F390101

General Info

Members Datasets Scaffolds Average Seq Length
290 204 252 255

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2997451912|2997455135
Length 288
Sequence KPPYVPGHGLLAGRTAVVTAAAGAGIGGATARKLLEEGADVVLSDTHTRRLKESEDRLAEEFGARRVAALPCDVTDEAQVGALFDLAEQRHGRLDIVVNNAGLGGTADLVEMTDDQWATVLDVTLNGTFRCTRAALRRMKAAHDGERLTGPGSGRYPGLGSGPGSGPGPSPGSGPGVIVNNASVVGWRAQRGQAHYAAAKAGVMALTRCAAVEAAAYGVRVNAVSPSLAMHPHLAKVTTDELLSELTAREAFGRYAEPWEVANVIVFLASDYSSYMTGEAVAVSSQHA

Samples

Sample ID Description Type Environment
1 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
2 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
3 2643221561 Nocardioides sp. Root151 Isolate Unclassified
4 2643221576 Nocardioides sp. Root614 Isolate Unclassified
5 2643221578 Streptomyces sp. Root63 Isolate Unclassified
6 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
7 2643221604 Nocardioides sp. Root190 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
11 2643221696 Nocardioides sp. Root140 Isolate Unclassified
12 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
13 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
14 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
15 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
16 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
17 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
18 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
19 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
20 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
21 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
22 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
23 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
24 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
25 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
26 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
27 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
28 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
29 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
30 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
31 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
32 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
33 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
34 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
35 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
113 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
114 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
115 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
203 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
204 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.55
Metatranscriptomes 0.34
Isolates 13.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.86
Nodule 0
Rhizoplane 4.14
Rhizosphere 78.97
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10016249 3300001989 Bacteria 2696
2 JGI24737J22298_10012505 3300001990 Bacteria 2768
3 JGI24738J21930_10009620 3300002075 Bacteria 2170
4 JGI25160J50197_1020084 3300003354 Bacteria 2027
5 JGI25160J50197_1028175 3300003354 Bacteria 1513
6 Ga0006562J51391_1094202 3300003578 Bacteria 7930
7 Ga0070690_100012247 3300005330 Bacteria 5044
8 Ga0070670_100175354 3300005331 Bacteria 1860
9 Ga0070660_100030496 3300005339 Bacteria 4046
10 Ga0070669_100430764 3300005353 Bacteria 1084
11 Ga0070659_100150422 3300005366 Bacteria 1899
12 Ga0070667_100007962 3300005367 Bacteria 8787
13 Ga0070714_100150481 3300005435 Bacteria 2097
14 Ga0070663_100434814 3300005455 Bacteria 1079
15 Ga0070681_10005101 3300005458 Bacteria 12674
16 Ga0070679_100069467 3300005530 Bacteria 3513
17 Ga0070679_100081408 3300005530 Bacteria 3227
18 Ga0068855_100210969 3300005563 Bacteria 2182
19 Ga0068856_100354931 3300005614 Bacteria 1485
20 Ga0068856_100534910 3300005614 Bacteria 1193
21 Ga0068864_100003316 3300005618 Bacteria 13307
22 Ga0068858_100003062 3300005842 Bacteria 16748
23 Ga0068862_100388410 3300005844 Bacteria 1303
24 Ga0075368_10008459 3300006042 Bacteria 3667
25 Ga0075363_100002683 3300006048 Bacteria 7353
26 Ga0075363_100066826 3300006048 Bacteria 1947
27 Ga0075367_10022866 3300006178 Bacteria 3512
28 Ga0075428_100015558 3300006844 Bacteria 8434
29 Ga0075430_100194142 3300006846 Bacteria 1687
30 Ga0105250_10069075 3300009092 Bacteria 1427
31 Ga0105241_10203944 3300009174 Bacteria 1653
32 Ga0105239_10049287 3300010375 Bacteria 4618
33 Ga0105239_10307614 3300010375 Bacteria 1786
34 Ga0105246_10028276 3300011119 Bacteria 3682
35 Ga0157369_10033678 3300013105 Bacteria 5628
36 Ga0157374_10231404 3300013296 Bacteria 1815
37 Ga0163162_10003007 3300013306 Bacteria 16117
38 Ga0157372_11280781 3300013307 Bacteria 846
39 Ga0182008_10016007 3300014497 Bacteria 3903
40 Ga0182006_1014320 3300015261 Bacteria 3421
41 Ga0182007_10003573 3300015262 Bacteria 7313
42 Ga0182005_1006994 3300015265 Bacteria 3409
43 Ga0183367_1007 3300015688 Bacteria 498079
44 Ga0213876_10005159 3300021384 Bacteria 7200
45 Ga0207426_1000393 3300025302 Bacteria 74583
46 Ga0207426_1001236 3300025302 Bacteria 22468
47 Ga0207426_1024521 3300025302 Bacteria 2045
48 Ga0207426_1033776 3300025302 Bacteria 1646
49 Ga0207705_10373896 3300025909 Bacteria 1100
50 Ga0207707_10087985 3300025912 Bacteria 2714
51 Ga0207660_10045851 3300025917 Bacteria 3082
52 Ga0207657_10395841 3300025919 Bacteria 1086
53 Ga0207652_10046765 3300025921 Bacteria 3694
54 Ga0207652_10104521 3300025921 Bacteria 2505
55 Ga0207687_10753668 3300025927 Bacteria 829
56 Ga0207664_10130616 3300025929 Bacteria 2114
57 Ga0207706_10192287 3300025933 Bacteria 1791
58 Ga0207658_10052451 3300025986 Bacteria 3010
59 Ga0207703_10000693 3300026035 Bacteria 33348
60 Ga0207703_10701265 3300026035 Bacteria 963
61 Ga0207702_10299894 3300026078 Bacteria 1525
62 Ga0207676_10000607 3300026095 Bacteria 29436
63 Ga0207676_10610342 3300026095 Bacteria 1049
64 Ga0209813_10014038 3300027866 Bacteria 2149
65 Ga0207428_10116902 3300027907 Bacteria 2047
66 Ga0268265_10479959 3300028380 Bacteria 1167
67 Ga0265334_10011461 3300028573 Bacteria 3733
68 Ga0307517_10026995 3300028786 Bacteria 6923
69 Ga0307517_10108987 3300028786 Bacteria 2121
70 Ga0265338_10001030 3300028800 Bacteria 46656
71 Ga0307511_10095484 3300030521 Bacteria 1986
72 Ga0265325_10001948 3300031241 Bacteria 14229
73 Ga0265325_10014511 3300031241 Bacteria 4449
74 Ga0265340_10008855 3300031247 Bacteria 5422
75 Ga0265339_10004055 3300031249 Bacteria 10116
76 Ga0265327_10002300 3300031251 Bacteria 20453
77 Ga0265327_10003572 3300031251 Bacteria 14713
78 Ga0265316_10080455 3300031344 Bacteria 2499
79 Ga0307509_10168600 3300031507 Bacteria 2073
80 Ga0265313_10000380 3300031595 Bacteria 47957
81 Ga0307508_10004796 3300031616 Bacteria 13048
82 Ga0307514_10028034 3300031649 Bacteria 4545
83 Ga0307514_10289440 3300031649 Bacteria 928
84 Ga0265314_10139590 3300031711 Bacteria 1500
85 Ga0307516_10010098 3300031730 Bacteria 10438
86 Ga0307409_100137783 3300031995 Bacteria 2098
87 Ga0307414_10243551 3300032004 Bacteria 1490
88 Ga0395900_0134163 3300037418 Bacteria 2536
89 Ga0395900_0198755 3300037418 Bacteria 2030
90 Ga0395898_0001427 3300037466 Bacteria 33941
91 Ga0395898_0009610 3300037466 Bacteria 10154
92 Ga0395901_0151457 3300038443 Bacteria 2437
93 Ga0436365_1153173 3300039437 Bacteria 7327
94 Ga0439449_0000442 3300042007 Bacteria 15380
95 Ga0439457_003992 3300042014 Bacteria 3921
96 Ga0450894_000344 3300042131 Bacteria 8207
97 Ga0450906_011628 3300042145 Bacteria 1643
98 Ga0466969_0000874 3300044656 Bacteria 16344
99 Ga0466969_0039492 3300044656 Bacteria 2369
100 Ga0466969_0068396 3300044656 Bacteria 1711
101 Ga0466972_0137911 3300044658 Bacteria 1148
102 Ga0466965_0025148 3300044683 Bacteria 2882
103 Ga0466966_0003616 3300044684 Bacteria 10199
104 Ga0466966_0013780 3300044684 Bacteria 5349
105 Ga0466966_0020025 3300044684 Bacteria 4402
106 Ga0466966_0050047 3300044684 Bacteria 2659
107 Ga0466961_0015176 3300044693 Bacteria 4947
108 Ga0466961_0020565 3300044693 Bacteria 4247
109 Ga0466961_0031776 3300044693 Bacteria 3394
110 Ga0466963_0151030 3300044694 Bacteria 1613
111 Ga0466963_0158002 3300044694 Bacteria 1577
112 Ga0466971_0009451 3300044719 Bacteria 4257
113 Ga0466968_0048783 3300044735 Bacteria 1802
114 Ga0466970_0001885 3300044765 Bacteria 10139
115 Ga0466970_0007243 3300044765 Bacteria 5556
116 Ga0466970_0026981 3300044765 Bacteria 3011
117 Ga0466957_0002102 3300044842 Bacteria 10659
118 Ga0466957_0387938 3300044842 Bacteria 953
119 Ga0466960_0201442 3300044901 Bacteria 1088
120 Ga0466960_0233849 3300044901 Bacteria 1015
121 Ga0466959_0017986 3300045049 Bacteria 5186
122 Ga0466959_0032775 3300045049 Bacteria 3845
123 Ga0466959_0048585 3300045049 Bacteria 3118
124 Ga0466959_0061720 3300045049 Bacteria 2725
125 Ga0466959_0106471 3300045049 Bacteria 2005
126 Ga0466959_0215354 3300045049 Bacteria 1334
127 Ga0466958_0005171 3300045836 Bacteria 6981
128 Ga0466958_0020801 3300045836 Bacteria 3829
129 Ga0466958_0020882 3300045836 Bacteria 3822
130 Ga0466967_0004982 3300045976 Bacteria 9093
131 Ga0466967_0008521 3300045976 Bacteria 7526
132 Ga0466967_0016927 3300045976 Bacteria 5766
133 Ga0466967_0220529 3300045976 Bacteria 1802
134 Ga0495592_0081564 3300046454 Bacteria 2338
135 Ga0495603_0003266 3300046455 Bacteria 9655
136 Ga0495603_0003925 3300046455 Bacteria 8862
137 Ga0495603_0018175 3300046455 Bacteria 4253
138 Ga0495603_0021382 3300046455 Bacteria 3918
139 Ga0495629_0005445 3300046459 Bacteria 9490
140 Ga0495629_0006177 3300046459 Bacteria 8895
141 Ga0495629_0011073 3300046459 Bacteria 6552
142 Ga0495651_0144322 3300046462 Bacteria 1722
143 Ga0495580_0033550 3300046472 Bacteria 3698
144 Ga0495582_0208752 3300046473 Bacteria 1116
145 Ga0495662_0021482 3300046476 Bacteria 3118
146 Ga0495662_0056308 3300046476 Bacteria 1899
147 Ga0495662_0060187 3300046476 Bacteria 1834
148 Ga0495664_0003404 3300046477 Bacteria 8643
149 Ga0495664_0122375 3300046477 Bacteria 1573
150 Ga0495594_0011084 3300046499 Bacteria 4682
151 Ga0495594_0052350 3300046499 Bacteria 2248
152 Ga0495594_0108112 3300046499 Bacteria 1567
153 Ga0495618_0210952 3300046514 Bacteria 1227
154 Ga0495620_0120419 3300046515 Bacteria 1034
155 Ga0495628_0025662 3300046516 Bacteria 4813
156 Ga0495643_0009657 3300046522 Bacteria 5976
157 Ga0495652_0097051 3300046529 Bacteria 2398
158 Ga0495640_0028734 3300046533 Bacteria 4000
159 Ga0495597_0056622 3300046542 Bacteria 1716
160 Ga0495622_0129109 3300046557 Bacteria 1152
161 Ga0495633_0082390 3300046558 Bacteria 1497
162 Ga0495634_0030116 3300046642 Bacteria 3750
163 Ga0495625_0207261 3300046660 Bacteria 1290
164 Ga0495625_0208682 3300046660 Bacteria 1285
165 Ga0495588_0026586 3300046674 Bacteria 2890
166 Ga0495588_0093018 3300046674 Bacteria 1580
167 Ga0495657_0047979 3300046675 Bacteria 2884
168 Ga0495658_0140241 3300046683 Bacteria 1478
169 Ga0495613_0008610 3300046689 Bacteria 7571
170 Ga0495613_0012371 3300046689 Bacteria 6341
171 Ga0495613_0021053 3300046689 Bacteria 4861
172 Ga0495613_0044001 3300046689 Bacteria 3304
173 Ga0495613_0203633 3300046689 Bacteria 1394
174 Ga0495624_0126302 3300046690 Bacteria 1569
175 Ga0495670_0085246 3300046691 Bacteria 1612
176 Ga0495589_0020216 3300046794 Bacteria 3407
177 Ga0495589_0033994 3300046794 Bacteria 2560
178 Ga0495600_0105940 3300046809 Bacteria 1832
179 Ga0495581_0021187 3300047315 Bacteria 3770
180 Ga0495604_0022763 3300047317 Bacteria 5002
181 Ga0495676_0019418 3300047321 Bacteria 5978
182 Ga0495680_0167947 3300047322 Bacteria 1589
183 Ga0495687_125122 3300047443 Bacteria 920
184 Ga0495675_0059961 3300047444 Bacteria 2412
185 Ga0495675_0093185 3300047444 Bacteria 1890
186 Ga0495685_036971 3300047447 Bacteria 1675
187 Ga0495593_0051661 3300047673 Bacteria 2174
188 Ga0495614_0007816 3300048089 Bacteria 4754
189 Ga0495614_0021547 3300048089 Bacteria 2782
190 Ga0495626_0122161 3300048091 Bacteria 1118
191 Ga0496104_0757625 3300048907 Bacteria 878
192 Ga0496106_0036052 3300048909 Bacteria 3700
193 Ga0496108_0170951 3300048911 Bacteria 1880
194 Ga0496108_0232367 3300048911 Bacteria 1603
195 Ga0496108_0476763 3300048911 Bacteria 1090
196 Ga0496108_0723336 3300048911 Bacteria 862
197 Ga0496109_0001537 3300048912 Bacteria 19187
198 Ga0496109_0082267 3300048912 Bacteria 2967
199 Ga0496111_0183387 3300048914 Bacteria 1556
200 Ga0496112_0010232 3300048915 Bacteria 8502
201 Ga0496112_0240054 3300048915 Bacteria 1765
202 Ga0496112_0414776 3300048915 Bacteria 1286
203 Ga0496117_0012839 3300048920 Bacteria 7346
204 Ga0496125_0219416 3300048928 Bacteria 1227
205 Ga0501031_0007104 3300049568 Bacteria 7306
206 Ga0501032_0008654 3300049569 Bacteria 7418
207 Ga0501032_0108683 3300049569 Bacteria 1836
208 Ga0501034_0006345 3300049571 Bacteria 12738
209 Ga0501034_0006559 3300049571 Bacteria 12500
210 Ga0501034_0055131 3300049571 Bacteria 4001
211 Ga0501038_0000163 3300049574 Bacteria 56384
212 Ga0501038_0018505 3300049574 Bacteria 6290
213 Ga0501038_0050974 3300049574 Bacteria 3575
214 Ga0501038_0266078 3300049574 Bacteria 1353
215 Ga0501043_0003856 3300049579 Bacteria 12325
216 Ga0501043_0188012 3300049579 Bacteria 1607
217 Ga0501046_0175264 3300049580 Bacteria 1606
218 Ga0501047_0013095 3300049581 Bacteria 7854
219 Ga0501047_0038446 3300049581 Bacteria 4630
220 Ga0501047_0134641 3300049581 Bacteria 2351
221 Ga0501047_0375610 3300049581 Bacteria 1256
222 Ga0501047_0449553 3300049581 Bacteria 1118
223 Ga0501048_0000047 3300049582 Bacteria 59594
224 Ga0501069_0001776 3300049585 Bacteria 10783
225 Ga0501070_0001074 3300049586 Bacteria 24478
226 Ga0501070_0018280 3300049586 Bacteria 5880
227 Ga0501070_0024254 3300049586 Bacteria 5087
228 Ga0501070_0025346 3300049586 Bacteria 4974
229 Ga0501070_0044751 3300049586 Bacteria 3681
230 Ga0501070_0108829 3300049586 Bacteria 2290
231 Ga0501073_0122659 3300049589 Bacteria 1801
232 Ga0501073_0302198 3300049589 Bacteria 1104
233 Ga0501075_0113616 3300049591 Bacteria 2059
234 Ga0501077_0027358 3300049593 Bacteria 3622
235 Ga0501079_0001247 3300049741 Bacteria 17845
236 Ga0501080_0001643 3300049742 Bacteria 19039
237 Ga0501080_0037949 3300049742 Bacteria 4499
238 Ga0501080_0173482 3300049742 Bacteria 1987
239 Ga0501080_0312662 3300049742 Bacteria 1423
240 Ga0501080_0394603 3300049742 Bacteria 1245
241 Ga0501035_0056289 3300049822 Bacteria 3509
242 Ga0501044_0014833 3300049823 Bacteria 8400
243 Ga0501044_0398140 3300049823 Bacteria 1290
244 nmdc:mga03n38_323686_c1 3300050490 Bacteria 833
245 nmdc:mga06z11_9141_c1 3300050494 Bacteria 4163
246 nmdc:mga04h51_4179_c1 3300050495 Bacteria 3569
247 nmdc:mga07m45_222360_c1 3300050496 Bacteria 1098
248 nmdc:mga09592_384582_c1 3300050508 Bacteria 1213
249 Ga0500568_0140784 3300053139 Bacteria 894
250 Ga0500616_0001220 3300053153 Bacteria 25870
251 Ga0501084_0000010 3300054114 Bacteria 187712
252 Ga0466962_0023252 3300061719 Bacteria 2979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042145 Ga0450906_011628 Ga0450906_011628_624_1286 204
2 3300026035 Ga0207703_10701265 Ga0207703_107012651 215
3 3300028573 Ga0265334_10011461 Ga0265334_100114612 215
4 3300028800 Ga0265338_10001030 Ga0265338_1000103017 215
5 3300031241 Ga0265325_10001948 Ga0265325_1000194813 215
6 3300031249 Ga0265339_10004055 Ga0265339_1000405511 215
7 3300031595 Ga0265313_10000380 Ga0265313_1000038020 215
8 3300031711 Ga0265314_10139590 Ga0265314_101395902 215
9 3300048907 Ga0496104_0757625 Ga0496104_0757625_43_804 215
10 3300048911 Ga0496108_0476763 Ga0496108_0476763_121_882 215
11 3300049591 Ga0501075_0113616 Ga0501075_0113616_788_1591 222
12 3300025917 Ga0207660_10045851 Ga0207660_100458513 230
13 3300044719 Ga0466971_0009451 Ga0466971_0009451_3253_3987 231
14 3300044842 Ga0466957_0002102 Ga0466957_0002102_6461_7195 231
15 3300045836 Ga0466958_0020882 Ga0466958_0020882_763_1497 231
16 3300006844 Ga0075428_100015558 Ga0075428_1000155589 233
17 3300048911 Ga0496108_0723336 Ga0496108_0723336_56_817 233
18 3300044901 Ga0466960_0201442 Ga0466960_0201442_19_798 235
19 3300045976 Ga0466967_0016927 Ga0466967_0016927_3275_4072 235
20 3300037418 Ga0395900_0198755 Ga0395900_0198755_672_1403 236
21 3300044693 Ga0466961_0031776 Ga0466961_0031776_2347_3129 236
22 3300044901 Ga0466960_0233849 Ga0466960_0233849_62_841 236
23 3300031344 Ga0265316_10080455 Ga0265316_100804552 239
24 3300050496 nmdc:mga07m45_222360_c1 nmdc:mga07m45_222360_c1_176_940 239
25 3300021384 Ga0213876_10005159 Ga0213876_100051595 241
26 3300039437 Ga0436365_1153173 Ga0436365_1153173_4108_4878 241
27 3300044842 Ga0466957_0387938 Ga0466957_0387938_194_922 241
28 3300037418 Ga0395900_0134163 Ga0395900_0134163_1521_2249 242
29 3300037466 Ga0395898_0001427 Ga0395898_0001427_16741_17469 242
30 3300038443 Ga0395901_0151457 Ga0395901_0151457_919_1647 242
31 3300048915 Ga0496112_0240054 Ga0496112_0240054_510_1484 242
32 3300031241 Ga0265325_10014511 Ga0265325_100145112 243
33 3300031247 Ga0265340_10008855 Ga0265340_100088554 243
34 3300044658 Ga0466972_0137911 Ga0466972_0137911_279_1061 243
35 3300044693 Ga0466961_0020565 Ga0466961_0020565_1917_2699 243
36 3300044765 Ga0466970_0007243 Ga0466970_0007243_1384_2166 243
37 3300045049 Ga0466959_0061720 Ga0466959_0061720_445_1227 243
38 3300045836 Ga0466958_0005171 Ga0466958_0005171_3530_4312 243
39 3300031995 Ga0307409_100137783 Ga0307409_1001377832 244
40 3300049585 Ga0501069_0001776 Ga0501069_0001776_2049_2822 244
41 3300049586 Ga0501070_0044751 Ga0501070_0044751_39_812 244
42 3300049589 Ga0501073_0122659 Ga0501073_0122659_209_982 244
43 3300049742 Ga0501080_0312662 Ga0501080_0312662_150_923 244
44 3300031649 Ga0307514_10028034 Ga0307514_100280343 246
45 3300031730 Ga0307516_10010098 Ga0307516_100100984 246
46 3300044735 Ga0466968_0048783 Ga0466968_0048783_155_955 246
47 3300045049 Ga0466959_0106471 Ga0466959_0106471_12_791 246
48 3300044683 Ga0466965_0025148 Ga0466965_0025148_1854_2651 247
49 3300005618 Ga0068864_100003316 Ga0068864_1000033166 248
50 3300005842 Ga0068858_100003062 Ga0068858_10000306211 248
51 3300006048 Ga0075363_100002683 Ga0075363_1000026834 248
52 3300006846 Ga0075430_100194142 Ga0075430_1001941422 248
53 3300013306 Ga0163162_10003007 Ga0163162_1000300710 248
54 3300026035 Ga0207703_10000693 Ga0207703_100006936 248
55 3300026095 Ga0207676_10000607 Ga0207676_100006076 248
56 3300044694 Ga0466963_0158002 Ga0466963_0158002_451_1266 248
57 3300045976 Ga0466967_0004982 Ga0466967_0004982_742_1536 248
58 3300049571 Ga0501034_0055131 Ga0501034_0055131_2197_2949 248
59 3300005366 Ga0070659_100150422 Ga0070659_1001504222 249
60 3300005455 Ga0070663_100434814 Ga0070663_1004348141 249
61 3300010375 Ga0105239_10049287 Ga0105239_100492873 249
62 3300042131 Ga0450894_000344 Ga0450894_000344_7254_8051 249
63 3300044684 Ga0466966_0020025 Ga0466966_0020025_2286_3062 249
64 3300045049 Ga0466959_0048585 Ga0466959_0048585_190_966 249
65 3300045836 Ga0466958_0020801 Ga0466958_0020801_901_1677 249
66 3300061719 Ga0466962_0023252 Ga0466962_0023252_1283_2059 249
67 3300005614 Ga0068856_100534910 Ga0068856_1005349101 250
68 3300031251 Ga0265327_10003572 Ga0265327_100035729 250
69 3300031649 Ga0307514_10289440 Ga0307514_102894401 250
70 3300044656 Ga0466969_0000874 Ga0466969_0000874_13275_14078 250
71 3300044684 Ga0466966_0003616 Ga0466966_0003616_2977_3780 250
72 3300044765 Ga0466970_0001885 Ga0466970_0001885_5626_6429 250
73 3300044765 Ga0466970_0026981 Ga0466970_0026981_935_1738 250
74 3300045049 Ga0466959_0017986 Ga0466959_0017986_2046_2849 250
75 3300045976 Ga0466967_0220529 Ga0466967_0220529_354_1157 250
76 iso_pu_bacteria 2870782633 2870787854 250
77 iso_pu_bacteria 2675903060 2676495607 251
78 3300005339 Ga0070660_100030496 Ga0070660_1000304961 252
79 3300005844 Ga0068862_100388410 Ga0068862_1003884102 252
80 3300025933 Ga0207706_10192287 Ga0207706_101922872 252
81 3300026095 Ga0207676_10610342 Ga0207676_106103422 252
82 3300028380 Ga0268265_10479959 Ga0268265_104799592 252
83 iso_pu_bacteria 2891395885 2891398397 252
84 3300031507 Ga0307509_10168600 Ga0307509_101686002 253
85 3300046455 Ga0495603_0003266 Ga0495603_0003266_1738_2526 253
86 3300046459 Ga0495629_0011073 Ga0495629_0011073_4954_5742 253
87 3300046689 Ga0495613_0008610 Ga0495613_0008610_4898_5686 253
88 3300046689 Ga0495613_0044001 Ga0495613_0044001_1430_2221 253
89 3300047321 Ga0495676_0019418 Ga0495676_0019418_1149_1937 253
90 3300048089 Ga0495614_0021547 Ga0495614_0021547_115_903 253
91 3300048911 Ga0496108_0232367 Ga0496108_0232367_552_1328 253
92 3300048912 Ga0496109_0001537 Ga0496109_0001537_11767_12543 253
93 3300048914 Ga0496111_0183387 Ga0496111_0183387_273_1049 253
94 3300048915 Ga0496112_0010232 Ga0496112_0010232_1320_2096 253
95 3300049568 Ga0501031_0007104 Ga0501031_0007104_5810_6592 253
96 3300049569 Ga0501032_0008654 Ga0501032_0008654_992_1774 253
97 3300049571 Ga0501034_0006559 Ga0501034_0006559_661_1443 253
98 3300049574 Ga0501038_0000163 Ga0501038_0000163_17148_17930 253
99 3300049574 Ga0501038_0050974 Ga0501038_0050974_168_950 253
100 3300049579 Ga0501043_0003856 Ga0501043_0003856_1733_2515 253
101 3300049580 Ga0501046_0175264 Ga0501046_0175264_78_860 253
102 3300049581 Ga0501047_0013095 Ga0501047_0013095_1391_2173 253
103 3300049582 Ga0501048_0000047 Ga0501048_0000047_52664_53446 253
104 3300049586 Ga0501070_0018280 Ga0501070_0018280_5019_5801 253
105 3300049589 Ga0501073_0302198 Ga0501073_0302198_126_908 253
106 3300049823 Ga0501044_0398140 Ga0501044_0398140_475_1257 253
107 3300005530 Ga0070679_100069467 Ga0070679_1000694673 254
108 3300006048 Ga0075363_100066826 Ga0075363_1000668262 254
109 3300013307 Ga0157372_11280781 Ga0157372_112807811 254
110 3300025921 Ga0207652_10046765 Ga0207652_100467654 254
111 3300044684 Ga0466966_0050047 Ga0466966_0050047_691_1458 254
112 3300048915 Ga0496112_0414776 Ga0496112_0414776_505_1272 254
113 3300049571 Ga0501034_0006345 Ga0501034_0006345_9696_10466 254
114 3300053139 Ga0500568_0140784 Ga0500568_0140784_61_834 254
115 3300053153 Ga0500616_0001220 Ga0500616_0001220_15689_16456 254
116 3300005458 Ga0070681_10005101 Ga0070681_1000510114 255
117 3300005530 Ga0070679_100081408 Ga0070679_1000814082 255
118 3300005563 Ga0068855_100210969 Ga0068855_1002109693 255
119 3300013105 Ga0157369_10033678 Ga0157369_100336787 255
120 3300025909 Ga0207705_10373896 Ga0207705_103738962 255
121 3300025912 Ga0207707_10087985 Ga0207707_100879853 255
122 3300025919 Ga0207657_10395841 Ga0207657_103958412 255
123 3300025921 Ga0207652_10104521 Ga0207652_101045212 255
124 3300030521 Ga0307511_10095484 Ga0307511_100954842 255
125 3300044656 Ga0466969_0039492 Ga0466969_0039492_63_836 255
126 3300044693 Ga0466961_0015176 Ga0466961_0015176_1781_2554 255
127 3300045049 Ga0466959_0032775 Ga0466959_0032775_1907_2680 255
128 3300046455 Ga0495603_0021382 Ga0495603_0021382_2167_2958 255
129 3300046472 Ga0495580_0033550 Ga0495580_0033550_936_1727 255
130 3300046476 Ga0495662_0060187 Ga0495662_0060187_572_1363 255
131 3300046477 Ga0495664_0122375 Ga0495664_0122375_52_843 255
132 3300046499 Ga0495594_0011084 Ga0495594_0011084_1139_1930 255
133 3300046515 Ga0495620_0120419 Ga0495620_0120419_184_975 255
134 3300046516 Ga0495628_0025662 Ga0495628_0025662_2377_3168 255
135 3300046522 Ga0495643_0009657 Ga0495643_0009657_1301_2092 255
136 3300046533 Ga0495640_0028734 Ga0495640_0028734_131_922 255
137 3300046542 Ga0495597_0056622 Ga0495597_0056622_34_825 255
138 3300046557 Ga0495622_0129109 Ga0495622_0129109_264_1055 255
139 3300046558 Ga0495633_0082390 Ga0495633_0082390_503_1294 255
140 3300046642 Ga0495634_0030116 Ga0495634_0030116_695_1486 255
141 3300046674 Ga0495588_0026586 Ga0495588_0026586_1425_2216 255
142 3300046689 Ga0495613_0021053 Ga0495613_0021053_2901_3692 255
143 3300046690 Ga0495624_0126302 Ga0495624_0126302_222_1013 255
144 3300046691 Ga0495670_0085246 Ga0495670_0085246_19_810 255
145 3300046794 Ga0495589_0033994 Ga0495589_0033994_1240_2031 255
146 3300047315 Ga0495581_0021187 Ga0495581_0021187_722_1513 255
147 3300047443 Ga0495687_125122 Ga0495687_125122_66_857 255
148 3300047447 Ga0495685_036971 Ga0495685_036971_590_1381 255
149 3300047673 Ga0495593_0051661 Ga0495593_0051661_214_1005 255
150 3300048091 Ga0495626_0122161 Ga0495626_0122161_73_864 255
151 iso_pu_bacteria 2643221561 2643823669 255
152 iso_pu_bacteria 2643221696 2644535349 255
153 3300025927 Ga0207687_10753668 Ga0207687_107536681 256
154 3300044684 Ga0466966_0013780 Ga0466966_0013780_1170_1946 256
155 3300045049 Ga0466959_0215354 Ga0466959_0215354_31_804 256
156 3300049569 Ga0501032_0108683 Ga0501032_0108683_975_1745 256
157 3300049574 Ga0501038_0018505 Ga0501038_0018505_4275_5045 256
158 3300049579 Ga0501043_0188012 Ga0501043_0188012_540_1310 256
159 3300049581 Ga0501047_0134641 Ga0501047_0134641_1253_2023 256
160 3300049581 Ga0501047_0375610 Ga0501047_0375610_146_916 256
161 3300049581 Ga0501047_0449553 Ga0501047_0449553_206_994 256
162 3300049586 Ga0501070_0001074 Ga0501070_0001074_1020_1793 256
163 3300049586 Ga0501070_0024254 Ga0501070_0024254_1337_2125 256
164 3300049586 Ga0501070_0025346 Ga0501070_0025346_2596_3384 256
165 3300049741 Ga0501079_0001247 Ga0501079_0001247_4069_4842 256
166 3300049742 Ga0501080_0001643 Ga0501080_0001643_16665_17438 256
167 3300049742 Ga0501080_0037949 Ga0501080_0037949_3541_4314 256
168 3300049742 Ga0501080_0173482 Ga0501080_0173482_804_1574 256
169 3300049742 Ga0501080_0394603 Ga0501080_0394603_244_1017 256
170 3300049822 Ga0501035_0056289 Ga0501035_0056289_2014_2784 256
171 3300049823 Ga0501044_0014833 Ga0501044_0014833_1345_2115 256
172 3300050508 nmdc:mga09592_384582_c1 nmdc:mga09592_384582_c1_209_985 256
173 iso_pu_bacteria 2643221576 2643891715 256
174 iso_pu_bacteria 2643221578 2643897275 256
175 iso_pu_bacteria 2643221604 2644035720 256
176 iso_pu_bacteria 2643221673 2644408420 256
177 iso_pu_bacteria 2875391855 2875393219 256
178 iso_pu_bacteria 2946045630 2946051474 256
179 iso_pu_bacteria 2947224130 2947231151 256
180 iso_pu_bacteria 3002998708 3003008817 256
181 3300031251 Ga0265327_10002300 Ga0265327_100023007 257
182 3300047444 Ga0495675_0093185 Ga0495675_0093185_1067_1858 257
183 iso_pu_bacteria 2954002825 2954004458 257
184 3300005330 Ga0070690_100012247 Ga0070690_1000122475 258
185 3300005331 Ga0070670_100175354 Ga0070670_1001753542 258
186 3300005353 Ga0070669_100430764 Ga0070669_1004307642 258
187 3300005435 Ga0070714_100150481 Ga0070714_1001504812 258
188 3300009174 Ga0105241_10203944 Ga0105241_102039442 258
189 3300010375 Ga0105239_10307614 Ga0105239_103076142 258
190 3300013296 Ga0157374_10231404 Ga0157374_102314042 258
191 3300025929 Ga0207664_10130616 Ga0207664_101306162 258
192 3300027907 Ga0207428_10116902 Ga0207428_101169022 258
193 3300044656 Ga0466969_0068396 Ga0466969_0068396_156_935 258
194 3300044694 Ga0466963_0151030 Ga0466963_0151030_86_865 258
195 3300045976 Ga0466967_0008521 Ga0466967_0008521_998_1777 258
196 3300048920 Ga0496117_0012839 Ga0496117_0012839_2715_3512 258
197 3300048928 Ga0496125_0219416 Ga0496125_0219416_175_963 258
198 3300049574 Ga0501038_0266078 Ga0501038_0266078_173_952 258
199 3300049581 Ga0501047_0038446 Ga0501047_0038446_1535_2314 258
200 3300049593 Ga0501077_0027358 Ga0501077_0027358_1958_2737 258
201 iso_pu_bacteria 2784746768 2785365935 258
202 iso_pu_bacteria 2808606982 2811847506 258
203 iso_pu_bacteria 2862178590 2862183047 258
204 iso_pu_bacteria 2862290372 2862294022 258
205 iso_pu_bacteria 2877676314 2877684539 258
206 iso_pu_bacteria 2912715099 2912721735 258
207 iso_pu_bacteria 2995463766 2995464361 258
208 iso_pu_bacteria 2997451912 2997455135 258
209 iso_pu_bacteria 2997600082 2997600642 258
210 3300005367 Ga0070667_100007962 Ga0070667_1000079623 259
211 3300025986 Ga0207658_10052451 Ga0207658_100524513 259
212 3300032004 Ga0307414_10243551 Ga0307414_102435512 259
213 iso_pu_bacteria 2582581314 2585314197 259
214 iso_pu_bacteria 2616644814 2616694180 259
215 iso_pu_bacteria 2643221647 2644271018 259
216 iso_pu_bacteria 2808606375 2808919072 259
217 iso_pu_bacteria 2954380949 2954387912 259
218 iso_pu_bacteria 2954691527 2954698722 259
219 iso_pu_bacteria 2954701450 2954703500 259
220 iso_pu_bacteria 2990059506 2990064337 259
221 iso_pu_bacteria 8056667051 8056670391 259
222 3300003354 JGI25160J50197_1020084 JGI25160J50197_10200841 260
223 3300003354 JGI25160J50197_1028175 JGI25160J50197_10281752 260
224 3300025302 Ga0207426_1000393 Ga0207426_100039328 260
225 3300025302 Ga0207426_1001236 Ga0207426_10012362 260
226 3300025302 Ga0207426_1033776 Ga0207426_10337762 260
227 3300046477 Ga0495664_0003404 Ga0495664_0003404_2984_3769 260
228 3300046660 Ga0495625_0207261 Ga0495625_0207261_160_999 260
229 3300046660 Ga0495625_0208682 Ga0495625_0208682_216_998 260
230 3300048909 Ga0496106_0036052 Ga0496106_0036052_801_1583 260
231 iso_pu_bacteria 2643221587 2643945260 260
232 iso_pu_bacteria 2643221677 2644432159 260
233 iso_pu_bacteria 2918501144 2918501323 260
234 iso_pu_bacteria 8056829672 8056830847 260
235 3300025302 Ga0207426_1024521 Ga0207426_10245212 261
236 3300031616 Ga0307508_10004796 Ga0307508_100047968 261
237 3300042007 Ga0439449_0000442 Ga0439449_0000442_5906_6694 261
238 3300042014 Ga0439457_003992 Ga0439457_003992_1255_2040 261
239 3300046455 Ga0495603_0003925 Ga0495603_0003925_6199_6984 261
240 3300046459 Ga0495629_0006177 Ga0495629_0006177_6245_7030 261
241 3300046499 Ga0495594_0052350 Ga0495594_0052350_336_1121 261
242 3300046689 Ga0495613_0012371 Ga0495613_0012371_3710_4495 261
243 3300048089 Ga0495614_0007816 Ga0495614_0007816_3719_4504 261
244 3300054114 Ga0501084_0000010 Ga0501084_0000010_149836_150624 261
245 3300003578 Ga0006562J51391_1094202 Ga0006562J51391_10942026 262
246 3300015688 Ga0183367_1007 Ga0183367_1007310 262
247 3300028786 Ga0307517_10026995 Ga0307517_100269954 262
248 3300001989 JGI24739J22299_10016249 JGI24739J22299_100162493 263
249 3300001990 JGI24737J22298_10012505 JGI24737J22298_100125053 263
250 3300002075 JGI24738J21930_10009620 JGI24738J21930_100096203 263
251 3300005614 Ga0068856_100354931 Ga0068856_1003549312 263
252 3300006042 Ga0075368_10008459 Ga0075368_100084593 263
253 3300006178 Ga0075367_10022866 Ga0075367_100228664 263
254 3300009092 Ga0105250_10069075 Ga0105250_100690752 263
255 3300011119 Ga0105246_10028276 Ga0105246_100282762 263
256 3300014497 Ga0182008_10016007 Ga0182008_100160072 263
257 3300015261 Ga0182006_1014320 Ga0182006_10143203 263
258 3300015262 Ga0182007_10003573 Ga0182007_100035736 263
259 3300015265 Ga0182005_1006994 Ga0182005_10069943 263
260 3300026078 Ga0207702_10299894 Ga0207702_102998942 263
261 3300027866 Ga0209813_10014038 Ga0209813_100140382 263
262 3300028786 Ga0307517_10108987 Ga0307517_101089872 263
263 3300037466 Ga0395898_0009610 Ga0395898_0009610_5353_6144 263
264 3300046454 Ga0495592_0081564 Ga0495592_0081564_164_955 263
265 3300046455 Ga0495603_0018175 Ga0495603_0018175_2534_3325 263
266 3300046459 Ga0495629_0005445 Ga0495629_0005445_5935_6726 263
267 3300046462 Ga0495651_0144322 Ga0495651_0144322_40_831 263
268 3300046473 Ga0495582_0208752 Ga0495582_0208752_168_959 263
269 3300046476 Ga0495662_0021482 Ga0495662_0021482_10_801 263
270 3300046476 Ga0495662_0056308 Ga0495662_0056308_527_1318 263
271 3300046499 Ga0495594_0108112 Ga0495594_0108112_229_1020 263
272 3300046514 Ga0495618_0210952 Ga0495618_0210952_408_1199 263
273 3300046529 Ga0495652_0097051 Ga0495652_0097051_1370_2161 263
274 3300046674 Ga0495588_0093018 Ga0495588_0093018_413_1204 263
275 3300046675 Ga0495657_0047979 Ga0495657_0047979_526_1317 263
276 3300046683 Ga0495658_0140241 Ga0495658_0140241_266_1066 263
277 3300046689 Ga0495613_0203633 Ga0495613_0203633_85_876 263
278 3300046794 Ga0495589_0020216 Ga0495589_0020216_1994_2785 263
279 3300046809 Ga0495600_0105940 Ga0495600_0105940_764_1555 263
280 3300047317 Ga0495604_0022763 Ga0495604_0022763_3740_4531 263
281 3300047322 Ga0495680_0167947 Ga0495680_0167947_461_1252 263
282 3300047444 Ga0495675_0059961 Ga0495675_0059961_1556_2347 263
283 3300048911 Ga0496108_0170951 Ga0496108_0170951_1070_1861 263
284 3300048912 Ga0496109_0082267 Ga0496109_0082267_1094_1885 263
285 3300049586 Ga0501070_0108829 Ga0501070_0108829_1145_1939 263
286 3300050490 nmdc:mga03n38_323686_c1 nmdc:mga03n38_323686_c1_19_810 263
287 3300050494 nmdc:mga06z11_9141_c1 nmdc:mga06z11_9141_c1_2322_3113 263
288 3300050495 nmdc:mga04h51_4179_c1 nmdc:mga04h51_4179_c1_1619_2410 263
289 iso_pu_bacteria 2873151551 2873152732 263
290 iso_pu_bacteria 8025478263 8025479563 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

169

285

0.96

PF00106

adh_short

short chain dehydrogenase

14

148

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

20

149

0.94

PF00106

adh_short

short chain dehydrogenase

171

242

0.89

PF08659

KR

KR domain

15

140

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9735 15 257
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.9723 14 258
4ni5-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from brucella suis 0.9708 15 259
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9707 14 258
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9705 13 258
ID Description Score Start End Superfamily
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9737 14 258 3.40.50.720
af_I6YCF0_1_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9723 1 258 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9723 14 258 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9707 14 258 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9706 15 258 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B3H2C6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9847 5 168 GO:0016491
AF-T0ZKV0-F1-model_v4 Short chain dehydrogenase 0.9806 19 198
AF-A0A3N1T7Q9-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9804 3 263 GO:0016616
GO:0030497
AF-A0A2N5KFC8-F1-model_v4 Short-chain dehydrogenase 0.9758 17 258
AF-A0A8B5XGS7-F1-model_v4 SDR family oxidoreductase 0.9752 16 259 GO:0016616

Feature Viewer

pLDDT pTM Quality
91.07 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map