F390451

General Info

Members Datasets Scaffolds Average Seq Length
291 192 582 281

Family's Representative Sequence

Representative Sequence 3300035242|Ga0373962_0006829|Ga0373962_0006829_692_1585
Length 297
Sequence MPERRNAPFSPQRPFALAPLPDVILEPIVKLALAEDLGVAGDLTTDALIDPETRGRWALRARKPGVVAGLDAASLTAWFVDPDLLFDIKKQDGASIGSNETIIEIEGYARSMLTAERVMLNFIGRLSGVATLTRAYVDAVSGTSAIIASTRKTTPGLRALEKRAVKLGGGGSHRYGLDDAILIKDNHIAACGGVTAAMARARAAAGHLCMIEIEVDSLDQLEEALACKPNVILLDNFSLSSMRAAVKLTDGAVALEASGGVSLDSVRAIAETGVDIISIGALTHSATSLDIGLDALD

Samples

Sample ID Description Type Environment
1 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
151 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
152 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
155 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
161 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
162 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
163 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
164 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
165 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
170 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
171 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
172 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
173 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
174 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
175 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
176 2643221583 Caulobacter sp. Root655 Isolate Unclassified
177 2643221584 Caulobacter sp. Root656 Isolate Unclassified
178 2643221640 Caulobacter sp. Root342 Isolate Unclassified
179 2643221642 Caulobacter sp. Root343 Isolate Unclassified
180 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
181 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
182 2818991435 Caulobacter henricii 536 Isolate Unclassified
183 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
184 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
185 2849560528 Caulobacter zeae 410 Isolate Unclassified
186 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
187 2851153111 Caulobacter radicis 736 Isolate Unclassified
188 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
189 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
190 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
191 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
192 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.75
Metatranscriptomes 0
Isolates 8.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.93
Nodule 0
Rhizoplane 1.03
Rhizosphere 69.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373962_0006829 3300035242 Bacteria 2777
2 rootH1_10006765 3300003323 Bacteria 6413
3 Ga0055524_1033814 3300003775 Bacteria 1424
4 Ga0055536_1002260 3300003781 Bacteria 10953
5 Ga0055530_10000752 3300003791 Bacteria 26932
6 Ga0055530_10002411 3300003791 Bacteria 12100
7 Ga0055531_10000749 3300003794 Bacteria 27331
8 Ga0055531_10001683 3300003794 Bacteria 15905
9 Ga0065165_1002257 3300005262 Bacteria 17042
10 Ga0070658_10085082 3300005327 Bacteria 2600
11 Ga0070658_10089739 3300005327 Bacteria 2531
12 Ga0070670_100000237 3300005331 Bacteria 49913
13 Ga0070670_100064496 3300005331 Bacteria 3143
14 Ga0070666_10047327 3300005335 Bacteria 2887
15 Ga0070666_10057380 3300005335 Bacteria 2631
16 Ga0070680_100011408 3300005336 Bacteria 6872
17 Ga0070680_100041083 3300005336 Bacteria 3749
18 Ga0070689_100240398 3300005340 Bacteria 1491
19 Ga0070668_100000233 3300005347 Bacteria 36341
20 Ga0070669_100101333 3300005353 Bacteria 2173
21 Ga0070659_100021980 3300005366 Bacteria 4867
22 Ga0070667_100000272 3300005367 Bacteria 58738
23 Ga0070667_100000504 3300005367 Bacteria 39552
24 Ga0070667_100044523 3300005367 Bacteria 3728
25 Ga0070714_100288320 3300005435 Bacteria 1527
26 Ga0070681_10004265 3300005458 Bacteria 13563
27 Ga0070679_100015319 3300005530 Bacteria 7368
28 Ga0070679_100044956 3300005530 Bacteria 4400
29 Ga0068853_100011000 3300005539 Bacteria 7338
30 Ga0070665_100001466 3300005548 Bacteria 27627
31 Ga0070704_100521728 3300005549 Bacteria 1034
32 Ga0068855_100035094 3300005563 Bacteria 5975
33 Ga0068855_100036738 3300005563 Bacteria 5828
34 Ga0068855_100303012 3300005563 Bacteria 1769
35 Ga0068856_100522195 3300005614 Bacteria 1209
36 Ga0068852_100024576 3300005616 Bacteria 4871
37 Ga0068859_100000231 3300005617 Bacteria 55036
38 Ga0068859_100297174 3300005617 Bacteria 1708
39 Ga0068864_100000597 3300005618 Bacteria 30646
40 Ga0068863_100000135 3300005841 Bacteria 78221
41 Ga0068858_100009028 3300005842 Bacteria 9535
42 Ga0068858_100042287 3300005842 Bacteria 4225
43 Ga0068860_100000526 3300005843 Bacteria 46691
44 Ga0068860_100086004 3300005843 Bacteria 2992
45 Ga0068860_100098824 3300005843 Bacteria 2783
46 Ga0068862_100000459 3300005844 Bacteria 44048
47 Ga0068862_100061397 3300005844 Bacteria 3231
48 Ga0075364_10001541 3300006051 Bacteria 12575
49 Ga0075369_10025431 3300006186 Bacteria 2462
50 Ga0075366_10005456 3300006195 Bacteria 6892
51 Ga0075366_10060689 3300006195 Bacteria 2246
52 Ga0075370_10171457 3300006353 Bacteria 1275
53 Ga0097620_100000231 3300006931 Bacteria 55036
54 Ga0097620_100297147 3300006931 Bacteria 1708
55 Ga0105240_10019170 3300009093 Bacteria 9146
56 Ga0105240_10044932 3300009093 Bacteria 5607
57 Ga0105240_10223630 3300009093 Bacteria 2191
58 Ga0105247_10042369 3300009101 Bacteria 2788
59 Ga0105248_10004008 3300009177 Bacteria 16272
60 Ga0105248_10359888 3300009177 Bacteria 1638
61 Ga0105237_10315304 3300009545 Bacteria 1567
62 Ga0105249_10001217 3300009553 Bacteria 22698
63 Ga0157373_10000383 3300013100 Bacteria 35475
64 Ga0157373_10005130 3300013100 Bacteria 9846
65 Ga0157373_10263349 3300013100 Bacteria 1220
66 Ga0157369_10012684 3300013105 Bacteria 9558
67 Ga0163162_10067325 3300013306 Bacteria 3631
68 Ga0157375_10867810 3300013308 Bacteria 1048
69 Ga0163163_10011074 3300014325 Bacteria 8159
70 Ga0157377_10076719 3300014745 Bacteria 1944
71 Ga0157379_10004950 3300014968 Bacteria 11428
72 Ga0157379_10011931 3300014968 Bacteria 7592
73 Ga0213874_10004966 3300021377 Bacteria 3073
74 Ga0213876_10000183 3300021384 Bacteria 64845
75 Ga0213875_10048994 3300021388 Bacteria 1981
76 Ga0209148_1024746 3300025254 Bacteria 945
77 Ga0209673_1029990 3300025273 Bacteria 1722
78 Ga0209676_1000119 3300025292 Bacteria 201094
79 Ga0209676_1000282 3300025292 Bacteria 105777
80 Ga0209564_1002945 3300025295 Bacteria 12347
81 Ga0209564_1017516 3300025295 Bacteria 2787
82 Ga0209758_1000816 3300025297 Bacteria 43874
83 Ga0209758_1002757 3300025297 Bacteria 17216
84 Ga0209050_1000049 3300025298 Bacteria 364096
85 Ga0209050_1003143 3300025298 Bacteria 12601
86 Ga0209050_1003150 3300025298 Bacteria 12573
87 Ga0209256_1001622 3300025299 Bacteria 21931
88 Ga0209257_1000036 3300025304 Bacteria 616006
89 Ga0209257_1000327 3300025304 Bacteria 99581
90 Ga0209257_1000332 3300025304 Bacteria 98632
91 Ga0209257_1001207 3300025304 Bacteria 32467
92 Ga0209257_1003799 3300025304 Bacteria 12432
93 Ga0207680_10031747 3300025903 Bacteria 2995
94 Ga0207643_10052092 3300025908 Bacteria 2324
95 Ga0207707_10052161 3300025912 Bacteria 3562
96 Ga0207707_10162746 3300025912 Bacteria 1951
97 Ga0207695_10003553 3300025913 Bacteria 21835
98 Ga0207695_10012950 3300025913 Bacteria 9973
99 Ga0207660_10040920 3300025917 Bacteria 3246
100 Ga0207660_10122959 3300025917 Bacteria 1967
101 Ga0207652_10271303 3300025921 Bacteria 1530
102 Ga0207681_10101723 3300025923 Bacteria 2073
103 Ga0207650_10000136 3300025925 Bacteria 89925
104 Ga0207650_10046147 3300025925 Bacteria 3208
105 Ga0207644_10004972 3300025931 Bacteria 8669
106 Ga0207690_10002323 3300025932 Bacteria 11585
107 Ga0207686_10043861 3300025934 Bacteria 2743
108 Ga0207711_10057035 3300025941 Bacteria 3357
109 Ga0207711_10227023 3300025941 Bacteria 1709
110 Ga0207667_10018280 3300025949 Bacteria 7867
111 Ga0207667_10201901 3300025949 Bacteria 2039
112 Ga0207712_10000900 3300025961 Bacteria 21552
113 Ga0207668_10000360 3300025972 Bacteria 29295
114 Ga0207668_10003421 3300025972 Bacteria 9308
115 Ga0207668_10016115 3300025972 Bacteria 4658
116 Ga0207658_10000379 3300025986 Bacteria 43390
117 Ga0207658_10000605 3300025986 Bacteria 31883
118 Ga0207703_10002251 3300026035 Bacteria 16864
119 Ga0207703_10007795 3300026035 Bacteria 8476
120 Ga0207639_10015146 3300026041 Bacteria 5432
121 Ga0207702_10283511 3300026078 Bacteria 1567
122 Ga0207641_10000770 3300026088 Bacteria 34326
123 Ga0207641_10005746 3300026088 Bacteria 10539
124 Ga0207676_10000523 3300026095 Bacteria 32225
125 Ga0209981_1009897 3300027378 Bacteria 1306
126 Ga0209999_1004611 3300027543 Bacteria 2473
127 Ga0268266_10001720 3300028379 Bacteria 25070
128 Ga0268265_10003113 3300028380 Bacteria 12100
129 Ga0268265_10202758 3300028380 Bacteria 1722
130 Ga0268264_10000192 3300028381 Bacteria 126749
131 Ga0268264_10035390 3300028381 Bacteria 4111
132 Ga0268264_10254781 3300028381 Bacteria 1632
133 Ga0307515_10060782 3300028794 Bacteria 5379
134 Ga0307515_10086135 3300028794 Bacteria 4009
135 Ga0265338_10026003 3300028800 Bacteria 5918
136 Ga0265338_10118202 3300028800 Bacteria 2119
137 Ga0307511_10008050 3300030521 Bacteria 10566
138 Ga0265327_10000140 3300031251 Bacteria 158935
139 Ga0265327_10007619 3300031251 Bacteria 8300
140 Ga0265327_10114909 3300031251 Bacteria 1281
141 Ga0265314_10061617 3300031711 Bacteria 2553
142 Ga0373946_0013082 3300035171 Bacteria 3114
143 Ga0373931_0003958 3300035691 Bacteria 6707
144 Ga0373927_0000188 3300035695 Bacteria 49189
145 Ga0373925_0000247 3300037068 Bacteria 57283
146 Ga0395900_0035046 3300037418 Bacteria 5169
147 Ga0395900_0163709 3300037418 Bacteria 2268
148 Ga0395900_0184694 3300037418 Bacteria 2117
149 Ga0395898_0018150 3300037466 Bacteria 7181
150 Ga0395898_0496442 3300037466 Bacteria 1161
151 Ga0395905_0195628 3300037471 Bacteria 1896
152 Ga0395905_0532840 3300037471 Bacteria 1075
153 Ga0436364_0461411 3300037853 Bacteria 2484
154 Ga0436364_1246530 3300037853 Bacteria 1434
155 Ga0395901_0025185 3300038443 Bacteria 6108
156 Ga0395901_0733018 3300038443 Bacteria 983
157 Ga0436365_0640791 3300039437 Bacteria 50242
158 Ga0436365_0998372 3300039437 Bacteria 6712
159 Ga0436361_0447772 3300039447 Bacteria 7779
160 Ga0436361_0808480 3300039447 Bacteria 14827
161 Ga0436363_1355867 3300039450 Bacteria 2227
162 Ga0436363_1605317 3300039450 Bacteria 3555
163 Ga0439461_0017341 3300041410 Bacteria 1399
164 Ga0439446_0010344 3300042156 Bacteria 2511
165 Ga0466969_0003007 3300044656 Bacteria 8982
166 Ga0466969_0019889 3300044656 Bacteria 3481
167 Ga0466966_0000375 3300044684 Bacteria 29156
168 Ga0466966_0000979 3300044684 Bacteria 18323
169 Ga0466961_0001014 3300044693 Bacteria 17335
170 Ga0466961_0010192 3300044693 Bacteria 5987
171 Ga0466963_0104889 3300044694 Bacteria 1937
172 Ga0466971_0000522 3300044719 Bacteria 15195
173 Ga0466971_0003502 3300044719 Bacteria 6703
174 Ga0466970_0001081 3300044765 Bacteria 13196
175 Ga0466959_0000108 3300045049 Bacteria 53075
176 Ga0466959_0058821 3300045049 Bacteria 2799
177 Ga0466959_0111449 3300045049 Bacteria 1952
178 Ga0466958_0045015 3300045836 Bacteria 2661
179 Ga0495590_0001689 3300046457 Bacteria 9390
180 Ga0495638_0000692 3300046460 Bacteria 36575
181 Ga0495638_0001024 3300046460 Bacteria 27760
182 Ga0495638_0002437 3300046460 Bacteria 15194
183 Ga0495638_0003978 3300046460 Bacteria 11372
184 Ga0495638_0004691 3300046460 Bacteria 10330
185 Ga0495650_0000024 3300046471 Bacteria 496674
186 Ga0495583_0000013 3300046506 Bacteria 323372
187 Ga0495606_0038241 3300046507 Bacteria 3248
188 Ga0495610_0000078 3300046512 Bacteria 116266
189 Ga0495610_0002837 3300046512 Bacteria 14102
190 Ga0495610_0009513 3300046512 Bacteria 6133
191 Ga0495616_0000222 3300046513 Bacteria 46999
192 Ga0495631_0029679 3300046518 Bacteria 2485
193 Ga0495632_0003808 3300046519 Bacteria 10517
194 Ga0495632_0052162 3300046519 Bacteria 2011
195 Ga0495632_0187898 3300046519 Bacteria 944
196 Ga0495637_0009782 3300046520 Bacteria 4665
197 Ga0495643_0058200 3300046522 Bacteria 2057
198 Ga0495643_0101504 3300046522 Bacteria 1474
199 Ga0495648_0000072 3300046524 Bacteria 132630
200 Ga0495648_0139916 3300046524 Bacteria 1275
201 Ga0495654_0000026 3300046530 Bacteria 234940
202 Ga0495654_0046369 3300046530 Bacteria 2141
203 Ga0495609_0036065 3300046538 Bacteria 2235
204 Ga0495668_0000105 3300046616 Bacteria 133981
205 Ga0495668_0062538 3300046616 Bacteria 2051
206 Ga0495668_0067039 3300046616 Bacteria 1974
207 Ga0495625_0000683 3300046660 Bacteria 48312
208 Ga0495625_0001108 3300046660 Bacteria 34911
209 Ga0495625_0011966 3300046660 Bacteria 7043
210 Ga0495625_0013372 3300046660 Bacteria 6596
211 Ga0495625_0026553 3300046660 Bacteria 4374
212 Ga0495625_0046253 3300046660 Bacteria 3141
213 Ga0495669_0000004 3300046684 Bacteria 208878
214 Ga0495613_0003028 3300046689 Bacteria 12569
215 Ga0495671_0046906 3300046692 Bacteria 2160
216 Ga0495649_0000586 3300046694 Bacteria 30569
217 Ga0495672_0001047 3300047320 Bacteria 28265
218 Ga0495672_0023281 3300047320 Bacteria 4010
219 Ga0495673_0000483 3300047469 Bacteria 42457
220 Ga0495673_0001103 3300047469 Bacteria 23234
221 Ga0495681_0070741 3300047470 Bacteria 1581
222 Ga0495686_0003048 3300047472 Bacteria 14849
223 Ga0495686_0004978 3300047472 Bacteria 10684
224 Ga0495686_0011274 3300047472 Bacteria 6301
225 Ga0495686_0040509 3300047472 Bacteria 2970
226 Ga0495686_0051792 3300047472 Bacteria 2575
227 Ga0495686_0078362 3300047472 Bacteria 2022
228 Ga0495615_0063385 3300048090 Bacteria 981
229 Ga0496107_0057081 3300048910 Bacteria 2822
230 Ga0496115_0002236 3300048918 Bacteria 13875
231 Ga0496115_0069032 3300048918 Bacteria 2862
232 Ga0496125_0002295 3300048928 Bacteria 25284
233 Ga0496125_0030292 3300048928 Bacteria 4843
234 Ga0496126_0003606 3300048929 Bacteria 19378
235 Ga0501047_0000537 3300049581 Bacteria 41106
236 Ga0501073_0297685 3300049589 Bacteria 1113
237 Ga0501257_006630 3300049686 Bacteria 2570
238 nmdc:mga00v17_2891_c1 3300050491 Bacteria 8808
239 nmdc:mga0k408_13943_c1 3300050493 Bacteria 4417
240 nmdc:mga06z11_17453_c1 3300050494 Bacteria 3258
241 nmdc:mga07m45_105981_c1 3300050496 Bacteria 1617
242 nmdc:mga07m45_2430_c1 3300050496 Bacteria 8736
243 nmdc:mga0sz30_2588_c1 3300050516 Bacteria 6433
244 Ga0500578_0003935 3300053086 Bacteria 10784
245 Ga0500644_0000238 3300053088 Bacteria 31362
246 Ga0500644_0042807 3300053088 Bacteria 1512
247 Ga0500647_0007375 3300053091 Bacteria 4723
248 Ga0500556_0001174 3300053104 Bacteria 12502
249 Ga0500562_000847 3300053108 Bacteria 7406
250 Ga0500562_002216 3300053108 Bacteria 4861
251 Ga0500572_000545 3300053111 Bacteria 12794
252 Ga0500594_0007890 3300053118 Bacteria 2415
253 Ga0500595_003265 3300053119 Bacteria 7658
254 Ga0500608_000046 3300053122 Bacteria 55792
255 Ga0500618_000058 3300053125 Bacteria 97628
256 Ga0500658_0003755 3300053134 Bacteria 5721
257 Ga0500559_0000006 3300053136 Bacteria 229895
258 Ga0500559_0000190 3300053136 Bacteria 49263
259 Ga0500559_0009960 3300053136 Bacteria 4095
260 Ga0500564_000496 3300053138 Bacteria 11572
261 Ga0500622_0030924 3300053156 Bacteria 2809
262 Ga0500627_0044504 3300053158 Bacteria 1917
263 Ga0500639_128915 3300053163 Bacteria 1201
264 Ga0500645_002606 3300053730 Bacteria 7913
265 Ga0500645_003237 3300053730 Bacteria 6732
266 Ga0500609_002067 3300053731 Bacteria 2884
267 Ga0466962_0005658 3300061719 Bacteria 6005
268 2511121782 2510917020 Bacteria 5657507
269 2585147765 2582581279 Bacteria 4980720
270 2585152958 2582581280 Bacteria 5994497
271 2585195083 2582581293 Bacteria 5907401
272 2587917440 2585428106 Bacteria 5179711
273 2643747123 2643221545 Bacteria 5083237
274 2643783152 2643221552 Bacteria 5708754
275 2643924429 2643221583 Bacteria 5218014
276 2643930905 2643221584 Bacteria 5511711
277 2644227037 2643221640 Bacteria 5258820
278 2644233495 2643221642 Bacteria 5357871
279 2644507679 2643221691 Bacteria 5093099
280 2792461024 2791355048 Bacteria 5832535
281 2819537458 2818991435 Bacteria 5433759
282 2819646480 2818991454 Bacteria 5563326
283 2843749307 2843744320 Bacteria 5659202
284 2849562716 2849560528 Bacteria 5393480
285 2849578005 2849573788 Bacteria 5421256
286 2851154017 2851153111 Bacteria 5542585
287 2857508404 2857504554 Bacteria 5369913
288 2884961981 2884960567 Bacteria 5437054
289 2898333170 2898329390 Bacteria 5168154
290 2928533397 2928531327 Bacteria 5101314
291 2941489292 2941485952 Bacteria 3591484
292 Ga0373962_0006829
293 rootH1_10006765
294 Ga0055524_1033814
295 Ga0055536_1002260
296 Ga0055530_10000752
297 Ga0055530_10002411
298 Ga0055531_10000749
299 Ga0055531_10001683
300 Ga0065165_1002257
301 Ga0070658_10085082
302 Ga0070658_10089739
303 Ga0070670_100000237
304 Ga0070670_100064496
305 Ga0070666_10047327
306 Ga0070666_10057380
307 Ga0070680_100011408
308 Ga0070680_100041083
309 Ga0070689_100240398
310 Ga0070668_100000233
311 Ga0070669_100101333
312 Ga0070659_100021980
313 Ga0070667_100000272
314 Ga0070667_100000504
315 Ga0070667_100044523
316 Ga0070714_100288320
317 Ga0070681_10004265
318 Ga0070679_100015319
319 Ga0070679_100044956
320 Ga0068853_100011000
321 Ga0070665_100001466
322 Ga0070704_100521728
323 Ga0068855_100035094
324 Ga0068855_100036738
325 Ga0068855_100303012
326 Ga0068856_100522195
327 Ga0068852_100024576
328 Ga0068859_100000231
329 Ga0068859_100297174
330 Ga0068864_100000597
331 Ga0068863_100000135
332 Ga0068858_100009028
333 Ga0068858_100042287
334 Ga0068860_100000526
335 Ga0068860_100086004
336 Ga0068860_100098824
337 Ga0068862_100000459
338 Ga0068862_100061397
339 Ga0075364_10001541
340 Ga0075369_10025431
341 Ga0075366_10005456
342 Ga0075366_10060689
343 Ga0075370_10171457
344 Ga0097620_100000231
345 Ga0097620_100297147
346 Ga0105240_10019170
347 Ga0105240_10044932
348 Ga0105240_10223630
349 Ga0105247_10042369
350 Ga0105248_10004008
351 Ga0105248_10359888
352 Ga0105237_10315304
353 Ga0105249_10001217
354 Ga0157373_10000383
355 Ga0157373_10005130
356 Ga0157373_10263349
357 Ga0157369_10012684
358 Ga0163162_10067325
359 Ga0157375_10867810
360 Ga0163163_10011074
361 Ga0157377_10076719
362 Ga0157379_10004950
363 Ga0157379_10011931
364 Ga0213874_10004966
365 Ga0213876_10000183
366 Ga0213875_10048994
367 Ga0209148_1024746
368 Ga0209673_1029990
369 Ga0209676_1000119
370 Ga0209676_1000282
371 Ga0209564_1002945
372 Ga0209564_1017516
373 Ga0209758_1000816
374 Ga0209758_1002757
375 Ga0209050_1000049
376 Ga0209050_1003143
377 Ga0209050_1003150
378 Ga0209256_1001622
379 Ga0209257_1000036
380 Ga0209257_1000327
381 Ga0209257_1000332
382 Ga0209257_1001207
383 Ga0209257_1003799
384 Ga0207680_10031747
385 Ga0207643_10052092
386 Ga0207707_10052161
387 Ga0207707_10162746
388 Ga0207695_10003553
389 Ga0207695_10012950
390 Ga0207660_10040920
391 Ga0207660_10122959
392 Ga0207652_10271303
393 Ga0207681_10101723
394 Ga0207650_10000136
395 Ga0207650_10046147
396 Ga0207644_10004972
397 Ga0207690_10002323
398 Ga0207686_10043861
399 Ga0207711_10057035
400 Ga0207711_10227023
401 Ga0207667_10018280
402 Ga0207667_10201901
403 Ga0207712_10000900
404 Ga0207668_10000360
405 Ga0207668_10003421
406 Ga0207668_10016115
407 Ga0207658_10000379
408 Ga0207658_10000605
409 Ga0207703_10002251
410 Ga0207703_10007795
411 Ga0207639_10015146
412 Ga0207702_10283511
413 Ga0207641_10000770
414 Ga0207641_10005746
415 Ga0207676_10000523
416 Ga0209981_1009897
417 Ga0209999_1004611
418 Ga0268266_10001720
419 Ga0268265_10003113
420 Ga0268265_10202758
421 Ga0268264_10000192
422 Ga0268264_10035390
423 Ga0268264_10254781
424 Ga0307515_10060782
425 Ga0307515_10086135
426 Ga0265338_10026003
427 Ga0265338_10118202
428 Ga0307511_10008050
429 Ga0265327_10000140
430 Ga0265327_10007619
431 Ga0265327_10114909
432 Ga0265314_10061617
433 Ga0373946_0013082
434 Ga0373931_0003958
435 Ga0373927_0000188
436 Ga0373925_0000247
437 Ga0395900_0035046
438 Ga0395900_0163709
439 Ga0395900_0184694
440 Ga0395898_0018150
441 Ga0395898_0496442
442 Ga0395905_0195628
443 Ga0395905_0532840
444 Ga0436364_0461411
445 Ga0436364_1246530
446 Ga0395901_0025185
447 Ga0395901_0733018
448 Ga0436365_0640791
449 Ga0436365_0998372
450 Ga0436361_0447772
451 Ga0436361_0808480
452 Ga0436363_1355867
453 Ga0436363_1605317
454 Ga0439461_0017341
455 Ga0439446_0010344
456 Ga0466969_0003007
457 Ga0466969_0019889
458 Ga0466966_0000375
459 Ga0466966_0000979
460 Ga0466961_0001014
461 Ga0466961_0010192
462 Ga0466963_0104889
463 Ga0466971_0000522
464 Ga0466971_0003502
465 Ga0466970_0001081
466 Ga0466959_0000108
467 Ga0466959_0058821
468 Ga0466959_0111449
469 Ga0466958_0045015
470 Ga0495590_0001689
471 Ga0495638_0000692
472 Ga0495638_0001024
473 Ga0495638_0002437
474 Ga0495638_0003978
475 Ga0495638_0004691
476 Ga0495650_0000024
477 Ga0495583_0000013
478 Ga0495606_0038241
479 Ga0495610_0000078
480 Ga0495610_0002837
481 Ga0495610_0009513
482 Ga0495616_0000222
483 Ga0495631_0029679
484 Ga0495632_0003808
485 Ga0495632_0052162
486 Ga0495632_0187898
487 Ga0495637_0009782
488 Ga0495643_0058200
489 Ga0495643_0101504
490 Ga0495648_0000072
491 Ga0495648_0139916
492 Ga0495654_0000026
493 Ga0495654_0046369
494 Ga0495609_0036065
495 Ga0495668_0000105
496 Ga0495668_0062538
497 Ga0495668_0067039
498 Ga0495625_0000683
499 Ga0495625_0001108
500 Ga0495625_0011966
501 Ga0495625_0013372
502 Ga0495625_0026553
503 Ga0495625_0046253
504 Ga0495669_0000004
505 Ga0495613_0003028
506 Ga0495671_0046906
507 Ga0495649_0000586
508 Ga0495672_0001047
509 Ga0495672_0023281
510 Ga0495673_0000483
511 Ga0495673_0001103
512 Ga0495681_0070741
513 Ga0495686_0003048
514 Ga0495686_0004978
515 Ga0495686_0011274
516 Ga0495686_0040509
517 Ga0495686_0051792
518 Ga0495686_0078362
519 Ga0495615_0063385
520 Ga0496107_0057081
521 Ga0496115_0002236
522 Ga0496115_0069032
523 Ga0496125_0002295
524 Ga0496125_0030292
525 Ga0496126_0003606
526 Ga0501047_0000537
527 Ga0501073_0297685
528 Ga0501257_006630
529 nmdc:mga00v17_2891_c1
530 nmdc:mga0k408_13943_c1
531 nmdc:mga06z11_17453_c1
532 nmdc:mga07m45_105981_c1
533 nmdc:mga07m45_2430_c1
534 nmdc:mga0sz30_2588_c1
535 Ga0500578_0003935
536 Ga0500644_0000238
537 Ga0500644_0042807
538 Ga0500647_0007375
539 Ga0500556_0001174
540 Ga0500562_000847
541 Ga0500562_002216
542 Ga0500572_000545
543 Ga0500594_0007890
544 Ga0500595_003265
545 Ga0500608_000046
546 Ga0500618_000058
547 Ga0500658_0003755
548 Ga0500559_0000006
549 Ga0500559_0000190
550 Ga0500559_0009960
551 Ga0500564_000496
552 Ga0500622_0030924
553 Ga0500627_0044504
554 Ga0500639_128915
555 Ga0500645_002606
556 Ga0500645_003237
557 Ga0500609_002067
558 Ga0466962_0005658
559 2511121782
560 2585147765
561 2585152958
562 2585195083
563 2587917440
564 2643747123
565 2643783152
566 2643924429
567 2643930905
568 2644227037
569 2644233495
570 2644507679
571 2792461024
572 2819537458
573 2819646480
574 2843749307
575 2849562716
576 2849578005
577 2851154017
578 2857508404
579 2884961981
580 2898333170
581 2928533397
582 2941489292

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01729

QRPTase_C

Quinolinate phosphoribosyl transferase, C-terminal domain

129

294

0.98

PF02749

QRPTase_N

Quinolinate phosphoribosyl transferase, N-terminal domain

42

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hul-assembly1.cif.gz_A crystal structure of nadc deletion mutant in cubic space group 0.9656 4 279
5huo-assembly1.cif.gz_E-3 crystal structure of nadc deletion mutant in c2221 space group 0.9586 4 279
1x1o-assembly1.cif.gz_A crystal structure of project id tt0268 from thermus thermophilus hb8 0.958 11 280
5huo-assembly2.cif.gz_H-2 crystal structure of nadc deletion mutant in c2221 space group 0.9567 4 279
5hul-assembly1.cif.gz_B crystal structure of nadc deletion mutant in cubic space group 0.9566 4 279
ID Description Score Start End Superfamily
3tqvB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9717 123 268 3.20.20.70
af_P30011_147_280_3.90.1170.20 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain 0.9679 130 263 3.90.1170.20
3gnnA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9676 129 267 3.20.20.70
1qpnA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.965 117 269 3.20.20.70
3l0gD02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9637 117 269 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A352CB40-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9892 118 280 GO:0004514
GO:0005737
GO:0009435
GO:0034213
AF-A0A261UL75-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9858 2 279 GO:0004514
GO:0005737
GO:0009435
GO:0034213
AF-A0A258C6Z3-F1-model_v4 deleted 0.9853 2 164
AF-A0A257V293-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9847 4 280 GO:0004514
GO:0005737
GO:0009435
GO:0034213
AF-A0A1H8BNW2-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9846 5 278 GO:0004514
GO:0005737
GO:0009435
GO:0034213

Map