F390451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 291 | 192 | 582 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300035242|Ga0373962_0006829|Ga0373962_0006829_692_1585 |
| Length | 297 |
| Sequence | MPERRNAPFSPQRPFALAPLPDVILEPIVKLALAEDLGVAGDLTTDALIDPETRGRWALRARKPGVVAGLDAASLTAWFVDPDLLFDIKKQDGASIGSNETIIEIEGYARSMLTAERVMLNFIGRLSGVATLTRAYVDAVSGTSAIIASTRKTTPGLRALEKRAVKLGGGGSHRYGLDDAILIKDNHIAACGGVTAAMARARAAAGHLCMIEIEVDSLDQLEEALACKPNVILLDNFSLSSMRAAVKLTDGAVALEASGGVSLDSVRAIAETGVDIISIGALTHSATSLDIGLDALD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 50 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 51 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 52 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 87 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 89 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 92 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 93 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 94 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 95 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 96 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 97 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 98 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 99 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 100 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 101 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 102 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 103 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 104 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 105 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 110 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 111 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 139 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 140 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 141 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 145 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 146 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 147 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 148 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 149 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 150 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 151 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 152 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 153 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 154 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 155 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 156 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 157 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 158 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 159 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 160 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 161 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 162 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 163 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 164 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 165 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 166 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 167 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 168 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 169 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 170 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 171 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 172 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 173 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 174 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 175 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 176 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 177 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 178 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 179 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 180 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 181 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 182 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 183 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 184 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 185 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 186 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 187 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 188 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 189 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 190 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 191 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 192 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.75 |
| Metatranscriptomes | 0 |
| Isolates | 8.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.93 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 69.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373962_0006829 | 3300035242 | Bacteria | 2777 |
| 2 | rootH1_10006765 | 3300003323 | Bacteria | 6413 |
| 3 | Ga0055524_1033814 | 3300003775 | Bacteria | 1424 |
| 4 | Ga0055536_1002260 | 3300003781 | Bacteria | 10953 |
| 5 | Ga0055530_10000752 | 3300003791 | Bacteria | 26932 |
| 6 | Ga0055530_10002411 | 3300003791 | Bacteria | 12100 |
| 7 | Ga0055531_10000749 | 3300003794 | Bacteria | 27331 |
| 8 | Ga0055531_10001683 | 3300003794 | Bacteria | 15905 |
| 9 | Ga0065165_1002257 | 3300005262 | Bacteria | 17042 |
| 10 | Ga0070658_10085082 | 3300005327 | Bacteria | 2600 |
| 11 | Ga0070658_10089739 | 3300005327 | Bacteria | 2531 |
| 12 | Ga0070670_100000237 | 3300005331 | Bacteria | 49913 |
| 13 | Ga0070670_100064496 | 3300005331 | Bacteria | 3143 |
| 14 | Ga0070666_10047327 | 3300005335 | Bacteria | 2887 |
| 15 | Ga0070666_10057380 | 3300005335 | Bacteria | 2631 |
| 16 | Ga0070680_100011408 | 3300005336 | Bacteria | 6872 |
| 17 | Ga0070680_100041083 | 3300005336 | Bacteria | 3749 |
| 18 | Ga0070689_100240398 | 3300005340 | Bacteria | 1491 |
| 19 | Ga0070668_100000233 | 3300005347 | Bacteria | 36341 |
| 20 | Ga0070669_100101333 | 3300005353 | Bacteria | 2173 |
| 21 | Ga0070659_100021980 | 3300005366 | Bacteria | 4867 |
| 22 | Ga0070667_100000272 | 3300005367 | Bacteria | 58738 |
| 23 | Ga0070667_100000504 | 3300005367 | Bacteria | 39552 |
| 24 | Ga0070667_100044523 | 3300005367 | Bacteria | 3728 |
| 25 | Ga0070714_100288320 | 3300005435 | Bacteria | 1527 |
| 26 | Ga0070681_10004265 | 3300005458 | Bacteria | 13563 |
| 27 | Ga0070679_100015319 | 3300005530 | Bacteria | 7368 |
| 28 | Ga0070679_100044956 | 3300005530 | Bacteria | 4400 |
| 29 | Ga0068853_100011000 | 3300005539 | Bacteria | 7338 |
| 30 | Ga0070665_100001466 | 3300005548 | Bacteria | 27627 |
| 31 | Ga0070704_100521728 | 3300005549 | Bacteria | 1034 |
| 32 | Ga0068855_100035094 | 3300005563 | Bacteria | 5975 |
| 33 | Ga0068855_100036738 | 3300005563 | Bacteria | 5828 |
| 34 | Ga0068855_100303012 | 3300005563 | Bacteria | 1769 |
| 35 | Ga0068856_100522195 | 3300005614 | Bacteria | 1209 |
| 36 | Ga0068852_100024576 | 3300005616 | Bacteria | 4871 |
| 37 | Ga0068859_100000231 | 3300005617 | Bacteria | 55036 |
| 38 | Ga0068859_100297174 | 3300005617 | Bacteria | 1708 |
| 39 | Ga0068864_100000597 | 3300005618 | Bacteria | 30646 |
| 40 | Ga0068863_100000135 | 3300005841 | Bacteria | 78221 |
| 41 | Ga0068858_100009028 | 3300005842 | Bacteria | 9535 |
| 42 | Ga0068858_100042287 | 3300005842 | Bacteria | 4225 |
| 43 | Ga0068860_100000526 | 3300005843 | Bacteria | 46691 |
| 44 | Ga0068860_100086004 | 3300005843 | Bacteria | 2992 |
| 45 | Ga0068860_100098824 | 3300005843 | Bacteria | 2783 |
| 46 | Ga0068862_100000459 | 3300005844 | Bacteria | 44048 |
| 47 | Ga0068862_100061397 | 3300005844 | Bacteria | 3231 |
| 48 | Ga0075364_10001541 | 3300006051 | Bacteria | 12575 |
| 49 | Ga0075369_10025431 | 3300006186 | Bacteria | 2462 |
| 50 | Ga0075366_10005456 | 3300006195 | Bacteria | 6892 |
| 51 | Ga0075366_10060689 | 3300006195 | Bacteria | 2246 |
| 52 | Ga0075370_10171457 | 3300006353 | Bacteria | 1275 |
| 53 | Ga0097620_100000231 | 3300006931 | Bacteria | 55036 |
| 54 | Ga0097620_100297147 | 3300006931 | Bacteria | 1708 |
| 55 | Ga0105240_10019170 | 3300009093 | Bacteria | 9146 |
| 56 | Ga0105240_10044932 | 3300009093 | Bacteria | 5607 |
| 57 | Ga0105240_10223630 | 3300009093 | Bacteria | 2191 |
| 58 | Ga0105247_10042369 | 3300009101 | Bacteria | 2788 |
| 59 | Ga0105248_10004008 | 3300009177 | Bacteria | 16272 |
| 60 | Ga0105248_10359888 | 3300009177 | Bacteria | 1638 |
| 61 | Ga0105237_10315304 | 3300009545 | Bacteria | 1567 |
| 62 | Ga0105249_10001217 | 3300009553 | Bacteria | 22698 |
| 63 | Ga0157373_10000383 | 3300013100 | Bacteria | 35475 |
| 64 | Ga0157373_10005130 | 3300013100 | Bacteria | 9846 |
| 65 | Ga0157373_10263349 | 3300013100 | Bacteria | 1220 |
| 66 | Ga0157369_10012684 | 3300013105 | Bacteria | 9558 |
| 67 | Ga0163162_10067325 | 3300013306 | Bacteria | 3631 |
| 68 | Ga0157375_10867810 | 3300013308 | Bacteria | 1048 |
| 69 | Ga0163163_10011074 | 3300014325 | Bacteria | 8159 |
| 70 | Ga0157377_10076719 | 3300014745 | Bacteria | 1944 |
| 71 | Ga0157379_10004950 | 3300014968 | Bacteria | 11428 |
| 72 | Ga0157379_10011931 | 3300014968 | Bacteria | 7592 |
| 73 | Ga0213874_10004966 | 3300021377 | Bacteria | 3073 |
| 74 | Ga0213876_10000183 | 3300021384 | Bacteria | 64845 |
| 75 | Ga0213875_10048994 | 3300021388 | Bacteria | 1981 |
| 76 | Ga0209148_1024746 | 3300025254 | Bacteria | 945 |
| 77 | Ga0209673_1029990 | 3300025273 | Bacteria | 1722 |
| 78 | Ga0209676_1000119 | 3300025292 | Bacteria | 201094 |
| 79 | Ga0209676_1000282 | 3300025292 | Bacteria | 105777 |
| 80 | Ga0209564_1002945 | 3300025295 | Bacteria | 12347 |
| 81 | Ga0209564_1017516 | 3300025295 | Bacteria | 2787 |
| 82 | Ga0209758_1000816 | 3300025297 | Bacteria | 43874 |
| 83 | Ga0209758_1002757 | 3300025297 | Bacteria | 17216 |
| 84 | Ga0209050_1000049 | 3300025298 | Bacteria | 364096 |
| 85 | Ga0209050_1003143 | 3300025298 | Bacteria | 12601 |
| 86 | Ga0209050_1003150 | 3300025298 | Bacteria | 12573 |
| 87 | Ga0209256_1001622 | 3300025299 | Bacteria | 21931 |
| 88 | Ga0209257_1000036 | 3300025304 | Bacteria | 616006 |
| 89 | Ga0209257_1000327 | 3300025304 | Bacteria | 99581 |
| 90 | Ga0209257_1000332 | 3300025304 | Bacteria | 98632 |
| 91 | Ga0209257_1001207 | 3300025304 | Bacteria | 32467 |
| 92 | Ga0209257_1003799 | 3300025304 | Bacteria | 12432 |
| 93 | Ga0207680_10031747 | 3300025903 | Bacteria | 2995 |
| 94 | Ga0207643_10052092 | 3300025908 | Bacteria | 2324 |
| 95 | Ga0207707_10052161 | 3300025912 | Bacteria | 3562 |
| 96 | Ga0207707_10162746 | 3300025912 | Bacteria | 1951 |
| 97 | Ga0207695_10003553 | 3300025913 | Bacteria | 21835 |
| 98 | Ga0207695_10012950 | 3300025913 | Bacteria | 9973 |
| 99 | Ga0207660_10040920 | 3300025917 | Bacteria | 3246 |
| 100 | Ga0207660_10122959 | 3300025917 | Bacteria | 1967 |
| 101 | Ga0207652_10271303 | 3300025921 | Bacteria | 1530 |
| 102 | Ga0207681_10101723 | 3300025923 | Bacteria | 2073 |
| 103 | Ga0207650_10000136 | 3300025925 | Bacteria | 89925 |
| 104 | Ga0207650_10046147 | 3300025925 | Bacteria | 3208 |
| 105 | Ga0207644_10004972 | 3300025931 | Bacteria | 8669 |
| 106 | Ga0207690_10002323 | 3300025932 | Bacteria | 11585 |
| 107 | Ga0207686_10043861 | 3300025934 | Bacteria | 2743 |
| 108 | Ga0207711_10057035 | 3300025941 | Bacteria | 3357 |
| 109 | Ga0207711_10227023 | 3300025941 | Bacteria | 1709 |
| 110 | Ga0207667_10018280 | 3300025949 | Bacteria | 7867 |
| 111 | Ga0207667_10201901 | 3300025949 | Bacteria | 2039 |
| 112 | Ga0207712_10000900 | 3300025961 | Bacteria | 21552 |
| 113 | Ga0207668_10000360 | 3300025972 | Bacteria | 29295 |
| 114 | Ga0207668_10003421 | 3300025972 | Bacteria | 9308 |
| 115 | Ga0207668_10016115 | 3300025972 | Bacteria | 4658 |
| 116 | Ga0207658_10000379 | 3300025986 | Bacteria | 43390 |
| 117 | Ga0207658_10000605 | 3300025986 | Bacteria | 31883 |
| 118 | Ga0207703_10002251 | 3300026035 | Bacteria | 16864 |
| 119 | Ga0207703_10007795 | 3300026035 | Bacteria | 8476 |
| 120 | Ga0207639_10015146 | 3300026041 | Bacteria | 5432 |
| 121 | Ga0207702_10283511 | 3300026078 | Bacteria | 1567 |
| 122 | Ga0207641_10000770 | 3300026088 | Bacteria | 34326 |
| 123 | Ga0207641_10005746 | 3300026088 | Bacteria | 10539 |
| 124 | Ga0207676_10000523 | 3300026095 | Bacteria | 32225 |
| 125 | Ga0209981_1009897 | 3300027378 | Bacteria | 1306 |
| 126 | Ga0209999_1004611 | 3300027543 | Bacteria | 2473 |
| 127 | Ga0268266_10001720 | 3300028379 | Bacteria | 25070 |
| 128 | Ga0268265_10003113 | 3300028380 | Bacteria | 12100 |
| 129 | Ga0268265_10202758 | 3300028380 | Bacteria | 1722 |
| 130 | Ga0268264_10000192 | 3300028381 | Bacteria | 126749 |
| 131 | Ga0268264_10035390 | 3300028381 | Bacteria | 4111 |
| 132 | Ga0268264_10254781 | 3300028381 | Bacteria | 1632 |
| 133 | Ga0307515_10060782 | 3300028794 | Bacteria | 5379 |
| 134 | Ga0307515_10086135 | 3300028794 | Bacteria | 4009 |
| 135 | Ga0265338_10026003 | 3300028800 | Bacteria | 5918 |
| 136 | Ga0265338_10118202 | 3300028800 | Bacteria | 2119 |
| 137 | Ga0307511_10008050 | 3300030521 | Bacteria | 10566 |
| 138 | Ga0265327_10000140 | 3300031251 | Bacteria | 158935 |
| 139 | Ga0265327_10007619 | 3300031251 | Bacteria | 8300 |
| 140 | Ga0265327_10114909 | 3300031251 | Bacteria | 1281 |
| 141 | Ga0265314_10061617 | 3300031711 | Bacteria | 2553 |
| 142 | Ga0373946_0013082 | 3300035171 | Bacteria | 3114 |
| 143 | Ga0373931_0003958 | 3300035691 | Bacteria | 6707 |
| 144 | Ga0373927_0000188 | 3300035695 | Bacteria | 49189 |
| 145 | Ga0373925_0000247 | 3300037068 | Bacteria | 57283 |
| 146 | Ga0395900_0035046 | 3300037418 | Bacteria | 5169 |
| 147 | Ga0395900_0163709 | 3300037418 | Bacteria | 2268 |
| 148 | Ga0395900_0184694 | 3300037418 | Bacteria | 2117 |
| 149 | Ga0395898_0018150 | 3300037466 | Bacteria | 7181 |
| 150 | Ga0395898_0496442 | 3300037466 | Bacteria | 1161 |
| 151 | Ga0395905_0195628 | 3300037471 | Bacteria | 1896 |
| 152 | Ga0395905_0532840 | 3300037471 | Bacteria | 1075 |
| 153 | Ga0436364_0461411 | 3300037853 | Bacteria | 2484 |
| 154 | Ga0436364_1246530 | 3300037853 | Bacteria | 1434 |
| 155 | Ga0395901_0025185 | 3300038443 | Bacteria | 6108 |
| 156 | Ga0395901_0733018 | 3300038443 | Bacteria | 983 |
| 157 | Ga0436365_0640791 | 3300039437 | Bacteria | 50242 |
| 158 | Ga0436365_0998372 | 3300039437 | Bacteria | 6712 |
| 159 | Ga0436361_0447772 | 3300039447 | Bacteria | 7779 |
| 160 | Ga0436361_0808480 | 3300039447 | Bacteria | 14827 |
| 161 | Ga0436363_1355867 | 3300039450 | Bacteria | 2227 |
| 162 | Ga0436363_1605317 | 3300039450 | Bacteria | 3555 |
| 163 | Ga0439461_0017341 | 3300041410 | Bacteria | 1399 |
| 164 | Ga0439446_0010344 | 3300042156 | Bacteria | 2511 |
| 165 | Ga0466969_0003007 | 3300044656 | Bacteria | 8982 |
| 166 | Ga0466969_0019889 | 3300044656 | Bacteria | 3481 |
| 167 | Ga0466966_0000375 | 3300044684 | Bacteria | 29156 |
| 168 | Ga0466966_0000979 | 3300044684 | Bacteria | 18323 |
| 169 | Ga0466961_0001014 | 3300044693 | Bacteria | 17335 |
| 170 | Ga0466961_0010192 | 3300044693 | Bacteria | 5987 |
| 171 | Ga0466963_0104889 | 3300044694 | Bacteria | 1937 |
| 172 | Ga0466971_0000522 | 3300044719 | Bacteria | 15195 |
| 173 | Ga0466971_0003502 | 3300044719 | Bacteria | 6703 |
| 174 | Ga0466970_0001081 | 3300044765 | Bacteria | 13196 |
| 175 | Ga0466959_0000108 | 3300045049 | Bacteria | 53075 |
| 176 | Ga0466959_0058821 | 3300045049 | Bacteria | 2799 |
| 177 | Ga0466959_0111449 | 3300045049 | Bacteria | 1952 |
| 178 | Ga0466958_0045015 | 3300045836 | Bacteria | 2661 |
| 179 | Ga0495590_0001689 | 3300046457 | Bacteria | 9390 |
| 180 | Ga0495638_0000692 | 3300046460 | Bacteria | 36575 |
| 181 | Ga0495638_0001024 | 3300046460 | Bacteria | 27760 |
| 182 | Ga0495638_0002437 | 3300046460 | Bacteria | 15194 |
| 183 | Ga0495638_0003978 | 3300046460 | Bacteria | 11372 |
| 184 | Ga0495638_0004691 | 3300046460 | Bacteria | 10330 |
| 185 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 186 | Ga0495583_0000013 | 3300046506 | Bacteria | 323372 |
| 187 | Ga0495606_0038241 | 3300046507 | Bacteria | 3248 |
| 188 | Ga0495610_0000078 | 3300046512 | Bacteria | 116266 |
| 189 | Ga0495610_0002837 | 3300046512 | Bacteria | 14102 |
| 190 | Ga0495610_0009513 | 3300046512 | Bacteria | 6133 |
| 191 | Ga0495616_0000222 | 3300046513 | Bacteria | 46999 |
| 192 | Ga0495631_0029679 | 3300046518 | Bacteria | 2485 |
| 193 | Ga0495632_0003808 | 3300046519 | Bacteria | 10517 |
| 194 | Ga0495632_0052162 | 3300046519 | Bacteria | 2011 |
| 195 | Ga0495632_0187898 | 3300046519 | Bacteria | 944 |
| 196 | Ga0495637_0009782 | 3300046520 | Bacteria | 4665 |
| 197 | Ga0495643_0058200 | 3300046522 | Bacteria | 2057 |
| 198 | Ga0495643_0101504 | 3300046522 | Bacteria | 1474 |
| 199 | Ga0495648_0000072 | 3300046524 | Bacteria | 132630 |
| 200 | Ga0495648_0139916 | 3300046524 | Bacteria | 1275 |
| 201 | Ga0495654_0000026 | 3300046530 | Bacteria | 234940 |
| 202 | Ga0495654_0046369 | 3300046530 | Bacteria | 2141 |
| 203 | Ga0495609_0036065 | 3300046538 | Bacteria | 2235 |
| 204 | Ga0495668_0000105 | 3300046616 | Bacteria | 133981 |
| 205 | Ga0495668_0062538 | 3300046616 | Bacteria | 2051 |
| 206 | Ga0495668_0067039 | 3300046616 | Bacteria | 1974 |
| 207 | Ga0495625_0000683 | 3300046660 | Bacteria | 48312 |
| 208 | Ga0495625_0001108 | 3300046660 | Bacteria | 34911 |
| 209 | Ga0495625_0011966 | 3300046660 | Bacteria | 7043 |
| 210 | Ga0495625_0013372 | 3300046660 | Bacteria | 6596 |
| 211 | Ga0495625_0026553 | 3300046660 | Bacteria | 4374 |
| 212 | Ga0495625_0046253 | 3300046660 | Bacteria | 3141 |
| 213 | Ga0495669_0000004 | 3300046684 | Bacteria | 208878 |
| 214 | Ga0495613_0003028 | 3300046689 | Bacteria | 12569 |
| 215 | Ga0495671_0046906 | 3300046692 | Bacteria | 2160 |
| 216 | Ga0495649_0000586 | 3300046694 | Bacteria | 30569 |
| 217 | Ga0495672_0001047 | 3300047320 | Bacteria | 28265 |
| 218 | Ga0495672_0023281 | 3300047320 | Bacteria | 4010 |
| 219 | Ga0495673_0000483 | 3300047469 | Bacteria | 42457 |
| 220 | Ga0495673_0001103 | 3300047469 | Bacteria | 23234 |
| 221 | Ga0495681_0070741 | 3300047470 | Bacteria | 1581 |
| 222 | Ga0495686_0003048 | 3300047472 | Bacteria | 14849 |
| 223 | Ga0495686_0004978 | 3300047472 | Bacteria | 10684 |
| 224 | Ga0495686_0011274 | 3300047472 | Bacteria | 6301 |
| 225 | Ga0495686_0040509 | 3300047472 | Bacteria | 2970 |
| 226 | Ga0495686_0051792 | 3300047472 | Bacteria | 2575 |
| 227 | Ga0495686_0078362 | 3300047472 | Bacteria | 2022 |
| 228 | Ga0495615_0063385 | 3300048090 | Bacteria | 981 |
| 229 | Ga0496107_0057081 | 3300048910 | Bacteria | 2822 |
| 230 | Ga0496115_0002236 | 3300048918 | Bacteria | 13875 |
| 231 | Ga0496115_0069032 | 3300048918 | Bacteria | 2862 |
| 232 | Ga0496125_0002295 | 3300048928 | Bacteria | 25284 |
| 233 | Ga0496125_0030292 | 3300048928 | Bacteria | 4843 |
| 234 | Ga0496126_0003606 | 3300048929 | Bacteria | 19378 |
| 235 | Ga0501047_0000537 | 3300049581 | Bacteria | 41106 |
| 236 | Ga0501073_0297685 | 3300049589 | Bacteria | 1113 |
| 237 | Ga0501257_006630 | 3300049686 | Bacteria | 2570 |
| 238 | nmdc:mga00v17_2891_c1 | 3300050491 | Bacteria | 8808 |
| 239 | nmdc:mga0k408_13943_c1 | 3300050493 | Bacteria | 4417 |
| 240 | nmdc:mga06z11_17453_c1 | 3300050494 | Bacteria | 3258 |
| 241 | nmdc:mga07m45_105981_c1 | 3300050496 | Bacteria | 1617 |
| 242 | nmdc:mga07m45_2430_c1 | 3300050496 | Bacteria | 8736 |
| 243 | nmdc:mga0sz30_2588_c1 | 3300050516 | Bacteria | 6433 |
| 244 | Ga0500578_0003935 | 3300053086 | Bacteria | 10784 |
| 245 | Ga0500644_0000238 | 3300053088 | Bacteria | 31362 |
| 246 | Ga0500644_0042807 | 3300053088 | Bacteria | 1512 |
| 247 | Ga0500647_0007375 | 3300053091 | Bacteria | 4723 |
| 248 | Ga0500556_0001174 | 3300053104 | Bacteria | 12502 |
| 249 | Ga0500562_000847 | 3300053108 | Bacteria | 7406 |
| 250 | Ga0500562_002216 | 3300053108 | Bacteria | 4861 |
| 251 | Ga0500572_000545 | 3300053111 | Bacteria | 12794 |
| 252 | Ga0500594_0007890 | 3300053118 | Bacteria | 2415 |
| 253 | Ga0500595_003265 | 3300053119 | Bacteria | 7658 |
| 254 | Ga0500608_000046 | 3300053122 | Bacteria | 55792 |
| 255 | Ga0500618_000058 | 3300053125 | Bacteria | 97628 |
| 256 | Ga0500658_0003755 | 3300053134 | Bacteria | 5721 |
| 257 | Ga0500559_0000006 | 3300053136 | Bacteria | 229895 |
| 258 | Ga0500559_0000190 | 3300053136 | Bacteria | 49263 |
| 259 | Ga0500559_0009960 | 3300053136 | Bacteria | 4095 |
| 260 | Ga0500564_000496 | 3300053138 | Bacteria | 11572 |
| 261 | Ga0500622_0030924 | 3300053156 | Bacteria | 2809 |
| 262 | Ga0500627_0044504 | 3300053158 | Bacteria | 1917 |
| 263 | Ga0500639_128915 | 3300053163 | Bacteria | 1201 |
| 264 | Ga0500645_002606 | 3300053730 | Bacteria | 7913 |
| 265 | Ga0500645_003237 | 3300053730 | Bacteria | 6732 |
| 266 | Ga0500609_002067 | 3300053731 | Bacteria | 2884 |
| 267 | Ga0466962_0005658 | 3300061719 | Bacteria | 6005 |
| 268 | 2511121782 | 2510917020 | Bacteria | 5657507 |
| 269 | 2585147765 | 2582581279 | Bacteria | 4980720 |
| 270 | 2585152958 | 2582581280 | Bacteria | 5994497 |
| 271 | 2585195083 | 2582581293 | Bacteria | 5907401 |
| 272 | 2587917440 | 2585428106 | Bacteria | 5179711 |
| 273 | 2643747123 | 2643221545 | Bacteria | 5083237 |
| 274 | 2643783152 | 2643221552 | Bacteria | 5708754 |
| 275 | 2643924429 | 2643221583 | Bacteria | 5218014 |
| 276 | 2643930905 | 2643221584 | Bacteria | 5511711 |
| 277 | 2644227037 | 2643221640 | Bacteria | 5258820 |
| 278 | 2644233495 | 2643221642 | Bacteria | 5357871 |
| 279 | 2644507679 | 2643221691 | Bacteria | 5093099 |
| 280 | 2792461024 | 2791355048 | Bacteria | 5832535 |
| 281 | 2819537458 | 2818991435 | Bacteria | 5433759 |
| 282 | 2819646480 | 2818991454 | Bacteria | 5563326 |
| 283 | 2843749307 | 2843744320 | Bacteria | 5659202 |
| 284 | 2849562716 | 2849560528 | Bacteria | 5393480 |
| 285 | 2849578005 | 2849573788 | Bacteria | 5421256 |
| 286 | 2851154017 | 2851153111 | Bacteria | 5542585 |
| 287 | 2857508404 | 2857504554 | Bacteria | 5369913 |
| 288 | 2884961981 | 2884960567 | Bacteria | 5437054 |
| 289 | 2898333170 | 2898329390 | Bacteria | 5168154 |
| 290 | 2928533397 | 2928531327 | Bacteria | 5101314 |
| 291 | 2941489292 | 2941485952 | Bacteria | 3591484 |
| 292 | Ga0373962_0006829 | |||
| 293 | rootH1_10006765 | |||
| 294 | Ga0055524_1033814 | |||
| 295 | Ga0055536_1002260 | |||
| 296 | Ga0055530_10000752 | |||
| 297 | Ga0055530_10002411 | |||
| 298 | Ga0055531_10000749 | |||
| 299 | Ga0055531_10001683 | |||
| 300 | Ga0065165_1002257 | |||
| 301 | Ga0070658_10085082 | |||
| 302 | Ga0070658_10089739 | |||
| 303 | Ga0070670_100000237 | |||
| 304 | Ga0070670_100064496 | |||
| 305 | Ga0070666_10047327 | |||
| 306 | Ga0070666_10057380 | |||
| 307 | Ga0070680_100011408 | |||
| 308 | Ga0070680_100041083 | |||
| 309 | Ga0070689_100240398 | |||
| 310 | Ga0070668_100000233 | |||
| 311 | Ga0070669_100101333 | |||
| 312 | Ga0070659_100021980 | |||
| 313 | Ga0070667_100000272 | |||
| 314 | Ga0070667_100000504 | |||
| 315 | Ga0070667_100044523 | |||
| 316 | Ga0070714_100288320 | |||
| 317 | Ga0070681_10004265 | |||
| 318 | Ga0070679_100015319 | |||
| 319 | Ga0070679_100044956 | |||
| 320 | Ga0068853_100011000 | |||
| 321 | Ga0070665_100001466 | |||
| 322 | Ga0070704_100521728 | |||
| 323 | Ga0068855_100035094 | |||
| 324 | Ga0068855_100036738 | |||
| 325 | Ga0068855_100303012 | |||
| 326 | Ga0068856_100522195 | |||
| 327 | Ga0068852_100024576 | |||
| 328 | Ga0068859_100000231 | |||
| 329 | Ga0068859_100297174 | |||
| 330 | Ga0068864_100000597 | |||
| 331 | Ga0068863_100000135 | |||
| 332 | Ga0068858_100009028 | |||
| 333 | Ga0068858_100042287 | |||
| 334 | Ga0068860_100000526 | |||
| 335 | Ga0068860_100086004 | |||
| 336 | Ga0068860_100098824 | |||
| 337 | Ga0068862_100000459 | |||
| 338 | Ga0068862_100061397 | |||
| 339 | Ga0075364_10001541 | |||
| 340 | Ga0075369_10025431 | |||
| 341 | Ga0075366_10005456 | |||
| 342 | Ga0075366_10060689 | |||
| 343 | Ga0075370_10171457 | |||
| 344 | Ga0097620_100000231 | |||
| 345 | Ga0097620_100297147 | |||
| 346 | Ga0105240_10019170 | |||
| 347 | Ga0105240_10044932 | |||
| 348 | Ga0105240_10223630 | |||
| 349 | Ga0105247_10042369 | |||
| 350 | Ga0105248_10004008 | |||
| 351 | Ga0105248_10359888 | |||
| 352 | Ga0105237_10315304 | |||
| 353 | Ga0105249_10001217 | |||
| 354 | Ga0157373_10000383 | |||
| 355 | Ga0157373_10005130 | |||
| 356 | Ga0157373_10263349 | |||
| 357 | Ga0157369_10012684 | |||
| 358 | Ga0163162_10067325 | |||
| 359 | Ga0157375_10867810 | |||
| 360 | Ga0163163_10011074 | |||
| 361 | Ga0157377_10076719 | |||
| 362 | Ga0157379_10004950 | |||
| 363 | Ga0157379_10011931 | |||
| 364 | Ga0213874_10004966 | |||
| 365 | Ga0213876_10000183 | |||
| 366 | Ga0213875_10048994 | |||
| 367 | Ga0209148_1024746 | |||
| 368 | Ga0209673_1029990 | |||
| 369 | Ga0209676_1000119 | |||
| 370 | Ga0209676_1000282 | |||
| 371 | Ga0209564_1002945 | |||
| 372 | Ga0209564_1017516 | |||
| 373 | Ga0209758_1000816 | |||
| 374 | Ga0209758_1002757 | |||
| 375 | Ga0209050_1000049 | |||
| 376 | Ga0209050_1003143 | |||
| 377 | Ga0209050_1003150 | |||
| 378 | Ga0209256_1001622 | |||
| 379 | Ga0209257_1000036 | |||
| 380 | Ga0209257_1000327 | |||
| 381 | Ga0209257_1000332 | |||
| 382 | Ga0209257_1001207 | |||
| 383 | Ga0209257_1003799 | |||
| 384 | Ga0207680_10031747 | |||
| 385 | Ga0207643_10052092 | |||
| 386 | Ga0207707_10052161 | |||
| 387 | Ga0207707_10162746 | |||
| 388 | Ga0207695_10003553 | |||
| 389 | Ga0207695_10012950 | |||
| 390 | Ga0207660_10040920 | |||
| 391 | Ga0207660_10122959 | |||
| 392 | Ga0207652_10271303 | |||
| 393 | Ga0207681_10101723 | |||
| 394 | Ga0207650_10000136 | |||
| 395 | Ga0207650_10046147 | |||
| 396 | Ga0207644_10004972 | |||
| 397 | Ga0207690_10002323 | |||
| 398 | Ga0207686_10043861 | |||
| 399 | Ga0207711_10057035 | |||
| 400 | Ga0207711_10227023 | |||
| 401 | Ga0207667_10018280 | |||
| 402 | Ga0207667_10201901 | |||
| 403 | Ga0207712_10000900 | |||
| 404 | Ga0207668_10000360 | |||
| 405 | Ga0207668_10003421 | |||
| 406 | Ga0207668_10016115 | |||
| 407 | Ga0207658_10000379 | |||
| 408 | Ga0207658_10000605 | |||
| 409 | Ga0207703_10002251 | |||
| 410 | Ga0207703_10007795 | |||
| 411 | Ga0207639_10015146 | |||
| 412 | Ga0207702_10283511 | |||
| 413 | Ga0207641_10000770 | |||
| 414 | Ga0207641_10005746 | |||
| 415 | Ga0207676_10000523 | |||
| 416 | Ga0209981_1009897 | |||
| 417 | Ga0209999_1004611 | |||
| 418 | Ga0268266_10001720 | |||
| 419 | Ga0268265_10003113 | |||
| 420 | Ga0268265_10202758 | |||
| 421 | Ga0268264_10000192 | |||
| 422 | Ga0268264_10035390 | |||
| 423 | Ga0268264_10254781 | |||
| 424 | Ga0307515_10060782 | |||
| 425 | Ga0307515_10086135 | |||
| 426 | Ga0265338_10026003 | |||
| 427 | Ga0265338_10118202 | |||
| 428 | Ga0307511_10008050 | |||
| 429 | Ga0265327_10000140 | |||
| 430 | Ga0265327_10007619 | |||
| 431 | Ga0265327_10114909 | |||
| 432 | Ga0265314_10061617 | |||
| 433 | Ga0373946_0013082 | |||
| 434 | Ga0373931_0003958 | |||
| 435 | Ga0373927_0000188 | |||
| 436 | Ga0373925_0000247 | |||
| 437 | Ga0395900_0035046 | |||
| 438 | Ga0395900_0163709 | |||
| 439 | Ga0395900_0184694 | |||
| 440 | Ga0395898_0018150 | |||
| 441 | Ga0395898_0496442 | |||
| 442 | Ga0395905_0195628 | |||
| 443 | Ga0395905_0532840 | |||
| 444 | Ga0436364_0461411 | |||
| 445 | Ga0436364_1246530 | |||
| 446 | Ga0395901_0025185 | |||
| 447 | Ga0395901_0733018 | |||
| 448 | Ga0436365_0640791 | |||
| 449 | Ga0436365_0998372 | |||
| 450 | Ga0436361_0447772 | |||
| 451 | Ga0436361_0808480 | |||
| 452 | Ga0436363_1355867 | |||
| 453 | Ga0436363_1605317 | |||
| 454 | Ga0439461_0017341 | |||
| 455 | Ga0439446_0010344 | |||
| 456 | Ga0466969_0003007 | |||
| 457 | Ga0466969_0019889 | |||
| 458 | Ga0466966_0000375 | |||
| 459 | Ga0466966_0000979 | |||
| 460 | Ga0466961_0001014 | |||
| 461 | Ga0466961_0010192 | |||
| 462 | Ga0466963_0104889 | |||
| 463 | Ga0466971_0000522 | |||
| 464 | Ga0466971_0003502 | |||
| 465 | Ga0466970_0001081 | |||
| 466 | Ga0466959_0000108 | |||
| 467 | Ga0466959_0058821 | |||
| 468 | Ga0466959_0111449 | |||
| 469 | Ga0466958_0045015 | |||
| 470 | Ga0495590_0001689 | |||
| 471 | Ga0495638_0000692 | |||
| 472 | Ga0495638_0001024 | |||
| 473 | Ga0495638_0002437 | |||
| 474 | Ga0495638_0003978 | |||
| 475 | Ga0495638_0004691 | |||
| 476 | Ga0495650_0000024 | |||
| 477 | Ga0495583_0000013 | |||
| 478 | Ga0495606_0038241 | |||
| 479 | Ga0495610_0000078 | |||
| 480 | Ga0495610_0002837 | |||
| 481 | Ga0495610_0009513 | |||
| 482 | Ga0495616_0000222 | |||
| 483 | Ga0495631_0029679 | |||
| 484 | Ga0495632_0003808 | |||
| 485 | Ga0495632_0052162 | |||
| 486 | Ga0495632_0187898 | |||
| 487 | Ga0495637_0009782 | |||
| 488 | Ga0495643_0058200 | |||
| 489 | Ga0495643_0101504 | |||
| 490 | Ga0495648_0000072 | |||
| 491 | Ga0495648_0139916 | |||
| 492 | Ga0495654_0000026 | |||
| 493 | Ga0495654_0046369 | |||
| 494 | Ga0495609_0036065 | |||
| 495 | Ga0495668_0000105 | |||
| 496 | Ga0495668_0062538 | |||
| 497 | Ga0495668_0067039 | |||
| 498 | Ga0495625_0000683 | |||
| 499 | Ga0495625_0001108 | |||
| 500 | Ga0495625_0011966 | |||
| 501 | Ga0495625_0013372 | |||
| 502 | Ga0495625_0026553 | |||
| 503 | Ga0495625_0046253 | |||
| 504 | Ga0495669_0000004 | |||
| 505 | Ga0495613_0003028 | |||
| 506 | Ga0495671_0046906 | |||
| 507 | Ga0495649_0000586 | |||
| 508 | Ga0495672_0001047 | |||
| 509 | Ga0495672_0023281 | |||
| 510 | Ga0495673_0000483 | |||
| 511 | Ga0495673_0001103 | |||
| 512 | Ga0495681_0070741 | |||
| 513 | Ga0495686_0003048 | |||
| 514 | Ga0495686_0004978 | |||
| 515 | Ga0495686_0011274 | |||
| 516 | Ga0495686_0040509 | |||
| 517 | Ga0495686_0051792 | |||
| 518 | Ga0495686_0078362 | |||
| 519 | Ga0495615_0063385 | |||
| 520 | Ga0496107_0057081 | |||
| 521 | Ga0496115_0002236 | |||
| 522 | Ga0496115_0069032 | |||
| 523 | Ga0496125_0002295 | |||
| 524 | Ga0496125_0030292 | |||
| 525 | Ga0496126_0003606 | |||
| 526 | Ga0501047_0000537 | |||
| 527 | Ga0501073_0297685 | |||
| 528 | Ga0501257_006630 | |||
| 529 | nmdc:mga00v17_2891_c1 | |||
| 530 | nmdc:mga0k408_13943_c1 | |||
| 531 | nmdc:mga06z11_17453_c1 | |||
| 532 | nmdc:mga07m45_105981_c1 | |||
| 533 | nmdc:mga07m45_2430_c1 | |||
| 534 | nmdc:mga0sz30_2588_c1 | |||
| 535 | Ga0500578_0003935 | |||
| 536 | Ga0500644_0000238 | |||
| 537 | Ga0500644_0042807 | |||
| 538 | Ga0500647_0007375 | |||
| 539 | Ga0500556_0001174 | |||
| 540 | Ga0500562_000847 | |||
| 541 | Ga0500562_002216 | |||
| 542 | Ga0500572_000545 | |||
| 543 | Ga0500594_0007890 | |||
| 544 | Ga0500595_003265 | |||
| 545 | Ga0500608_000046 | |||
| 546 | Ga0500618_000058 | |||
| 547 | Ga0500658_0003755 | |||
| 548 | Ga0500559_0000006 | |||
| 549 | Ga0500559_0000190 | |||
| 550 | Ga0500559_0009960 | |||
| 551 | Ga0500564_000496 | |||
| 552 | Ga0500622_0030924 | |||
| 553 | Ga0500627_0044504 | |||
| 554 | Ga0500639_128915 | |||
| 555 | Ga0500645_002606 | |||
| 556 | Ga0500645_003237 | |||
| 557 | Ga0500609_002067 | |||
| 558 | Ga0466962_0005658 | |||
| 559 | 2511121782 | |||
| 560 | 2585147765 | |||
| 561 | 2585152958 | |||
| 562 | 2585195083 | |||
| 563 | 2587917440 | |||
| 564 | 2643747123 | |||
| 565 | 2643783152 | |||
| 566 | 2643924429 | |||
| 567 | 2643930905 | |||
| 568 | 2644227037 | |||
| 569 | 2644233495 | |||
| 570 | 2644507679 | |||
| 571 | 2792461024 | |||
| 572 | 2819537458 | |||
| 573 | 2819646480 | |||
| 574 | 2843749307 | |||
| 575 | 2849562716 | |||
| 576 | 2849578005 | |||
| 577 | 2851154017 | |||
| 578 | 2857508404 | |||
| 579 | 2884961981 | |||
| 580 | 2898333170 | |||
| 581 | 2928533397 | |||
| 582 | 2941489292 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hul-assembly1.cif.gz_A | crystal structure of nadc deletion mutant in cubic space group | 0.9656 | 4 | 279 |
| 5huo-assembly1.cif.gz_E-3 | crystal structure of nadc deletion mutant in c2221 space group | 0.9586 | 4 | 279 |
| 1x1o-assembly1.cif.gz_A | crystal structure of project id tt0268 from thermus thermophilus hb8 | 0.958 | 11 | 280 |
| 5huo-assembly2.cif.gz_H-2 | crystal structure of nadc deletion mutant in c2221 space group | 0.9567 | 4 | 279 |
| 5hul-assembly1.cif.gz_B | crystal structure of nadc deletion mutant in cubic space group | 0.9566 | 4 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tqvB02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9717 | 123 | 268 | 3.20.20.70 |
| af_P30011_147_280_3.90.1170.20 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain | 0.9679 | 130 | 263 | 3.90.1170.20 |
| 3gnnA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9676 | 129 | 267 | 3.20.20.70 |
| 1qpnA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.965 | 117 | 269 | 3.20.20.70 |
| 3l0gD02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9637 | 117 | 269 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352CB40-F1-model_v4 | nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) | 0.9892 | 118 | 280 |
GO:0004514
GO:0005737 GO:0009435 GO:0034213 |
| AF-A0A261UL75-F1-model_v4 | nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) | 0.9858 | 2 | 279 |
GO:0004514
GO:0005737 GO:0009435 GO:0034213 |
| AF-A0A258C6Z3-F1-model_v4 | deleted | 0.9853 | 2 | 164 |
|
| AF-A0A257V293-F1-model_v4 | nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) | 0.9847 | 4 | 280 |
GO:0004514
GO:0005737 GO:0009435 GO:0034213 |
| AF-A0A1H8BNW2-F1-model_v4 | nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) | 0.9846 | 5 | 278 |
GO:0004514
GO:0005737 GO:0009435 GO:0034213 |