F389995
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 183 | 290 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0076412|Ga0496104_0076412_430_987 |
| Length | 185 |
| Sequence | MNELIEKLLTIHEALKSQSLPHAFGGAIALAYCVEEPRGTRDLDLNIFIDAANAERALEALPEGVRVTDADIEAVKRDGQTRLFWDGVPVDLFLNNLPLHEEVAHRVVWVPAPLSKGKEIPVLDCASLVVFKSFFDRYRDWGDIEAVAQATPEDVDAAMKTVAGLVGEDAPVYRKLAELATSSRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 105 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 108 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 109 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 110 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 111 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 112 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 113 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 163 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 164 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 181 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 182 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 183 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.72 |
| Nodule | 0 |
| Rhizoplane | 11.03 |
| Rhizosphere | 86.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000142 | 3300002074 | Bacteria | 12113 |
| 2 | JGI24034J26672_10000275 | 3300002239 | Bacteria | 6784 |
| 3 | JGI24742J22300_10005389 | 3300002244 | Bacteria | 2103 |
| 4 | JGI25404J52841_10002738 | 3300003659 | Bacteria | 3383 |
| 5 | JGI25405J52794_10079462 | 3300003911 | Unclassified | 721 |
| 6 | Ga0070683_100002346 | 3300005329 | Bacteria | 15022 |
| 7 | Ga0070683_100009632 | 3300005329 | Bacteria | 8268 |
| 8 | Ga0070683_100109365 | 3300005329 | Bacteria | 2607 |
| 9 | Ga0070690_100221211 | 3300005330 | Bacteria | 1327 |
| 10 | Ga0070670_100587358 | 3300005331 | Bacteria | 996 |
| 11 | Ga0070666_10039509 | 3300005335 | Bacteria | 3146 |
| 12 | Ga0070682_100000038 | 3300005337 | Bacteria | 145670 |
| 13 | Ga0070682_100000072 | 3300005337 | Bacteria | 93808 |
| 14 | Ga0068868_100559554 | 3300005338 | Unclassified | 1009 |
| 15 | Ga0070689_100078874 | 3300005340 | Unclassified | 2582 |
| 16 | Ga0070668_100273622 | 3300005347 | Bacteria | 1408 |
| 17 | Ga0070669_100342240 | 3300005353 | Bacteria | 1212 |
| 18 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 19 | Ga0070674_100000001 | 3300005356 | Bacteria | 277173 |
| 20 | Ga0070674_100000026 | 3300005356 | Bacteria | 77168 |
| 21 | Ga0070673_100031221 | 3300005364 | Bacteria | 3996 |
| 22 | Ga0070688_100000018 | 3300005365 | Bacteria | 72357 |
| 23 | Ga0070659_100056089 | 3300005366 | Bacteria | 3106 |
| 24 | Ga0070703_10035246 | 3300005406 | Bacteria | 1531 |
| 25 | Ga0070714_100029048 | 3300005435 | Bacteria | 4594 |
| 26 | Ga0070714_100098529 | 3300005435 | Bacteria | 2572 |
| 27 | Ga0070713_100000061 | 3300005436 | Bacteria | 68662 |
| 28 | Ga0070713_100229994 | 3300005436 | Bacteria | 1685 |
| 29 | Ga0070711_100390156 | 3300005439 | Unclassified | 1128 |
| 30 | Ga0070700_100182333 | 3300005441 | Archaea | 1462 |
| 31 | Ga0070700_100349782 | 3300005441 | Bacteria | 1095 |
| 32 | Ga0070700_100700312 | 3300005441 | Unclassified | 805 |
| 33 | Ga0070663_100159035 | 3300005455 | Bacteria | 1738 |
| 34 | Ga0070663_100703284 | 3300005455 | Unclassified | 859 |
| 35 | Ga0068867_100000246 | 3300005459 | Bacteria | 35737 |
| 36 | Ga0070685_10000437 | 3300005466 | Bacteria | 24303 |
| 37 | Ga0070685_10421945 | 3300005466 | Bacteria | 928 |
| 38 | Ga0070706_100006320 | 3300005467 | Bacteria | 11194 |
| 39 | Ga0070707_100144255 | 3300005468 | Bacteria | 2317 |
| 40 | Ga0070684_100029006 | 3300005535 | Bacteria | 4685 |
| 41 | Ga0070684_100035874 | 3300005535 | Bacteria | 4247 |
| 42 | Ga0068853_100005229 | 3300005539 | Bacteria | 10153 |
| 43 | Ga0068853_100090526 | 3300005539 | Bacteria | 2689 |
| 44 | Ga0070686_100060387 | 3300005544 | Bacteria | 2446 |
| 45 | Ga0070686_100100012 | 3300005544 | Unclassified | 1957 |
| 46 | Ga0070686_100438786 | 3300005544 | Bacteria | 1001 |
| 47 | Ga0070695_100289587 | 3300005545 | Unclassified | 1207 |
| 48 | Ga0070696_100283912 | 3300005546 | Unclassified | 1263 |
| 49 | Ga0070693_100001059 | 3300005547 | Bacteria | 12294 |
| 50 | Ga0070693_100166310 | 3300005547 | Bacteria | 1409 |
| 51 | Ga0070665_100030614 | 3300005548 | Bacteria | 5414 |
| 52 | Ga0068854_100000044 | 3300005578 | Bacteria | 91882 |
| 53 | Ga0068854_100056128 | 3300005578 | Bacteria | 2838 |
| 54 | Ga0068854_100760935 | 3300005578 | Unclassified | 841 |
| 55 | Ga0068852_100000050 | 3300005616 | Bacteria | 84306 |
| 56 | Ga0068864_100000201 | 3300005618 | Bacteria | 54044 |
| 57 | Ga0068866_10000006 | 3300005718 | Bacteria | 176129 |
| 58 | Ga0068866_10000055 | 3300005718 | Bacteria | 44369 |
| 59 | Ga0068866_10001565 | 3300005718 | Bacteria | 9730 |
| 60 | Ga0068863_100000039 | 3300005841 | Bacteria | 161450 |
| 61 | Ga0068860_100329495 | 3300005843 | Bacteria | 1500 |
| 62 | Ga0081455_10038227 | 3300005937 | Bacteria | 4251 |
| 63 | Ga0081540_1000044 | 3300005983 | Bacteria | 134269 |
| 64 | Ga0081540_1127277 | 3300005983 | Unclassified | 1046 |
| 65 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 66 | Ga0075428_101072449 | 3300006844 | Bacteria | 851 |
| 67 | Ga0068865_100489822 | 3300006881 | Bacteria | 1023 |
| 68 | Ga0075435_101028528 | 3300007076 | Unclassified | 719 |
| 69 | Ga0111539_10069335 | 3300009094 | Bacteria | 4163 |
| 70 | Ga0105245_10000049 | 3300009098 | Bacteria | 128277 |
| 71 | Ga0105245_10000508 | 3300009098 | Bacteria | 35724 |
| 72 | Ga0105245_10314468 | 3300009098 | Unclassified | 1541 |
| 73 | Ga0114129_10126177 | 3300009147 | Bacteria | 3518 |
| 74 | Ga0105243_10112300 | 3300009148 | Bacteria | 2283 |
| 75 | Ga0105243_10243920 | 3300009148 | Bacteria | 1600 |
| 76 | Ga0105242_10000403 | 3300009176 | Bacteria | 34337 |
| 77 | Ga0105242_10042435 | 3300009176 | Bacteria | 3673 |
| 78 | Ga0105242_10149427 | 3300009176 | Bacteria | 2036 |
| 79 | Ga0105242_10267866 | 3300009176 | Bacteria | 1546 |
| 80 | Ga0105248_10000267 | 3300009177 | Bacteria | 61244 |
| 81 | Ga0105238_10000014 | 3300009551 | Bacteria | 241954 |
| 82 | Ga0105249_10731216 | 3300009553 | Unclassified | 1051 |
| 83 | Ga0105239_10035301 | 3300010375 | Bacteria | 5492 |
| 84 | Ga0105239_11120379 | 3300010375 | Bacteria | 906 |
| 85 | Ga0105246_10159912 | 3300011119 | Bacteria | 1715 |
| 86 | Ga0157370_10009506 | 3300013104 | Bacteria | 10374 |
| 87 | Ga0157374_10501595 | 3300013296 | Unclassified | 1218 |
| 88 | Ga0157378_10026417 | 3300013297 | Bacteria | 5118 |
| 89 | Ga0157372_10694564 | 3300013307 | Bacteria | 1184 |
| 90 | Ga0157375_10000942 | 3300013308 | Bacteria | 25237 |
| 91 | Ga0157375_10322669 | 3300013308 | Bacteria | 1709 |
| 92 | Ga0157375_10352815 | 3300013308 | Bacteria | 1637 |
| 93 | Ga0157375_10385940 | 3300013308 | Bacteria | 1567 |
| 94 | Ga0157375_10710843 | 3300013308 | Unclassified | 1158 |
| 95 | Ga0157380_10000009 | 3300014326 | Bacteria | 142155 |
| 96 | Ga0157380_10431505 | 3300014326 | Bacteria | 1260 |
| 97 | Ga0157379_10136041 | 3300014968 | Bacteria | 2214 |
| 98 | Ga0163161_10240963 | 3300017792 | Bacteria | 1406 |
| 99 | Ga0206356_11281601 | 3300020070 | Bacteria | 4126 |
| 100 | Ga0207682_10000007 | 3300025893 | Bacteria | 88967 |
| 101 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 102 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 103 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 104 | Ga0207642_10001353 | 3300025899 | Bacteria | 7604 |
| 105 | Ga0207642_10049872 | 3300025899 | Bacteria | 1885 |
| 106 | Ga0207680_10015963 | 3300025903 | Bacteria | 3932 |
| 107 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 108 | Ga0207684_10002595 | 3300025910 | Bacteria | 18094 |
| 109 | Ga0207684_10225591 | 3300025910 | Bacteria | 1617 |
| 110 | Ga0207663_10137799 | 3300025916 | Unclassified | 1696 |
| 111 | Ga0207646_10055638 | 3300025922 | Bacteria | 3537 |
| 112 | Ga0207681_10256130 | 3300025923 | Bacteria | 1368 |
| 113 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 114 | Ga0207650_10442349 | 3300025925 | Bacteria | 1081 |
| 115 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 116 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 117 | Ga0207687_10001866 | 3300025927 | Bacteria | 14507 |
| 118 | Ga0207687_10469116 | 3300025927 | Bacteria | 1046 |
| 119 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 120 | Ga0207700_10230635 | 3300025928 | Bacteria | 1574 |
| 121 | Ga0207664_10033143 | 3300025929 | Bacteria | 3966 |
| 122 | Ga0207690_10021359 | 3300025932 | Bacteria | 4014 |
| 123 | Ga0207706_10000302 | 3300025933 | Bacteria | 53541 |
| 124 | Ga0207686_10000029 | 3300025934 | Bacteria | 160239 |
| 125 | Ga0207686_10001249 | 3300025934 | Bacteria | 14701 |
| 126 | Ga0207686_10009233 | 3300025934 | Bacteria | 5346 |
| 127 | Ga0207709_10019930 | 3300025935 | Bacteria | 3778 |
| 128 | Ga0207670_10084066 | 3300025936 | Unclassified | 2234 |
| 129 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 130 | Ga0207669_10000041 | 3300025937 | Bacteria | 67085 |
| 131 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 132 | Ga0207661_10000925 | 3300025944 | Bacteria | 19251 |
| 133 | Ga0207661_10009099 | 3300025944 | Bacteria | 7118 |
| 134 | Ga0207661_10110161 | 3300025944 | Bacteria | 2327 |
| 135 | Ga0207651_10016005 | 3300025960 | Bacteria | 4377 |
| 136 | Ga0207640_10000517 | 3300025981 | Bacteria | 23263 |
| 137 | Ga0207640_10043926 | 3300025981 | Bacteria | 2860 |
| 138 | Ga0207677_10000671 | 3300026023 | Bacteria | 20346 |
| 139 | Ga0207639_10000838 | 3300026041 | Bacteria | 20868 |
| 140 | Ga0207678_10050439 | 3300026067 | Bacteria | 3595 |
| 141 | Ga0207678_10287000 | 3300026067 | Bacteria | 1413 |
| 142 | Ga0207708_10253446 | 3300026075 | Unclassified | 1419 |
| 143 | Ga0207708_10305837 | 3300026075 | Archaea | 1294 |
| 144 | Ga0207641_10000065 | 3300026088 | Bacteria | 156066 |
| 145 | Ga0207648_10000783 | 3300026089 | Bacteria | 35821 |
| 146 | Ga0207676_10000026 | 3300026095 | Bacteria | 248593 |
| 147 | Ga0207698_10000009 | 3300026142 | Bacteria | 281300 |
| 148 | Ga0268266_10011831 | 3300028379 | Bacteria | 7561 |
| 149 | Ga0268266_10325560 | 3300028379 | Bacteria | 1439 |
| 150 | Ga0268264_10003844 | 3300028381 | Bacteria | 12882 |
| 151 | Ga0268264_10245755 | 3300028381 | Bacteria | 1660 |
| 152 | Ga0265319_1000091 | 3300028563 | Bacteria | 70394 |
| 153 | Ga0265338_10000752 | 3300028800 | Bacteria | 55238 |
| 154 | Ga0265325_10003985 | 3300031241 | Bacteria | 9448 |
| 155 | Ga0373955_0066879 | 3300035172 | Bacteria | 1999 |
| 156 | Ga0373937_0086041 | 3300036401 | Bacteria | 2909 |
| 157 | Ga0451789_1225635 | 3300041443 | Bacteria | 1041 |
| 158 | Ga0451849_0896956 | 3300041505 | Bacteria | 1076 |
| 159 | Ga0439446_0151542 | 3300042156 | Unclassified | 763 |
| 160 | Ga0466957_0000824 | 3300044842 | Bacteria | 15816 |
| 161 | Ga0466960_0178396 | 3300044901 | Bacteria | 1150 |
| 162 | Ga0466967_0000123 | 3300045976 | Bacteria | 29223 |
| 163 | Ga0495603_0001846 | 3300046455 | Bacteria | 12499 |
| 164 | Ga0495591_040724 | 3300046458 | Bacteria | 1323 |
| 165 | Ga0495629_0014026 | 3300046459 | Bacteria | 5775 |
| 166 | Ga0495629_0093444 | 3300046459 | Bacteria | 2099 |
| 167 | Ga0495641_0000095 | 3300046461 | Bacteria | 60441 |
| 168 | Ga0495641_0012922 | 3300046461 | Bacteria | 4630 |
| 169 | Ga0495653_0144782 | 3300046463 | Bacteria | 1667 |
| 170 | Ga0495662_0001723 | 3300046476 | Bacteria | 10927 |
| 171 | Ga0495662_0031586 | 3300046476 | Bacteria | 2558 |
| 172 | Ga0495596_0017523 | 3300046500 | Bacteria | 2963 |
| 173 | Ga0495606_0000294 | 3300046507 | Bacteria | 85998 |
| 174 | Ga0495608_0000010 | 3300046511 | Bacteria | 258660 |
| 175 | Ga0495608_0011638 | 3300046511 | Bacteria | 6120 |
| 176 | Ga0495618_0501438 | 3300046514 | Bacteria | 732 |
| 177 | Ga0495628_0019162 | 3300046516 | Bacteria | 5659 |
| 178 | Ga0495628_0245954 | 3300046516 | Bacteria | 1336 |
| 179 | Ga0495628_0370800 | 3300046516 | Bacteria | 1050 |
| 180 | Ga0495630_0000082 | 3300046517 | Bacteria | 75280 |
| 181 | Ga0495644_0001672 | 3300046523 | Bacteria | 9001 |
| 182 | Ga0495652_0061979 | 3300046529 | Bacteria | 3155 |
| 183 | Ga0495586_0000234 | 3300046535 | Bacteria | 36813 |
| 184 | Ga0495587_0008616 | 3300046536 | Bacteria | 6557 |
| 185 | Ga0495587_0391638 | 3300046536 | Unclassified | 772 |
| 186 | Ga0495645_0038925 | 3300046543 | Bacteria | 3468 |
| 187 | Ga0495645_0180597 | 3300046543 | Bacteria | 1446 |
| 188 | Ga0495667_0369773 | 3300046559 | Bacteria | 905 |
| 189 | Ga0495656_0009207 | 3300046615 | Bacteria | 3547 |
| 190 | Ga0495634_0000616 | 3300046642 | Bacteria | 34537 |
| 191 | Ga0495634_0028409 | 3300046642 | Bacteria | 3883 |
| 192 | Ga0495625_0269260 | 3300046660 | Bacteria | 1100 |
| 193 | Ga0495635_0128537 | 3300046663 | Unclassified | 1727 |
| 194 | Ga0495635_0507917 | 3300046663 | Unclassified | 793 |
| 195 | Ga0495588_0000218 | 3300046674 | Bacteria | 54328 |
| 196 | Ga0495657_0000005 | 3300046675 | Bacteria | 254860 |
| 197 | Ga0495657_0243722 | 3300046675 | Unclassified | 1084 |
| 198 | Ga0495599_0027864 | 3300046678 | Bacteria | 3539 |
| 199 | Ga0495599_0271058 | 3300046678 | Bacteria | 1030 |
| 200 | Ga0495647_0000010 | 3300046681 | Bacteria | 94696 |
| 201 | Ga0495647_0000111 | 3300046681 | Bacteria | 20557 |
| 202 | Ga0495658_0000965 | 3300046683 | Bacteria | 15281 |
| 203 | Ga0495613_0000131 | 3300046689 | Bacteria | 74262 |
| 204 | Ga0495613_0203237 | 3300046689 | Bacteria | 1396 |
| 205 | Ga0495613_0291315 | 3300046689 | Unclassified | 1132 |
| 206 | Ga0495624_0000778 | 3300046690 | Bacteria | 25141 |
| 207 | Ga0495624_0029189 | 3300046690 | Bacteria | 3600 |
| 208 | Ga0495649_0001406 | 3300046694 | Bacteria | 18177 |
| 209 | Ga0495600_0020345 | 3300046809 | Bacteria | 4245 |
| 210 | Ga0495600_0085500 | 3300046809 | Bacteria | 2058 |
| 211 | Ga0495600_0276381 | 3300046809 | Bacteria | 1064 |
| 212 | Ga0495600_0328004 | 3300046809 | Unclassified | 962 |
| 213 | Ga0495604_0035697 | 3300047317 | Bacteria | 3924 |
| 214 | Ga0495604_0187293 | 3300047317 | Bacteria | 1444 |
| 215 | Ga0495676_0003442 | 3300047321 | Bacteria | 14318 |
| 216 | Ga0495680_0000873 | 3300047322 | Bacteria | 33510 |
| 217 | Ga0495680_0009372 | 3300047322 | Bacteria | 8811 |
| 218 | Ga0495680_0113850 | 3300047322 | Bacteria | 2002 |
| 219 | Ga0495675_0000004 | 3300047444 | Bacteria | 211049 |
| 220 | Ga0495679_022610 | 3300047446 | Unclassified | 2148 |
| 221 | Ga0495673_0016617 | 3300047469 | Bacteria | 3758 |
| 222 | Ga0495673_0039581 | 3300047469 | Bacteria | 2137 |
| 223 | Ga0495686_0000008 | 3300047472 | Bacteria | 727479 |
| 224 | Ga0495686_0024231 | 3300047472 | Bacteria | 3991 |
| 225 | Ga0495686_0087808 | 3300047472 | Bacteria | 1891 |
| 226 | Ga0495593_0018795 | 3300047673 | Bacteria | 3880 |
| 227 | Ga0495593_0044212 | 3300047673 | Bacteria | 2383 |
| 228 | Ga0495602_0000009 | 3300048088 | Bacteria | 258991 |
| 229 | Ga0495602_0216455 | 3300048088 | Bacteria | 1449 |
| 230 | Ga0495602_0635683 | 3300048088 | Unclassified | 730 |
| 231 | Ga0496100_0234374 | 3300048903 | Bacteria | 1352 |
| 232 | Ga0496102_0000132 | 3300048905 | Bacteria | 103176 |
| 233 | Ga0496103_0000077 | 3300048906 | Bacteria | 112223 |
| 234 | Ga0496103_0189323 | 3300048906 | Bacteria | 1323 |
| 235 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 236 | Ga0496104_0076412 | 3300048907 | Bacteria | 3190 |
| 237 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 238 | Ga0496106_0000130 | 3300048909 | Bacteria | 57887 |
| 239 | Ga0496106_0200505 | 3300048909 | Unclassified | 1588 |
| 240 | Ga0496107_0011520 | 3300048910 | Bacteria | 6161 |
| 241 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 242 | Ga0496108_0000339 | 3300048911 | Bacteria | 39428 |
| 243 | Ga0496108_0014574 | 3300048911 | Bacteria | 6417 |
| 244 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 245 | Ga0496109_0001321 | 3300048912 | Bacteria | 20438 |
| 246 | Ga0496110_0000015 | 3300048913 | Bacteria | 85373 |
| 247 | Ga0496110_0016082 | 3300048913 | Bacteria | 6239 |
| 248 | Ga0496110_0095743 | 3300048913 | Bacteria | 2659 |
| 249 | Ga0496110_0502321 | 3300048913 | Bacteria | 1104 |
| 250 | Ga0496111_0000001 | 3300048914 | Bacteria | 194837 |
| 251 | Ga0496111_0036242 | 3300048914 | Bacteria | 3526 |
| 252 | Ga0496111_0085263 | 3300048914 | Bacteria | 2310 |
| 253 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 254 | Ga0496112_0000250 | 3300048915 | Bacteria | 34271 |
| 255 | Ga0496112_0788905 | 3300048915 | Bacteria | 875 |
| 256 | Ga0496113_0000039 | 3300048916 | Bacteria | 55926 |
| 257 | Ga0496113_0022010 | 3300048916 | Bacteria | 4503 |
| 258 | Ga0496114_0084282 | 3300048917 | Bacteria | 2691 |
| 259 | Ga0496114_0137284 | 3300048917 | Bacteria | 2115 |
| 260 | Ga0496115_0000183 | 3300048918 | Bacteria | 58406 |
| 261 | Ga0496115_0017582 | 3300048918 | Bacteria | 5471 |
| 262 | Ga0501042_0021689 | 3300049578 | Bacteria | 4479 |
| 263 | Ga0501042_0082073 | 3300049578 | Bacteria | 2311 |
| 264 | Ga0501071_0073671 | 3300049587 | Bacteria | 2491 |
| 265 | Ga0501075_0000897 | 3300049591 | Bacteria | 18804 |
| 266 | Ga0501081_0749367 | 3300049743 | Bacteria | 734 |
| 267 | Ga0501083_0150022 | 3300049744 | Bacteria | 1526 |
| 268 | nmdc:mga05p37_199991_c1 | 3300050507 | Bacteria | 2421 |
| 269 | nmdc:mga0rr50_388674_c1 | 3300050513 | Bacteria | 1177 |
| 270 | Ga0495601_0000042 | 3300053077 | Bacteria | 77373 |
| 271 | Ga0495601_0000296 | 3300053077 | Bacteria | 26491 |
| 272 | Ga0495601_0322299 | 3300053077 | Bacteria | 1006 |
| 273 | Ga0495601_0474048 | 3300053077 | Unclassified | 809 |
| 274 | Ga0495612_0003776 | 3300053078 | Bacteria | 6301 |
| 275 | Ga0495612_0011513 | 3300053078 | Bacteria | 3566 |
| 276 | Ga0495655_0000009 | 3300053083 | Bacteria | 150662 |
| 277 | Ga0495595_0000005 | 3300053084 | Bacteria | 258660 |
| 278 | Ga0495595_0004027 | 3300053084 | Bacteria | 5880 |
| 279 | Ga0495619_0000040 | 3300053085 | Bacteria | 118238 |
| 280 | Ga0495619_0000126 | 3300053085 | Bacteria | 56169 |
| 281 | Ga0495619_0002266 | 3300053085 | Bacteria | 12712 |
| 282 | Ga0495619_0007234 | 3300053085 | Bacteria | 7032 |
| 283 | Ga0495619_0073468 | 3300053085 | Bacteria | 2292 |
| 284 | Ga0495619_0083487 | 3300053085 | Bacteria | 2155 |
| 285 | Ga0495619_0581672 | 3300053085 | Unclassified | 767 |
| 286 | Ga0500566_0017835 | 3300053094 | Bacteria | 4167 |
| 287 | Ga0500641_0002279 | 3300053096 | Bacteria | 6808 |
| 288 | Ga0500614_000806 | 3300053123 | Bacteria | 7940 |
| 289 | Ga0500628_000078 | 3300053129 | Bacteria | 24490 |
| 290 | Ga0500628_105812 | 3300053129 | Bacteria | 749 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053085 | Ga0495619_0073468 | Ga0495619_0073468_1083_1580 | 165 |
| 2 | 3300005539 | Ga0068853_100005229 | Ga0068853_1000052298 | 168 |
| 3 | 3300026041 | Ga0207639_10000838 | Ga0207639_100008386 | 168 |
| 4 | 3300047472 | Ga0495686_0024231 | Ga0495686_0024231_1967_2497 | 176 |
| 5 | 3300006844 | Ga0075428_101072449 | Ga0075428_1010724492 | 177 |
| 6 | 3300009094 | Ga0111539_10069335 | Ga0111539_100693353 | 177 |
| 7 | 3300009147 | Ga0114129_10126177 | Ga0114129_101261772 | 177 |
| 8 | 3300050507 | nmdc:mga05p37_199991_c1 | nmdc:mga05p37_199991_c1_398_931 | 177 |
| 9 | 3300005356 | Ga0070674_100000001 | Ga0070674_10000000171 | 178 |
| 10 | 3300005441 | Ga0070700_100349782 | Ga0070700_1003497821 | 178 |
| 11 | 3300005455 | Ga0070663_100703284 | Ga0070663_1007032842 | 178 |
| 12 | 3300005544 | Ga0070686_100438786 | Ga0070686_1004387861 | 178 |
| 13 | 3300005545 | Ga0070695_100289587 | Ga0070695_1002895872 | 178 |
| 14 | 3300005546 | Ga0070696_100283912 | Ga0070696_1002839122 | 178 |
| 15 | 3300005718 | Ga0068866_10000055 | Ga0068866_100000557 | 178 |
| 16 | 3300009148 | Ga0105243_10112300 | Ga0105243_101123003 | 178 |
| 17 | 3300009148 | Ga0105243_10243920 | Ga0105243_102439202 | 178 |
| 18 | 3300009176 | Ga0105242_10042435 | Ga0105242_100424354 | 178 |
| 19 | 3300009176 | Ga0105242_10149427 | Ga0105242_101494273 | 178 |
| 20 | 3300009553 | Ga0105249_10731216 | Ga0105249_107312162 | 178 |
| 21 | 3300013308 | Ga0157375_10000942 | Ga0157375_1000094226 | 178 |
| 22 | 3300013308 | Ga0157375_10322669 | Ga0157375_103226693 | 178 |
| 23 | 3300025899 | Ga0207642_10001353 | Ga0207642_100013537 | 178 |
| 24 | 3300025934 | Ga0207686_10009233 | Ga0207686_100092335 | 178 |
| 25 | 3300025935 | Ga0207709_10019930 | Ga0207709_100199305 | 178 |
| 26 | 3300025937 | Ga0207669_10000002 | Ga0207669_10000002278 | 178 |
| 27 | 3300026067 | Ga0207678_10050439 | Ga0207678_100504392 | 178 |
| 28 | 3300026075 | Ga0207708_10253446 | Ga0207708_102534461 | 178 |
| 29 | 3300042156 | Ga0439446_0151542 | Ga0439446_0151542_186_722 | 178 |
| 30 | 3300046615 | Ga0495656_0009207 | Ga0495656_0009207_1631_2167 | 178 |
| 31 | 3300046809 | Ga0495600_0276381 | Ga0495600_0276381_58_594 | 178 |
| 32 | 3300048911 | Ga0496108_0014574 | Ga0496108_0014574_38_574 | 178 |
| 33 | 3300049578 | Ga0501042_0082073 | Ga0501042_0082073_1399_1935 | 178 |
| 34 | 3300005618 | Ga0068864_100000201 | Ga0068864_10000020134 | 179 |
| 35 | 3300007076 | Ga0075435_101028528 | Ga0075435_1010285282 | 179 |
| 36 | 3300026095 | Ga0207676_10000026 | Ga0207676_10000026212 | 179 |
| 37 | 3300036401 | Ga0373937_0086041 | Ga0373937_0086041_284_832 | 179 |
| 38 | 3300046455 | Ga0495603_0001846 | Ga0495603_0001846_6575_7114 | 179 |
| 39 | 3300046514 | Ga0495618_0501438 | Ga0495618_0501438_127_666 | 179 |
| 40 | 3300046516 | Ga0495628_0370800 | Ga0495628_0370800_27_566 | 179 |
| 41 | 3300046517 | Ga0495630_0000082 | Ga0495630_0000082_52065_52604 | 179 |
| 42 | 3300046642 | Ga0495634_0028409 | Ga0495634_0028409_1491_2030 | 179 |
| 43 | 3300046678 | Ga0495599_0271058 | Ga0495599_0271058_244_783 | 179 |
| 44 | 3300048903 | Ga0496100_0234374 | Ga0496100_0234374_411_953 | 179 |
| 45 | 3300048916 | Ga0496113_0022010 | Ga0496113_0022010_461_1000 | 179 |
| 46 | 3300050513 | nmdc:mga0rr50_388674_c1 | nmdc:mga0rr50_388674_c1_526_1068 | 179 |
| 47 | 3300053077 | Ga0495601_0322299 | Ga0495601_0322299_42_581 | 179 |
| 48 | 3300053085 | Ga0495619_0002266 | Ga0495619_0002266_8944_9483 | 179 |
| 49 | 3300005467 | Ga0070706_100006320 | Ga0070706_10000632011 | 180 |
| 50 | 3300005468 | Ga0070707_100144255 | Ga0070707_1001442552 | 180 |
| 51 | 3300025910 | Ga0207684_10002595 | Ga0207684_100025957 | 180 |
| 52 | 3300025922 | Ga0207646_10055638 | Ga0207646_100556382 | 180 |
| 53 | 3300046675 | Ga0495657_0243722 | Ga0495657_0243722_516_1058 | 180 |
| 54 | 3300047472 | Ga0495686_0000008 | Ga0495686_0000008_724199_724741 | 180 |
| 55 | 3300053085 | Ga0495619_0083487 | Ga0495619_0083487_510_1052 | 180 |
| 56 | 3300005331 | Ga0070670_100587358 | Ga0070670_1005873582 | 181 |
| 57 | 3300005340 | Ga0070689_100078874 | Ga0070689_1000788743 | 181 |
| 58 | 3300005365 | Ga0070688_100000018 | Ga0070688_10000001871 | 181 |
| 59 | 3300005436 | Ga0070713_100000061 | Ga0070713_10000006130 | 181 |
| 60 | 3300005436 | Ga0070713_100229994 | Ga0070713_1002299942 | 181 |
| 61 | 3300005439 | Ga0070711_100390156 | Ga0070711_1003901561 | 181 |
| 62 | 3300005466 | Ga0070685_10000437 | Ga0070685_100004378 | 181 |
| 63 | 3300005466 | Ga0070685_10421945 | Ga0070685_104219452 | 181 |
| 64 | 3300025916 | Ga0207663_10137799 | Ga0207663_101377993 | 181 |
| 65 | 3300025925 | Ga0207650_10442349 | Ga0207650_104423492 | 181 |
| 66 | 3300025928 | Ga0207700_10000016 | Ga0207700_10000016106 | 181 |
| 67 | 3300025928 | Ga0207700_10230635 | Ga0207700_102306353 | 181 |
| 68 | 3300025936 | Ga0207670_10084066 | Ga0207670_100840663 | 181 |
| 69 | 3300003659 | JGI25404J52841_10002738 | JGI25404J52841_100027385 | 182 |
| 70 | 3300003911 | JGI25405J52794_10079462 | JGI25405J52794_100794622 | 182 |
| 71 | 3300005329 | Ga0070683_100002346 | Ga0070683_1000023467 | 182 |
| 72 | 3300005329 | Ga0070683_100109365 | Ga0070683_1001093653 | 182 |
| 73 | 3300005330 | Ga0070690_100221211 | Ga0070690_1002212112 | 182 |
| 74 | 3300005335 | Ga0070666_10039509 | Ga0070666_100395093 | 182 |
| 75 | 3300005337 | Ga0070682_100000072 | Ga0070682_10000007259 | 182 |
| 76 | 3300005347 | Ga0070668_100273622 | Ga0070668_1002736221 | 182 |
| 77 | 3300005354 | Ga0070675_100000008 | Ga0070675_100000008151 | 182 |
| 78 | 3300005366 | Ga0070659_100056089 | Ga0070659_1000560894 | 182 |
| 79 | 3300005435 | Ga0070714_100029048 | Ga0070714_1000290484 | 182 |
| 80 | 3300005435 | Ga0070714_100098529 | Ga0070714_1000985292 | 182 |
| 81 | 3300005441 | Ga0070700_100700312 | Ga0070700_1007003122 | 182 |
| 82 | 3300005455 | Ga0070663_100159035 | Ga0070663_1001590353 | 182 |
| 83 | 3300005535 | Ga0070684_100029006 | Ga0070684_1000290062 | 182 |
| 84 | 3300005539 | Ga0068853_100090526 | Ga0068853_1000905262 | 182 |
| 85 | 3300005544 | Ga0070686_100060387 | Ga0070686_1000603872 | 182 |
| 86 | 3300005544 | Ga0070686_100100012 | Ga0070686_1001000122 | 182 |
| 87 | 3300005548 | Ga0070665_100030614 | Ga0070665_1000306144 | 182 |
| 88 | 3300005578 | Ga0068854_100000044 | Ga0068854_10000004434 | 182 |
| 89 | 3300005578 | Ga0068854_100760935 | Ga0068854_1007609352 | 182 |
| 90 | 3300005616 | Ga0068852_100000050 | Ga0068852_10000005069 | 182 |
| 91 | 3300005718 | Ga0068866_10001565 | Ga0068866_100015657 | 182 |
| 92 | 3300005841 | Ga0068863_100000039 | Ga0068863_100000039117 | 182 |
| 93 | 3300005843 | Ga0068860_100329495 | Ga0068860_1003294953 | 182 |
| 94 | 3300005937 | Ga0081455_10038227 | Ga0081455_100382274 | 182 |
| 95 | 3300005983 | Ga0081540_1000044 | Ga0081540_100004490 | 182 |
| 96 | 3300006881 | Ga0068865_100489822 | Ga0068865_1004898222 | 182 |
| 97 | 3300009176 | Ga0105242_10000403 | Ga0105242_1000040326 | 182 |
| 98 | 3300009177 | Ga0105248_10000267 | Ga0105248_100002674 | 182 |
| 99 | 3300010375 | Ga0105239_10035301 | Ga0105239_100353017 | 182 |
| 100 | 3300010375 | Ga0105239_11120379 | Ga0105239_111203792 | 182 |
| 101 | 3300013104 | Ga0157370_10009506 | Ga0157370_100095068 | 182 |
| 102 | 3300013297 | Ga0157378_10026417 | Ga0157378_100264174 | 182 |
| 103 | 3300013307 | Ga0157372_10694564 | Ga0157372_106945642 | 182 |
| 104 | 3300013308 | Ga0157375_10352815 | Ga0157375_103528153 | 182 |
| 105 | 3300013308 | Ga0157375_10710843 | Ga0157375_107108432 | 182 |
| 106 | 3300014326 | Ga0157380_10000009 | Ga0157380_1000000992 | 182 |
| 107 | 3300014326 | Ga0157380_10431505 | Ga0157380_104315053 | 182 |
| 108 | 3300017792 | Ga0163161_10240963 | Ga0163161_102409632 | 182 |
| 109 | 3300020070 | Ga0206356_11281601 | Ga0206356_112816013 | 182 |
| 110 | 3300025899 | Ga0207642_10049872 | Ga0207642_100498722 | 182 |
| 111 | 3300025903 | Ga0207680_10015963 | Ga0207680_100159633 | 182 |
| 112 | 3300025926 | Ga0207659_10000014 | Ga0207659_10000014164 | 182 |
| 113 | 3300025929 | Ga0207664_10033143 | Ga0207664_100331434 | 182 |
| 114 | 3300025932 | Ga0207690_10021359 | Ga0207690_100213595 | 182 |
| 115 | 3300025934 | Ga0207686_10000029 | Ga0207686_1000002915 | 182 |
| 116 | 3300025941 | Ga0207711_10000024 | Ga0207711_10000024111 | 182 |
| 117 | 3300025944 | Ga0207661_10000925 | Ga0207661_100009257 | 182 |
| 118 | 3300025944 | Ga0207661_10110161 | Ga0207661_101101612 | 182 |
| 119 | 3300025981 | Ga0207640_10000517 | Ga0207640_100005176 | 182 |
| 120 | 3300026023 | Ga0207677_10000671 | Ga0207677_100006713 | 182 |
| 121 | 3300026067 | Ga0207678_10287000 | Ga0207678_102870003 | 182 |
| 122 | 3300026088 | Ga0207641_10000065 | Ga0207641_1000006520 | 182 |
| 123 | 3300026142 | Ga0207698_10000009 | Ga0207698_1000000958 | 182 |
| 124 | 3300028379 | Ga0268266_10011831 | Ga0268266_100118314 | 182 |
| 125 | 3300028379 | Ga0268266_10325560 | Ga0268266_103255603 | 182 |
| 126 | 3300028381 | Ga0268264_10245755 | Ga0268264_102457552 | 182 |
| 127 | 3300028563 | Ga0265319_1000091 | Ga0265319_100009132 | 182 |
| 128 | 3300028800 | Ga0265338_10000752 | Ga0265338_1000075232 | 182 |
| 129 | 3300031241 | Ga0265325_10003985 | Ga0265325_100039855 | 182 |
| 130 | 3300041443 | Ga0451789_1225635 | Ga0451789_1225635_64_612 | 182 |
| 131 | 3300041505 | Ga0451849_0896956 | Ga0451849_0896956_461_1009 | 182 |
| 132 | 3300044842 | Ga0466957_0000824 | Ga0466957_0000824_13473_14024 | 182 |
| 133 | 3300045976 | Ga0466967_0000123 | Ga0466967_0000123_51_602 | 182 |
| 134 | 3300046459 | Ga0495629_0014026 | Ga0495629_0014026_781_1329 | 182 |
| 135 | 3300046459 | Ga0495629_0093444 | Ga0495629_0093444_828_1376 | 182 |
| 136 | 3300046461 | Ga0495641_0012922 | Ga0495641_0012922_256_804 | 182 |
| 137 | 3300046476 | Ga0495662_0001723 | Ga0495662_0001723_7639_8196 | 182 |
| 138 | 3300046476 | Ga0495662_0031586 | Ga0495662_0031586_348_905 | 182 |
| 139 | 3300046500 | Ga0495596_0017523 | Ga0495596_0017523_253_801 | 182 |
| 140 | 3300046507 | Ga0495606_0000294 | Ga0495606_0000294_22599_23150 | 182 |
| 141 | 3300046511 | Ga0495608_0000010 | Ga0495608_0000010_29990_30541 | 182 |
| 142 | 3300046516 | Ga0495628_0245954 | Ga0495628_0245954_283_834 | 182 |
| 143 | 3300046523 | Ga0495644_0001672 | Ga0495644_0001672_4975_5523 | 182 |
| 144 | 3300046529 | Ga0495652_0061979 | Ga0495652_0061979_1649_2197 | 182 |
| 145 | 3300046535 | Ga0495586_0000234 | Ga0495586_0000234_13989_14546 | 182 |
| 146 | 3300046536 | Ga0495587_0008616 | Ga0495587_0008616_3048_3596 | 182 |
| 147 | 3300046536 | Ga0495587_0391638 | Ga0495587_0391638_146_703 | 182 |
| 148 | 3300046543 | Ga0495645_0038925 | Ga0495645_0038925_239_787 | 182 |
| 149 | 3300046543 | Ga0495645_0180597 | Ga0495645_0180597_145_693 | 182 |
| 150 | 3300046559 | Ga0495667_0369773 | Ga0495667_0369773_120_668 | 182 |
| 151 | 3300046642 | Ga0495634_0000616 | Ga0495634_0000616_21244_21792 | 182 |
| 152 | 3300046660 | Ga0495625_0269260 | Ga0495625_0269260_313_861 | 182 |
| 153 | 3300046663 | Ga0495635_0507917 | Ga0495635_0507917_206_754 | 182 |
| 154 | 3300046674 | Ga0495588_0000218 | Ga0495588_0000218_34127_34678 | 182 |
| 155 | 3300046675 | Ga0495657_0000005 | Ga0495657_0000005_224320_224871 | 182 |
| 156 | 3300046681 | Ga0495647_0000010 | Ga0495647_0000010_7117_7674 | 182 |
| 157 | 3300046681 | Ga0495647_0000111 | Ga0495647_0000111_7224_7775 | 182 |
| 158 | 3300046683 | Ga0495658_0000965 | Ga0495658_0000965_2576_3127 | 182 |
| 159 | 3300046689 | Ga0495613_0000131 | Ga0495613_0000131_27066_27617 | 182 |
| 160 | 3300046689 | Ga0495613_0203237 | Ga0495613_0203237_628_1176 | 182 |
| 161 | 3300046689 | Ga0495613_0291315 | Ga0495613_0291315_468_1016 | 182 |
| 162 | 3300046690 | Ga0495624_0000778 | Ga0495624_0000778_932_1483 | 182 |
| 163 | 3300046690 | Ga0495624_0029189 | Ga0495624_0029189_291_848 | 182 |
| 164 | 3300046809 | Ga0495600_0020345 | Ga0495600_0020345_3132_3683 | 182 |
| 165 | 3300046809 | Ga0495600_0085500 | Ga0495600_0085500_1131_1679 | 182 |
| 166 | 3300047317 | Ga0495604_0035697 | Ga0495604_0035697_2069_2620 | 182 |
| 167 | 3300047317 | Ga0495604_0187293 | Ga0495604_0187293_796_1353 | 182 |
| 168 | 3300047322 | Ga0495680_0113850 | Ga0495680_0113850_487_1035 | 182 |
| 169 | 3300047444 | Ga0495675_0000004 | Ga0495675_0000004_21130_21681 | 182 |
| 170 | 3300047469 | Ga0495673_0016617 | Ga0495673_0016617_2246_2794 | 182 |
| 171 | 3300047472 | Ga0495686_0087808 | Ga0495686_0087808_1264_1812 | 182 |
| 172 | 3300047673 | Ga0495593_0018795 | Ga0495593_0018795_1820_2371 | 182 |
| 173 | 3300047673 | Ga0495593_0044212 | Ga0495593_0044212_1063_1611 | 182 |
| 174 | 3300048088 | Ga0495602_0000009 | Ga0495602_0000009_189395_189946 | 182 |
| 175 | 3300048088 | Ga0495602_0216455 | Ga0495602_0216455_480_1028 | 182 |
| 176 | 3300048088 | Ga0495602_0635683 | Ga0495602_0635683_166_717 | 182 |
| 177 | 3300048905 | Ga0496102_0000132 | Ga0496102_0000132_58345_58893 | 182 |
| 178 | 3300048906 | Ga0496103_0000077 | Ga0496103_0000077_44272_44820 | 182 |
| 179 | 3300048906 | Ga0496103_0189323 | Ga0496103_0189323_378_926 | 182 |
| 180 | 3300048907 | Ga0496104_0076412 | Ga0496104_0076412_430_987 | 182 |
| 181 | 3300048909 | Ga0496106_0000130 | Ga0496106_0000130_21416_21973 | 182 |
| 182 | 3300048910 | Ga0496107_0011520 | Ga0496107_0011520_3171_3728 | 182 |
| 183 | 3300048913 | Ga0496110_0000015 | Ga0496110_0000015_13674_14225 | 182 |
| 184 | 3300048913 | Ga0496110_0016082 | Ga0496110_0016082_2789_3340 | 182 |
| 185 | 3300048913 | Ga0496110_0502321 | Ga0496110_0502321_463_1011 | 182 |
| 186 | 3300048914 | Ga0496111_0000001 | Ga0496111_0000001_160603_161154 | 182 |
| 187 | 3300048914 | Ga0496111_0036242 | Ga0496111_0036242_1203_1754 | 182 |
| 188 | 3300048914 | Ga0496111_0085263 | Ga0496111_0085263_312_860 | 182 |
| 189 | 3300048915 | Ga0496112_0000250 | Ga0496112_0000250_4612_5163 | 182 |
| 190 | 3300048915 | Ga0496112_0788905 | Ga0496112_0788905_147_698 | 182 |
| 191 | 3300048916 | Ga0496113_0000039 | Ga0496113_0000039_782_1333 | 182 |
| 192 | 3300048917 | Ga0496114_0084282 | Ga0496114_0084282_393_947 | 182 |
| 193 | 3300048917 | Ga0496114_0137284 | Ga0496114_0137284_858_1406 | 182 |
| 194 | 3300048918 | Ga0496115_0000183 | Ga0496115_0000183_21954_22502 | 182 |
| 195 | 3300048918 | Ga0496115_0017582 | Ga0496115_0017582_1047_1601 | 182 |
| 196 | 3300049578 | Ga0501042_0021689 | Ga0501042_0021689_1049_1597 | 182 |
| 197 | 3300049743 | Ga0501081_0749367 | Ga0501081_0749367_49_606 | 182 |
| 198 | 3300053077 | Ga0495601_0000042 | Ga0495601_0000042_28929_29480 | 182 |
| 199 | 3300053077 | Ga0495601_0474048 | Ga0495601_0474048_216_764 | 182 |
| 200 | 3300053078 | Ga0495612_0003776 | Ga0495612_0003776_2210_2761 | 182 |
| 201 | 3300053078 | Ga0495612_0011513 | Ga0495612_0011513_1383_1931 | 182 |
| 202 | 3300053083 | Ga0495655_0000009 | Ga0495655_0000009_21623_22171 | 182 |
| 203 | 3300053084 | Ga0495595_0000005 | Ga0495595_0000005_228120_228671 | 182 |
| 204 | 3300053084 | Ga0495595_0004027 | Ga0495595_0004027_3845_4396 | 182 |
| 205 | 3300053085 | Ga0495619_0000040 | Ga0495619_0000040_33018_33569 | 182 |
| 206 | 3300053085 | Ga0495619_0000126 | Ga0495619_0000126_25640_26191 | 182 |
| 207 | 3300053085 | Ga0495619_0581672 | Ga0495619_0581672_11_559 | 182 |
| 208 | 3300053094 | Ga0500566_0017835 | Ga0500566_0017835_2596_3144 | 182 |
| 209 | 3300053096 | Ga0500641_0002279 | Ga0500641_0002279_5550_6098 | 182 |
| 210 | 3300053129 | Ga0500628_000078 | Ga0500628_000078_22927_23475 | 182 |
| 211 | 3300053129 | Ga0500628_105812 | Ga0500628_105812_144_692 | 182 |
| 212 | 3300005337 | Ga0070682_100000038 | Ga0070682_100000038117 | 183 |
| 213 | 3300009176 | Ga0105242_10267866 | Ga0105242_102678662 | 183 |
| 214 | 3300009551 | Ga0105238_10000014 | Ga0105238_10000014116 | 183 |
| 215 | 3300013296 | Ga0157374_10501595 | Ga0157374_105015952 | 183 |
| 216 | 3300025910 | Ga0207684_10225591 | Ga0207684_102255912 | 183 |
| 217 | 3300025924 | Ga0207694_10000008 | Ga0207694_10000008122 | 183 |
| 218 | 3300046458 | Ga0495591_040724 | Ga0495591_040724_715_1275 | 183 |
| 219 | 3300046694 | Ga0495649_0001406 | Ga0495649_0001406_913_1473 | 183 |
| 220 | 3300047321 | Ga0495676_0003442 | Ga0495676_0003442_7109_7669 | 183 |
| 221 | 3300047322 | Ga0495680_0009372 | Ga0495680_0009372_4622_5179 | 183 |
| 222 | 3300047446 | Ga0495679_022610 | Ga0495679_022610_1517_2077 | 183 |
| 223 | 3300035172 | Ga0373955_0066879 | Ga0373955_0066879_1351_1917 | 185 |
| 224 | 3300044901 | Ga0466960_0178396 | Ga0466960_0178396_171_731 | 185 |
| 225 | 3300046678 | Ga0495599_0027864 | Ga0495599_0027864_889_1455 | 185 |
| 226 | 3300046809 | Ga0495600_0328004 | Ga0495600_0328004_267_833 | 185 |
| 227 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_291111_291671 | 185 |
| 228 | 3300005329 | Ga0070683_100009632 | Ga0070683_1000096327 | 186 |
| 229 | 3300005338 | Ga0068868_100559554 | Ga0068868_1005595541 | 186 |
| 230 | 3300005353 | Ga0070669_100342240 | Ga0070669_1003422401 | 186 |
| 231 | 3300005356 | Ga0070674_100000026 | Ga0070674_10000002680 | 186 |
| 232 | 3300005364 | Ga0070673_100031221 | Ga0070673_1000312213 | 186 |
| 233 | 3300005406 | Ga0070703_10035246 | Ga0070703_100352461 | 186 |
| 234 | 3300005441 | Ga0070700_100182333 | Ga0070700_1001823332 | 186 |
| 235 | 3300005459 | Ga0068867_100000246 | Ga0068867_1000002462 | 186 |
| 236 | 3300005535 | Ga0070684_100035874 | Ga0070684_1000358745 | 186 |
| 237 | 3300005547 | Ga0070693_100001059 | Ga0070693_1000010595 | 186 |
| 238 | 3300005547 | Ga0070693_100166310 | Ga0070693_1001663102 | 186 |
| 239 | 3300005578 | Ga0068854_100056128 | Ga0068854_1000561282 | 186 |
| 240 | 3300005718 | Ga0068866_10000006 | Ga0068866_10000006127 | 186 |
| 241 | 3300005983 | Ga0081540_1127277 | Ga0081540_11272772 | 186 |
| 242 | 3300006163 | Ga0070715_10000003 | Ga0070715_10000003183 | 186 |
| 243 | 3300009098 | Ga0105245_10000049 | Ga0105245_10000049125 | 186 |
| 244 | 3300009098 | Ga0105245_10000508 | Ga0105245_1000050815 | 186 |
| 245 | 3300009098 | Ga0105245_10314468 | Ga0105245_103144682 | 186 |
| 246 | 3300011119 | Ga0105246_10159912 | Ga0105246_101599123 | 186 |
| 247 | 3300013308 | Ga0157375_10385940 | Ga0157375_103859402 | 186 |
| 248 | 3300014968 | Ga0157379_10136041 | Ga0157379_101360413 | 186 |
| 249 | 3300025893 | Ga0207682_10000007 | Ga0207682_1000000735 | 186 |
| 250 | 3300025899 | Ga0207642_10000001 | Ga0207642_1000000182 | 186 |
| 251 | 3300025899 | Ga0207642_10000003 | Ga0207642_1000000382 | 186 |
| 252 | 3300025899 | Ga0207642_10000004 | Ga0207642_1000000482 | 186 |
| 253 | 3300025905 | Ga0207685_10000003 | Ga0207685_10000003181 | 186 |
| 254 | 3300025923 | Ga0207681_10256130 | Ga0207681_102561302 | 186 |
| 255 | 3300025927 | Ga0207687_10000012 | Ga0207687_10000012367 | 186 |
| 256 | 3300025927 | Ga0207687_10001866 | Ga0207687_1000186614 | 186 |
| 257 | 3300025927 | Ga0207687_10469116 | Ga0207687_104691162 | 186 |
| 258 | 3300025933 | Ga0207706_10000302 | Ga0207706_1000030231 | 186 |
| 259 | 3300025937 | Ga0207669_10000041 | Ga0207669_100000415 | 186 |
| 260 | 3300025944 | Ga0207661_10009099 | Ga0207661_100090994 | 186 |
| 261 | 3300025960 | Ga0207651_10016005 | Ga0207651_100160054 | 186 |
| 262 | 3300025981 | Ga0207640_10043926 | Ga0207640_100439263 | 186 |
| 263 | 3300026075 | Ga0207708_10305837 | Ga0207708_103058372 | 186 |
| 264 | 3300026089 | Ga0207648_10000783 | Ga0207648_1000078339 | 186 |
| 265 | 3300028381 | Ga0268264_10003844 | Ga0268264_1000384412 | 186 |
| 266 | 3300046461 | Ga0495641_0000095 | Ga0495641_0000095_35579_36148 | 186 |
| 267 | 3300046511 | Ga0495608_0011638 | Ga0495608_0011638_2684_3253 | 186 |
| 268 | 3300047322 | Ga0495680_0000873 | Ga0495680_0000873_26985_27554 | 186 |
| 269 | 3300047469 | Ga0495673_0039581 | Ga0495673_0039581_1418_1987 | 186 |
| 270 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_558292_558861 | 186 |
| 271 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_627260_627829 | 186 |
| 272 | 3300048909 | Ga0496106_0200505 | Ga0496106_0200505_286_855 | 186 |
| 273 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_635553_636122 | 186 |
| 274 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_635515_636084 | 186 |
| 275 | 3300048913 | Ga0496110_0095743 | Ga0496110_0095743_1508_2077 | 186 |
| 276 | 3300049587 | Ga0501071_0073671 | Ga0501071_0073671_113_682 | 186 |
| 277 | 3300049591 | Ga0501075_0000897 | Ga0501075_0000897_5060_5632 | 186 |
| 278 | 3300053077 | Ga0495601_0000296 | Ga0495601_0000296_15115_15684 | 186 |
| 279 | 3300053085 | Ga0495619_0007234 | Ga0495619_0007234_2666_3235 | 186 |
| 280 | 3300053123 | Ga0500614_000806 | Ga0500614_000806_2738_3307 | 186 |
| 281 | 3300049744 | Ga0501083_0150022 | Ga0501083_0150022_794_1387 | 189 |
| 282 | 3300025934 | Ga0207686_10001249 | Ga0207686_100012496 | 190 |
| 283 | 3300046663 | Ga0495635_0128537 | Ga0495635_0128537_321_917 | 193 |
| 284 | 3300046463 | Ga0495653_0144782 | Ga0495653_0144782_44_646 | 195 |
| 285 | 3300046516 | Ga0495628_0019162 | Ga0495628_0019162_4584_5198 | 198 |
| 286 | 3300048911 | Ga0496108_0000339 | Ga0496108_0000339_37776_38393 | 199 |
| 287 | 3300048912 | Ga0496109_0001321 | Ga0496109_0001321_15607_16224 | 199 |
| 288 | 3300002074 | JGI24748J21848_1000142 | JGI24748J21848_10001426 | 201 |
| 289 | 3300002239 | JGI24034J26672_10000275 | JGI24034J26672_100002753 | 201 |
| 290 | 3300002244 | JGI24742J22300_10005389 | JGI24742J22300_100053893 | 201 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8an4-assembly1.cif.gz_A | ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv | 0.7781 | 3 | 178 |
| 8an5-assembly1.cif.gz_B | menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv | 0.7727 | 3 | 175 |
| 8an5-assembly1.cif.gz_A | menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv | 0.7695 | 3 | 178 |
| 8an4-assembly2.cif.gz_B | ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv | 0.757 | 1 | 181 |
| 8an5-assembly1.cif.gz_B | menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv | 0.7279 | 3 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L7N686_1_158_3.30.460.40 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; | 0.7975 | 1 | 145 | 3.30.460.40 |
| af_P12945_549_762_1.25.40.1010 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; | 0.7514 | 142 | 184 | 1.25.40.1010 |
| af_L7N686_1_158_3.30.460.40 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; | 0.7328 | 1 | 145 | 3.30.460.40 |
| af_O74467_142_271_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.69 | 136 | 174 | 1.25.40.10 |
| af_F4HUW0_97_242_3.30.460.10 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 | 0.685 | 6 | 94 | 3.30.460.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S5J923-F1-model_v4 | deleted | 0.9762 | 3 | 91 |
|
| AF-A0A3S5J923-F1-model_v4 | deleted | 0.9552 | 3 | 91 |
|
| AF-T0ZX38-F1-model_v4 | Uncharacterized protein | 0.9464 | 1 | 96 |
|
| AF-T0YTH8-F1-model_v4 | Protein containing DUF1814 | 0.9434 | 3 | 177 |
|
| AF-A0A7W1S2D8-F1-model_v4 | deleted | 0.9408 | 4 | 182 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar