F390707

General Info

Members Datasets Scaffolds Average Seq Length
292 151 584 349

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10084168|Ga0065712_100841682
Length 399
Sequence LVYSLQLPAWFAASYLRGQSCDLVVYATLFIKIRQSSYSNQAYRTSFIFAPAMYNAIRRILFLFPPESIHYFLMNSLKALCSIGLIRKLIAWYFSPNDNRLNTTELHLKFQNPVGLGAGFDKNAKWLRELDTLGFGFVEIGTVTPLPQKGNEKPRLFRLPKDSALINRMGFNNDGVQAVAERLKKWRSGSQSTSSNLIVGGNIGKNKVTSNEDAWKDYESCFKELHPYVDYFVVNVSSPNTPGLRELQEKESLRKILRHLQMINNGKARSKPILLKISPDLMQDQIDDILELALEIKLDGLVCTNTTVSRAGLLTRKDEIEKIGQGGLSGKPIRERSTLIIEYIHKKTEGEIPIIASGGIFTGAHAKEKLNVGADLVQVWTGFIYEGPAIVKKICNSLK

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 2818991444 Filimonas endophytica 3197 Isolate Unclassified
151 2914759650 Rhizosphaericola mali Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 0.68
Rhizosphere 95.55
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10084168 3300005290 Bacteria 2785
2 rootL2_10207189 3300003322 Bacteria 2384
3 rootL2_10323352 3300003322 Unclassified 1407
4 JGI25160J50197_1002259 3300003354 Bacteria 9039
5 Ga0065712_10009488 3300005290 Bacteria 5714
6 Ga0065712_10013640 3300005290 Bacteria 2179
7 Ga0070658_10004224 3300005327 Bacteria 11752
8 Ga0070658_10103962 3300005327 Bacteria 2349
9 Ga0070658_10128969 3300005327 Bacteria 2106
10 Ga0070690_100077291 3300005330 Bacteria 2173
11 Ga0070670_100069658 3300005331 Bacteria 3019
12 Ga0070670_100154309 3300005331 Unclassified 1988
13 Ga0068869_100006366 3300005334 Bacteria 7482
14 Ga0068869_100070696 3300005334 Unclassified 2583
15 Ga0068869_100210033 3300005334 Bacteria 1538
16 Ga0068869_100211401 3300005334 Bacteria 1534
17 Ga0068869_100234447 3300005334 Bacteria 1460
18 Ga0070666_10000031 3300005335 Bacteria 132089
19 Ga0070666_10041522 3300005335 Bacteria 3074
20 Ga0070682_100076138 3300005337 Bacteria 2159
21 Ga0068868_100354232 3300005338 Unclassified 1258
22 Ga0070689_100007593 3300005340 Bacteria 7597
23 Ga0070689_100074788 3300005340 Bacteria 2651
24 Ga0070689_100166052 3300005340 Bacteria 1787
25 Ga0070687_100029695 3300005343 Bacteria 2665
26 Ga0070668_100031706 3300005347 Bacteria 4021
27 Ga0070669_100000278 3300005353 Bacteria 40980
28 Ga0070669_100062427 3300005353 Bacteria 2739
29 Ga0070669_100068981 3300005353 Bacteria 2611
30 Ga0070675_100020880 3300005354 Bacteria 5228
31 Ga0070675_100030862 3300005354 Unclassified 4329
32 Ga0070675_100263534 3300005354 Bacteria 1511
33 Ga0070671_100041634 3300005355 Bacteria 3818
34 Ga0070671_100084858 3300005355 Bacteria 2649
35 Ga0070671_100128877 3300005355 Bacteria 2130
36 Ga0070674_100034216 3300005356 Unclassified 3391
37 Ga0070674_100058871 3300005356 Bacteria 2672
38 Ga0070674_100193453 3300005356 Bacteria 1566
39 Ga0070674_100230102 3300005356 Bacteria 1446
40 Ga0070673_100022753 3300005364 Bacteria 4567
41 Ga0070673_100080691 3300005364 Bacteria 2637
42 Ga0070688_100001544 3300005365 Bacteria 11513
43 Ga0070688_100009106 3300005365 Bacteria 5415
44 Ga0070688_100010539 3300005365 Bacteria 5102
45 Ga0070688_100069208 3300005365 Bacteria 2253
46 Ga0070667_100071590 3300005367 Bacteria 2953
47 Ga0070667_100135561 3300005367 Bacteria 2152
48 Ga0070701_10009719 3300005438 Bacteria 4221
49 Ga0070701_10056191 3300005438 Bacteria 2058
50 Ga0070701_10096669 3300005438 Bacteria 1628
51 Ga0070694_100190622 3300005444 Unclassified 1522
52 Ga0070663_100122854 3300005455 Bacteria 1963
53 Ga0070678_100021265 3300005456 Bacteria 4275
54 Ga0070678_100103905 3300005456 Bacteria 2208
55 Ga0068867_100082780 3300005459 Bacteria 2422
56 Ga0070685_10164890 3300005466 Bacteria 1415
57 Ga0070698_100003794 3300005471 Bacteria 16603
58 Ga0070698_100009599 3300005471 Bacteria 10353
59 Ga0070679_100251778 3300005530 Bacteria 1722
60 Ga0070684_100022349 3300005535 Bacteria 5275
61 Ga0070672_100010286 3300005543 Bacteria 6483
62 Ga0070672_100073084 3300005543 Bacteria 2732
63 Ga0070672_100395859 3300005543 Bacteria 1183
64 Ga0070686_100006502 3300005544 Bacteria 6500
65 Ga0070693_100096276 3300005547 Bacteria 1794
66 Ga0068855_100385088 3300005563 Unclassified 1539
67 Ga0070664_100264096 3300005564 Unclassified 1549
68 Ga0068857_100032716 3300005577 Bacteria 4596
69 Ga0068857_100179144 3300005577 Bacteria 1929
70 Ga0068856_100150396 3300005614 Bacteria 2337
71 Ga0070702_100006614 3300005615 Bacteria 5501
72 Ga0068859_100000045 3300005617 Bacteria 143607
73 Ga0068859_100068123 3300005617 Bacteria 3594
74 Ga0068859_100438850 3300005617 Bacteria 1402
75 Ga0068859_100577867 3300005617 Bacteria 1217
76 Ga0068864_100001153 3300005618 Bacteria 21991
77 Ga0068864_100021416 3300005618 Bacteria 5417
78 Ga0068864_100048426 3300005618 Bacteria 3654
79 Ga0068864_100141213 3300005618 Bacteria 2173
80 Ga0068861_100001238 3300005719 Bacteria 15917
81 Ga0068861_100037888 3300005719 Unclassified 3586
82 Ga0068863_100002071 3300005841 Bacteria 19895
83 Ga0068863_100013093 3300005841 Bacteria 8002
84 Ga0068863_100046686 3300005841 Bacteria 4111
85 Ga0068863_100140396 3300005841 Bacteria 2309
86 Ga0068858_100002469 3300005842 Bacteria 18659
87 Ga0068858_100154280 3300005842 Bacteria 2160
88 Ga0068860_100004776 3300005843 Bacteria 13806
89 Ga0068860_100034632 3300005843 Bacteria 4845
90 Ga0068860_100057657 3300005843 Bacteria 3692
91 Ga0068860_100177243 3300005843 Unclassified 2060
92 Ga0068860_100246354 3300005843 Unclassified 1739
93 Ga0068862_100001103 3300005844 Bacteria 25640
94 Ga0068862_100005077 3300005844 Bacteria 11082
95 Ga0068862_100431878 3300005844 Bacteria 1238
96 Ga0081539_10000603 3300005985 Bacteria 73114
97 Ga0097621_100000427 3300006237 Bacteria 29385
98 Ga0097621_100277314 3300006237 Bacteria 1475
99 Ga0068871_100021716 3300006358 Bacteria 4939
100 Ga0068871_100094457 3300006358 Bacteria 2496
101 Ga0075428_100006377 3300006844 Bacteria 13128
102 Ga0097620_100000045 3300006931 Bacteria 143607
103 Ga0097620_100068123 3300006931 Bacteria 3594
104 Ga0097620_100438848 3300006931 Bacteria 1402
105 Ga0097620_100577837 3300006931 Bacteria 1217
106 Ga0105240_10041526 3300009093 Bacteria 5870
107 Ga0111539_10010247 3300009094 Bacteria 11811
108 Ga0111539_10386031 3300009094 Bacteria 1631
109 Ga0105247_10009880 3300009101 Bacteria 5780
110 Ga0105243_10130709 3300009148 Bacteria 2129
111 Ga0105241_10003471 3300009174 Bacteria 11732
112 Ga0105242_10008177 3300009176 Bacteria 8036
113 Ga0105242_10062448 3300009176 Bacteria 3065
114 Ga0105242_10420056 3300009176 Bacteria 1253
115 Ga0105237_10002015 3300009545 Bacteria 25851
116 Ga0105237_10019825 3300009545 Bacteria 6943
117 Ga0105249_10001437 3300009553 Bacteria 20858
118 Ga0105249_10002907 3300009553 Bacteria 14779
119 Ga0105249_10008926 3300009553 Bacteria 8757
120 Ga0105249_10243414 3300009553 Bacteria 1779
121 Ga0105246_10012782 3300011119 Bacteria 5248
122 Ga0157373_10023446 3300013100 Bacteria 4474
123 Ga0157373_10152431 3300013100 Bacteria 1626
124 Ga0157371_10002769 3300013102 Bacteria 16467
125 Ga0157371_10002845 3300013102 Bacteria 16172
126 Ga0157371_10003497 3300013102 Bacteria 14205
127 Ga0157371_10007582 3300013102 Bacteria 8757
128 Ga0157371_10019924 3300013102 Bacteria 4942
129 Ga0157370_10152402 3300013104 Bacteria 2151
130 Ga0157369_10169118 3300013105 Bacteria 2304
131 Ga0157374_10023123 3300013296 Bacteria 5554
132 Ga0157374_10256518 3300013296 Bacteria 1721
133 Ga0157378_10013101 3300013297 Bacteria 7254
134 Ga0157378_10015472 3300013297 Bacteria 6683
135 Ga0157378_10023395 3300013297 Bacteria 5438
136 Ga0163162_10001051 3300013306 Bacteria 25638
137 Ga0163162_10005140 3300013306 Bacteria 12610
138 Ga0163162_10007331 3300013306 Bacteria 10716
139 Ga0163162_10009023 3300013306 Bacteria 9693
140 Ga0163162_10030461 3300013306 Bacteria 5346
141 Ga0163162_10049730 3300013306 Bacteria 4202
142 Ga0163162_10136423 3300013306 Unclassified 2564
143 Ga0163162_10233485 3300013306 Unclassified 1970
144 Ga0163162_10454899 3300013306 Bacteria 1412
145 Ga0157372_10142607 3300013307 Bacteria 2762
146 Ga0157372_10165695 3300013307 Bacteria 2555
147 Ga0157372_10329681 3300013307 Bacteria 1777
148 Ga0157375_10000186 3300013308 Bacteria 58217
149 Ga0157375_10012039 3300013308 Bacteria 7660
150 Ga0163163_10005424 3300014325 Bacteria 11026
151 Ga0163163_10010386 3300014325 Bacteria 8368
152 Ga0157380_10001581 3300014326 Bacteria 14991
153 Ga0157380_10073239 3300014326 Bacteria 2776
154 Ga0157380_10167778 3300014326 Bacteria 1915
155 Ga0157380_10241362 3300014326 Bacteria 1629
156 Ga0157377_10004609 3300014745 Bacteria 6372
157 Ga0157377_10004780 3300014745 Bacteria 6278
158 Ga0157376_10000101 3300014969 Bacteria 62612
159 Ga0157376_10145571 3300014969 Bacteria 2131
160 Ga0163161_10015238 3300017792 Bacteria 5356
161 Ga0163161_10262427 3300017792 Bacteria 1349
162 Ga0207426_1000023 3300025302 Bacteria 545465
163 Ga0207710_10025651 3300025900 Bacteria 2544
164 Ga0207688_10001577 3300025901 Bacteria 12027
165 Ga0207680_10000627 3300025903 Bacteria 16642
166 Ga0207645_10034704 3300025907 Bacteria 3241
167 Ga0207643_10005651 3300025908 Bacteria 6687
168 Ga0207643_10229095 3300025908 Bacteria 1139
169 Ga0207705_10027556 3300025909 Bacteria 4052
170 Ga0207705_10139299 3300025909 Unclassified 1811
171 Ga0207654_10014865 3300025911 Bacteria 4030
172 Ga0207671_10001627 3300025914 Bacteria 25569
173 Ga0207660_10257288 3300025917 Bacteria 1379
174 Ga0207681_10074594 3300025923 Bacteria 2377
175 Ga0207659_10115581 3300025926 Unclassified 2047
176 Ga0207644_10051816 3300025931 Bacteria 2947
177 Ga0207644_10073121 3300025931 Bacteria 2513
178 Ga0207644_10092484 3300025931 Bacteria 2256
179 Ga0207706_10032868 3300025933 Bacteria 4616
180 Ga0207686_10003456 3300025934 Bacteria 8481
181 Ga0207686_10034775 3300025934 Bacteria 3018
182 Ga0207670_10137610 3300025936 Bacteria 1797
183 Ga0207669_10007677 3300025937 Bacteria 5011
184 Ga0207669_10103681 3300025937 Bacteria 1887
185 Ga0207704_10205542 3300025938 Bacteria 1445
186 Ga0207691_10023587 3300025940 Bacteria 5793
187 Ga0207689_10012717 3300025942 Bacteria 7190
188 Ga0207689_10075725 3300025942 Bacteria 2766
189 Ga0207689_10098000 3300025942 Bacteria 2408
190 Ga0207689_10106344 3300025942 Bacteria 2305
191 Ga0207689_10134084 3300025942 Unclassified 2039
192 Ga0207689_10268468 3300025942 Bacteria 1412
193 Ga0207661_10136474 3300025944 Bacteria 2107
194 Ga0207679_10074721 3300025945 Bacteria 2569
195 Ga0207679_10126035 3300025945 Bacteria 2046
196 Ga0207651_10074314 3300025960 Unclassified 2420
197 Ga0207651_10097800 3300025960 Bacteria 2168
198 Ga0207712_10001513 3300025961 Bacteria 15777
199 Ga0207712_10066842 3300025961 Bacteria 2571
200 Ga0207712_10149184 3300025961 Unclassified 1804
201 Ga0207712_10160416 3300025961 Bacteria 1747
202 Ga0207712_10388999 3300025961 Bacteria 1169
203 Ga0207658_10048653 3300025986 Bacteria 3110
204 Ga0207658_10084997 3300025986 Bacteria 2436
205 Ga0207677_10052739 3300026023 Bacteria 2765
206 Ga0207703_10003137 3300026035 Bacteria 13955
207 Ga0207703_10031832 3300026035 Bacteria 4173
208 Ga0207702_10044225 3300026078 Bacteria 3743
209 Ga0207641_10000146 3300026088 Bacteria 100666
210 Ga0207641_10002920 3300026088 Bacteria 15480
211 Ga0207641_10021557 3300026088 Bacteria 5295
212 Ga0207641_10035848 3300026088 Bacteria 4137
213 Ga0207641_10126825 3300026088 Bacteria 2286
214 Ga0207648_10004806 3300026089 Bacteria 13786
215 Ga0207648_10022529 3300026089 Bacteria 5653
216 Ga0207648_10061650 3300026089 Bacteria 3270
217 Ga0207648_10061825 3300026089 Bacteria 3265
218 Ga0207676_10007680 3300026095 Bacteria 7660
219 Ga0207676_10136738 3300026095 Bacteria 2092
220 Ga0207674_10026711 3300026116 Bacteria 6125
221 Ga0207675_100000224 3300026118 Bacteria 53231
222 Ga0207675_100044562 3300026118 Bacteria 4146
223 Ga0207675_100323730 3300026118 Bacteria 1505
224 Ga0207683_10083653 3300026121 Bacteria 2836
225 Ga0207683_10172390 3300026121 Bacteria 1960
226 Ga0207428_10140170 3300027907 Bacteria 1846
227 Ga0268265_10081655 3300028380 Bacteria 2553
228 Ga0268264_10003376 3300028381 Bacteria 13787
229 Ga0268264_10025339 3300028381 Bacteria 4846
230 Ga0268264_10035319 3300028381 Bacteria 4115
231 Ga0268264_10042403 3300028381 Bacteria 3767
232 Ga0268264_10314232 3300028381 Bacteria 1479
233 Ga0307517_10003459 3300028786 Bacteria 24556
234 Ga0307515_10000001 3300028794 Bacteria 4259510
235 Ga0307508_10016381 3300031616 Bacteria 6748
236 Ga0395899_0092819 3300037312 Bacteria 2185
237 Ga0395899_0120615 3300037312 Bacteria 1878
238 Ga0395900_0023783 3300037418 Bacteria 6269
239 Ga0395898_0074297 3300037466 Bacteria 3283
240 Ga0395905_0014814 3300037471 Bacteria 7434
241 Ga0395905_0122157 3300037471 Bacteria 2448
242 Ga0395905_0199702 3300037471 Bacteria 1875
243 Ga0395901_0025750 3300038443 Bacteria 6039
244 Ga0395901_0027407 3300038443 Bacteria 5854
245 Ga0439465_0040601 3300041413 Bacteria 1504
246 Ga0439441_003931 3300042001 Bacteria 2221
247 Ga0439449_0013272 3300042007 Bacteria 3100
248 Ga0450898_002965 3300042134 Bacteria 2399
249 Ga0451577_0007735 3300042876 Bacteria 10535
250 Ga0451577_0104980 3300042876 Bacteria 2525
251 Ga0451577_0160430 3300042876 Unclassified 2025
252 Ga0466972_0000021 3300044658 Bacteria 196266
253 Ga0466970_0001306 3300044765 Bacteria 12070
254 Ga0451576_0000673 3300045051 Bacteria 69699
255 Ga0495580_0061210 3300046472 Bacteria 2644
256 Ga0495668_0000242 3300046616 Bacteria 78022
257 Ga0495686_0010137 3300047472 Bacteria 6724
258 Ga0496104_0101266 3300048907 Bacteria 2758
259 Ga0496110_0380508 3300048913 Bacteria 1286
260 Ga0501031_0005917 3300049568 Bacteria 7974
261 Ga0501032_0187054 3300049569 Bacteria 1354
262 Ga0501033_0052610 3300049570 Bacteria 3018
263 Ga0501034_0000002 3300049571 Bacteria 565510
264 Ga0501034_0029668 3300049571 Bacteria 5561
265 Ga0501034_0046422 3300049571 Bacteria 4390
266 Ga0501034_0049307 3300049571 Unclassified 4249
267 Ga0501034_0055687 3300049571 Bacteria 3979
268 Ga0501034_0199069 3300049571 Bacteria 1962
269 Ga0501036_0055758 3300049572 Bacteria 3348
270 Ga0501037_0014409 3300049573 Bacteria 5820
271 Ga0501037_0124803 3300049573 Bacteria 1849
272 Ga0501038_0006563 3300049574 Bacteria 10762
273 Ga0501038_0315362 3300049574 Bacteria 1224
274 Ga0501047_0017081 3300049581 Bacteria 6940
275 Ga0501047_0110478 3300049581 Bacteria 2632
276 Ga0501259_004214 3300049688 Bacteria 2288
277 Ga0501080_0191905 3300049742 Bacteria 1877
278 Ga0501083_0039404 3300049744 Bacteria 3210
279 Ga0501035_0091761 3300049822 Bacteria 2673
280 Ga0501035_0242293 3300049822 Bacteria 1533
281 Ga0501044_0036967 3300049823 Bacteria 5105
282 Ga0501044_0080670 3300049823 Unclassified 3295
283 nmdc:mga05p37_88318_c1 3300050507 Bacteria 3821
284 nmdc:mga06r32_184296_c1 3300050510 Bacteria 2074
285 nmdc:mga08y16_110142_c1 3300050511 Bacteria 2867
286 nmdc:mga08y16_68912_c1 3300050511 Bacteria 3688
287 nmdc:mga08y16_95417_c1 3300050511 Bacteria 3098
288 Ga0500568_0001221 3300053139 Bacteria 17154
289 Ga0500588_0001821 3300053146 Bacteria 4161
290 Ga0500616_0043554 3300053153 Bacteria 2398
291 2819585483 2818991444 Bacteria 6968812
292 2914760575 2914759650 Bacteria 4701441
293 Ga0065712_10084168
294 rootL2_10207189
295 rootL2_10323352
296 JGI25160J50197_1002259
297 Ga0065712_10009488
298 Ga0065712_10013640
299 Ga0070658_10004224
300 Ga0070658_10103962
301 Ga0070658_10128969
302 Ga0070690_100077291
303 Ga0070670_100069658
304 Ga0070670_100154309
305 Ga0068869_100006366
306 Ga0068869_100070696
307 Ga0068869_100210033
308 Ga0068869_100211401
309 Ga0068869_100234447
310 Ga0070666_10000031
311 Ga0070666_10041522
312 Ga0070682_100076138
313 Ga0068868_100354232
314 Ga0070689_100007593
315 Ga0070689_100074788
316 Ga0070689_100166052
317 Ga0070687_100029695
318 Ga0070668_100031706
319 Ga0070669_100000278
320 Ga0070669_100062427
321 Ga0070669_100068981
322 Ga0070675_100020880
323 Ga0070675_100030862
324 Ga0070675_100263534
325 Ga0070671_100041634
326 Ga0070671_100084858
327 Ga0070671_100128877
328 Ga0070674_100034216
329 Ga0070674_100058871
330 Ga0070674_100193453
331 Ga0070674_100230102
332 Ga0070673_100022753
333 Ga0070673_100080691
334 Ga0070688_100001544
335 Ga0070688_100009106
336 Ga0070688_100010539
337 Ga0070688_100069208
338 Ga0070667_100071590
339 Ga0070667_100135561
340 Ga0070701_10009719
341 Ga0070701_10056191
342 Ga0070701_10096669
343 Ga0070694_100190622
344 Ga0070663_100122854
345 Ga0070678_100021265
346 Ga0070678_100103905
347 Ga0068867_100082780
348 Ga0070685_10164890
349 Ga0070698_100003794
350 Ga0070698_100009599
351 Ga0070679_100251778
352 Ga0070684_100022349
353 Ga0070672_100010286
354 Ga0070672_100073084
355 Ga0070672_100395859
356 Ga0070686_100006502
357 Ga0070693_100096276
358 Ga0068855_100385088
359 Ga0070664_100264096
360 Ga0068857_100032716
361 Ga0068857_100179144
362 Ga0068856_100150396
363 Ga0070702_100006614
364 Ga0068859_100000045
365 Ga0068859_100068123
366 Ga0068859_100438850
367 Ga0068859_100577867
368 Ga0068864_100001153
369 Ga0068864_100021416
370 Ga0068864_100048426
371 Ga0068864_100141213
372 Ga0068861_100001238
373 Ga0068861_100037888
374 Ga0068863_100002071
375 Ga0068863_100013093
376 Ga0068863_100046686
377 Ga0068863_100140396
378 Ga0068858_100002469
379 Ga0068858_100154280
380 Ga0068860_100004776
381 Ga0068860_100034632
382 Ga0068860_100057657
383 Ga0068860_100177243
384 Ga0068860_100246354
385 Ga0068862_100001103
386 Ga0068862_100005077
387 Ga0068862_100431878
388 Ga0081539_10000603
389 Ga0097621_100000427
390 Ga0097621_100277314
391 Ga0068871_100021716
392 Ga0068871_100094457
393 Ga0075428_100006377
394 Ga0097620_100000045
395 Ga0097620_100068123
396 Ga0097620_100438848
397 Ga0097620_100577837
398 Ga0105240_10041526
399 Ga0111539_10010247
400 Ga0111539_10386031
401 Ga0105247_10009880
402 Ga0105243_10130709
403 Ga0105241_10003471
404 Ga0105242_10008177
405 Ga0105242_10062448
406 Ga0105242_10420056
407 Ga0105237_10002015
408 Ga0105237_10019825
409 Ga0105249_10001437
410 Ga0105249_10002907
411 Ga0105249_10008926
412 Ga0105249_10243414
413 Ga0105246_10012782
414 Ga0157373_10023446
415 Ga0157373_10152431
416 Ga0157371_10002769
417 Ga0157371_10002845
418 Ga0157371_10003497
419 Ga0157371_10007582
420 Ga0157371_10019924
421 Ga0157370_10152402
422 Ga0157369_10169118
423 Ga0157374_10023123
424 Ga0157374_10256518
425 Ga0157378_10013101
426 Ga0157378_10015472
427 Ga0157378_10023395
428 Ga0163162_10001051
429 Ga0163162_10005140
430 Ga0163162_10007331
431 Ga0163162_10009023
432 Ga0163162_10030461
433 Ga0163162_10049730
434 Ga0163162_10136423
435 Ga0163162_10233485
436 Ga0163162_10454899
437 Ga0157372_10142607
438 Ga0157372_10165695
439 Ga0157372_10329681
440 Ga0157375_10000186
441 Ga0157375_10012039
442 Ga0163163_10005424
443 Ga0163163_10010386
444 Ga0157380_10001581
445 Ga0157380_10073239
446 Ga0157380_10167778
447 Ga0157380_10241362
448 Ga0157377_10004609
449 Ga0157377_10004780
450 Ga0157376_10000101
451 Ga0157376_10145571
452 Ga0163161_10015238
453 Ga0163161_10262427
454 Ga0207426_1000023
455 Ga0207710_10025651
456 Ga0207688_10001577
457 Ga0207680_10000627
458 Ga0207645_10034704
459 Ga0207643_10005651
460 Ga0207643_10229095
461 Ga0207705_10027556
462 Ga0207705_10139299
463 Ga0207654_10014865
464 Ga0207671_10001627
465 Ga0207660_10257288
466 Ga0207681_10074594
467 Ga0207659_10115581
468 Ga0207644_10051816
469 Ga0207644_10073121
470 Ga0207644_10092484
471 Ga0207706_10032868
472 Ga0207686_10003456
473 Ga0207686_10034775
474 Ga0207670_10137610
475 Ga0207669_10007677
476 Ga0207669_10103681
477 Ga0207704_10205542
478 Ga0207691_10023587
479 Ga0207689_10012717
480 Ga0207689_10075725
481 Ga0207689_10098000
482 Ga0207689_10106344
483 Ga0207689_10134084
484 Ga0207689_10268468
485 Ga0207661_10136474
486 Ga0207679_10074721
487 Ga0207679_10126035
488 Ga0207651_10074314
489 Ga0207651_10097800
490 Ga0207712_10001513
491 Ga0207712_10066842
492 Ga0207712_10149184
493 Ga0207712_10160416
494 Ga0207712_10388999
495 Ga0207658_10048653
496 Ga0207658_10084997
497 Ga0207677_10052739
498 Ga0207703_10003137
499 Ga0207703_10031832
500 Ga0207702_10044225
501 Ga0207641_10000146
502 Ga0207641_10002920
503 Ga0207641_10021557
504 Ga0207641_10035848
505 Ga0207641_10126825
506 Ga0207648_10004806
507 Ga0207648_10022529
508 Ga0207648_10061650
509 Ga0207648_10061825
510 Ga0207676_10007680
511 Ga0207676_10136738
512 Ga0207674_10026711
513 Ga0207675_100000224
514 Ga0207675_100044562
515 Ga0207675_100323730
516 Ga0207683_10083653
517 Ga0207683_10172390
518 Ga0207428_10140170
519 Ga0268265_10081655
520 Ga0268264_10003376
521 Ga0268264_10025339
522 Ga0268264_10035319
523 Ga0268264_10042403
524 Ga0268264_10314232
525 Ga0307517_10003459
526 Ga0307515_10000001
527 Ga0307508_10016381
528 Ga0395899_0092819
529 Ga0395899_0120615
530 Ga0395900_0023783
531 Ga0395898_0074297
532 Ga0395905_0014814
533 Ga0395905_0122157
534 Ga0395905_0199702
535 Ga0395901_0025750
536 Ga0395901_0027407
537 Ga0439465_0040601
538 Ga0439441_003931
539 Ga0439449_0013272
540 Ga0450898_002965
541 Ga0451577_0007735
542 Ga0451577_0104980
543 Ga0451577_0160430
544 Ga0466972_0000021
545 Ga0466970_0001306
546 Ga0451576_0000673
547 Ga0495580_0061210
548 Ga0495668_0000242
549 Ga0495686_0010137
550 Ga0496104_0101266
551 Ga0496110_0380508
552 Ga0501031_0005917
553 Ga0501032_0187054
554 Ga0501033_0052610
555 Ga0501034_0000002
556 Ga0501034_0029668
557 Ga0501034_0046422
558 Ga0501034_0049307
559 Ga0501034_0055687
560 Ga0501034_0199069
561 Ga0501036_0055758
562 Ga0501037_0014409
563 Ga0501037_0124803
564 Ga0501038_0006563
565 Ga0501038_0315362
566 Ga0501047_0017081
567 Ga0501047_0110478
568 Ga0501259_004214
569 Ga0501080_0191905
570 Ga0501083_0039404
571 Ga0501035_0091761
572 Ga0501035_0242293
573 Ga0501044_0036967
574 Ga0501044_0080670
575 nmdc:mga05p37_88318_c1
576 nmdc:mga06r32_184296_c1
577 nmdc:mga08y16_110142_c1
578 nmdc:mga08y16_68912_c1
579 nmdc:mga08y16_95417_c1
580 Ga0500568_0001221
581 Ga0500588_0001821
582 Ga0500616_0043554
583 2819585483
584 2914760575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01180

DHO_dh

Dihydroorotate dehydrogenase

100

399

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofw-assembly1.cif.gz_A crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis 0.8951 4 317
8ofw-assembly2.cif.gz_B crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis 0.8858 4 317
6syp-assembly1.cif.gz_AAA human dhodh bound to inhibitor ipp/cnrs-a017 0.8818 12 317
8ofw-assembly1.cif.gz_A crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis 0.8735 4 317
6aj5-assembly1.cif.gz_A crystal structure of ligand-free type dhodh from eimeria tenella 0.8712 35 316
ID Description Score Start End Superfamily
af_P9WHL1_31_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8973 31 317 3.20.20.70
af_Q2FV30_1_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8927 1 317 3.20.20.70
af_Q2FV30_1_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8793 1 317 3.20.20.70
af_P0A7E1_1_336_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8581 2 310 3.20.20.70
6i55B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8521 2 317 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3D3CWY0-F1-model_v4 Dihydroorotate dehydrogenase (Quinone) 0.9818 1 124 GO:0004152
GO:0005737
GO:0005886
GO:0006207
GO:0044205
AF-A0A4Q6A9N9-F1-model_v4 Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) 0.9674 1 229 GO:0005737
GO:0005886
GO:0006207
GO:0044205
GO:0106430
AF-A0A455U4K3-F1-model_v4 Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) (DHOdehase) (Dihydroorotate oxidase) 0.9642 43 183 GO:0005737
GO:0005886
GO:0006207
GO:0044205
GO:0106430
AF-A0A0G1P3W5-F1-model_v4 Dihydroorotate dehydrogenase (Quinone) 0.9613 28 187 GO:0004152
GO:0005737
GO:0005886
GO:0006207
GO:0044205
AF-A0A2S9F9D6-F1-model_v4 Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) 0.9608 1 183 GO:0005737
GO:0005886
GO:0006207
GO:0044205
GO:0106430

Map