 1 145 3.30.460.40
af_P12945_549_762_1.25.40.1010 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.7514 142 184 1.25.40.1010
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7328 1 145 3.30.460.40
af_O74467_142_271_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.69 136 174 1.25.40.10
af_F4HUW0_97_242_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.685 6 94 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A3S5J923-F1-model_v4 deleted 0.9762 3 91
AF-A0A3S5J923-F1-model_v4 deleted 0.9552 3 91
AF-T0ZX38-F1-model_v4 Uncharacterized protein 0.9464 1 96
AF-T0YTH8-F1-model_v4 Protein containing DUF1814 0.9434 3 177
AF-A0A7W1S2D8-F1-model_v4 deleted 0.9408 4 182

Feature Viewer

pLDDT pTM Quality
88.65 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map