F390905

General Info

Members Datasets Scaffolds Average Seq Length
292 193 584 146

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_11708389|Ga0105242_117083891
Length 149
Sequence MLGAMTLQRMDNVGIVVDDLKAAIAFFVELGMELEAEMPVEGRWVDRIVGLDGVRNDIAMMRTPDGHGRLELMKFHAPPATTAEPNAPVNTLGIRRIMFAVDDVDDVVARLRGHGAELLGEIAQYEDLYRLCFVRGPEGIIIGLAERLG

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
121 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
122 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
125 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
193 2869068681 Micromonospora noduli GUI43 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 0
Rhizoplane 13.7
Rhizosphere 78.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_11708389 3300009176 Bacteria 666
2 JGI25406J46586_10021727 3300003203 Bacteria 2569
3 JGI25407J50210_10001082 3300003373 Bacteria 5998
4 Ga0070658_10965628 3300005327 Bacteria 741
5 Ga0070683_100831225 3300005329 Bacteria 886
6 Ga0070690_101013059 3300005330 Bacteria 655
7 Ga0068869_100314203 3300005334 Bacteria 1269
8 Ga0068868_100080626 3300005338 Bacteria 2608
9 Ga0068868_100088365 3300005338 Bacteria 2494
10 Ga0068868_101219971 3300005338 Bacteria 696
11 Ga0070660_100824635 3300005339 Bacteria 781
12 Ga0070668_100741762 3300005347 Bacteria 869
13 Ga0070688_100204713 3300005365 Bacteria 1382
14 Ga0070711_100301628 3300005439 Bacteria 1274
15 Ga0070700_100024699 3300005441 Bacteria 3532
16 Ga0070700_100286884 3300005441 Bacteria 1196
17 Ga0070708_100038151 3300005445 Bacteria 4196
18 Ga0068867_100042190 3300005459 Bacteria 3336
19 Ga0070685_10113412 3300005466 Bacteria 1673
20 Ga0070706_100003993 3300005467 Bacteria 14361
21 Ga0070707_100078585 3300005468 Bacteria 3183
22 Ga0070698_100031905 3300005471 Bacteria 5460
23 Ga0070699_100140687 3300005518 Bacteria 2131
24 Ga0070684_100058047 3300005535 Bacteria 3381
25 Ga0070665_100942126 3300005548 Bacteria 876
26 Ga0070704_100007433 3300005549 Bacteria 6525
27 Ga0068857_100502781 3300005577 Bacteria 1138
28 Ga0070702_100030389 3300005615 Bacteria 2945
29 Ga0070702_100133450 3300005615 Bacteria 1571
30 Ga0070702_100419255 3300005615 Bacteria 963
31 Ga0068852_100365333 3300005616 Bacteria 1413
32 Ga0068859_100168791 3300005617 Bacteria 2269
33 Ga0068864_101776622 3300005618 Bacteria 622
34 Ga0068861_100094245 3300005719 Bacteria 2369
35 Ga0068861_100215853 3300005719 Bacteria 1618
36 Ga0068870_10161825 3300005840 Bacteria 1328
37 Ga0068858_100077265 3300005842 Bacteria 3093
38 Ga0068858_100105329 3300005842 Bacteria 2631
39 Ga0081455_10120279 3300005937 Bacteria 2070
40 Ga0081538_10000490 3300005981 Bacteria 44238
41 Ga0081539_10004290 3300005985 Bacteria 15987
42 Ga0081539_10025416 3300005985 Bacteria 3815
43 Ga0070717_10000005 3300006028 Bacteria 357819
44 Ga0070717_10056246 3300006028 Bacteria 3249
45 Ga0075365_10001325 3300006038 Bacteria 11067
46 Ga0075365_10020348 3300006038 Bacteria 4114
47 Ga0075363_100971022 3300006048 Bacteria 522
48 Ga0075430_100337659 3300006846 Bacteria 1245
49 Ga0075431_100300357 3300006847 Bacteria 1622
50 Ga0075433_10023364 3300006852 Bacteria 5203
51 Ga0097620_100168790 3300006931 Bacteria 2269
52 Ga0075435_100567026 3300007076 Bacteria 984
53 Ga0105251_10269128 3300009011 Bacteria 769
54 Ga0111539_10041164 3300009094 Bacteria 5556
55 Ga0111539_10176277 3300009094 Bacteria 2497
56 Ga0111539_12104318 3300009094 Bacteria 655
57 Ga0105245_10043904 3300009098 Bacteria 3988
58 Ga0105245_10055911 3300009098 Bacteria 3546
59 Ga0114129_10023870 3300009147 Bacteria 8667
60 Ga0105243_10041011 3300009148 Bacteria 3619
61 Ga0105243_10051157 3300009148 Bacteria 3266
62 Ga0105241_10464610 3300009174 Bacteria 1122
63 Ga0105242_10120397 3300009176 Bacteria 2251
64 Ga0105242_10363178 3300009176 Bacteria 1341
65 Ga0105248_11187741 3300009177 Bacteria 862
66 Ga0105248_11677207 3300009177 Bacteria 720
67 Ga0105249_10120749 3300009553 Bacteria 2490
68 Ga0105249_10128079 3300009553 Bacteria 2420
69 Ga0105239_10185868 3300010375 Bacteria 2325
70 Ga0105246_10236855 3300011119 Bacteria 1441
71 Ga0105246_10617181 3300011119 Bacteria 939
72 Ga0157373_10196638 3300013100 Bacteria 1421
73 Ga0157373_10437426 3300013100 Bacteria 940
74 Ga0157371_11531254 3300013102 Bacteria 521
75 Ga0157374_11240489 3300013296 Bacteria 767
76 Ga0157372_10593645 3300013307 Bacteria 1291
77 Ga0157375_10246261 3300013308 Bacteria 1948
78 Ga0163163_10463550 3300014325 Bacteria 1328
79 Ga0163163_12176542 3300014325 Bacteria 614
80 Ga0157380_10778285 3300014326 Bacteria 971
81 Ga0182008_10099841 3300014497 Bacteria 1434
82 Ga0182008_10617018 3300014497 Bacteria 610
83 Ga0157377_10113325 3300014745 Bacteria 1633
84 Ga0157379_10019296 3300014968 Bacteria 6021
85 Ga0157379_10289359 3300014968 Bacteria 1492
86 Ga0157379_10659107 3300014968 Bacteria 980
87 Ga0157376_10651721 3300014969 Bacteria 1053
88 Ga0163161_10139663 3300017792 Bacteria 1834
89 Ga0213875_10024303 3300021388 Bacteria 2891
90 Ga0213875_10101621 3300021388 Bacteria 1342
91 Ga0207656_10551411 3300025321 Bacteria 587
92 Ga0207642_10115491 3300025899 Bacteria 1375
93 Ga0207688_10351106 3300025901 Bacteria 909
94 Ga0207647_10369453 3300025904 Bacteria 811
95 Ga0207643_10050576 3300025908 Bacteria 2357
96 Ga0207684_10008660 3300025910 Bacteria 9036
97 Ga0207654_10283551 3300025911 Bacteria 1121
98 Ga0207662_10116146 3300025918 Bacteria 1673
99 Ga0207652_10572775 3300025921 Bacteria 1014
100 Ga0207646_10030961 3300025922 Bacteria 4846
101 Ga0207650_10250623 3300025925 Bacteria 1433
102 Ga0207687_10016515 3300025927 Bacteria 4849
103 Ga0207644_10224396 3300025931 Bacteria 1491
104 Ga0207690_10276297 3300025932 Bacteria 1307
105 Ga0207686_10102157 3300025934 Bacteria 1916
106 Ga0207686_10349238 3300025934 Bacteria 1113
107 Ga0207709_10029843 3300025935 Bacteria 3167
108 Ga0207709_10184007 3300025935 Bacteria 1478
109 Ga0207665_10660904 3300025939 Bacteria 820
110 Ga0207689_10408167 3300025942 Bacteria 1133
111 Ga0207679_10202729 3300025945 Bacteria 1658
112 Ga0207679_10919632 3300025945 Bacteria 800
113 Ga0207651_10159055 3300025960 Bacteria 1769
114 Ga0207712_10264226 3300025961 Bacteria 1397
115 Ga0207668_10165087 3300025972 Bacteria 1730
116 Ga0207677_10062862 3300026023 Bacteria 2578
117 Ga0207677_10149590 3300026023 Bacteria 1799
118 Ga0207703_10075996 3300026035 Bacteria 2785
119 Ga0207703_10132354 3300026035 Bacteria 2155
120 Ga0207639_11779488 3300026041 Bacteria 577
121 Ga0207708_10046907 3300026075 Bacteria 3290
122 Ga0207708_10276479 3300026075 Bacteria 1360
123 Ga0207641_11180176 3300026088 Bacteria 765
124 Ga0207648_10079292 3300026089 Bacteria 2864
125 Ga0207648_10315051 3300026089 Bacteria 1405
126 Ga0207676_10206495 3300026095 Bacteria 1739
127 Ga0207676_11014833 3300026095 Bacteria 818
128 Ga0207674_10185464 3300026116 Bacteria 2031
129 Ga0207675_100279377 3300026118 Bacteria 1622
130 Ga0207698_10061633 3300026142 Bacteria 2925
131 Ga0207698_10210861 3300026142 Bacteria 1748
132 Ga0207428_10063566 3300027907 Bacteria 2915
133 Ga0207428_10820771 3300027907 Bacteria 660
134 Ga0268266_10877180 3300028379 Bacteria 867
135 Ga0268265_10585965 3300028380 Bacteria 1064
136 Ga0268264_10248202 3300028381 Bacteria 1652
137 Ga0307405_10918008 3300031731 Bacteria 742
138 Ga0307413_10089404 3300031824 Bacteria 2001
139 Ga0307410_10086080 3300031852 Bacteria 2219
140 Ga0307406_10015247 3300031901 Bacteria 4443
141 Ga0307406_10140579 3300031901 Bacteria 1708
142 Ga0307406_10403214 3300031901 Bacteria 1085
143 Ga0307407_11175798 3300031903 Bacteria 598
144 Ga0307412_11213024 3300031911 Bacteria 676
145 Ga0307409_100583210 3300031995 Bacteria 1102
146 Ga0307409_101053434 3300031995 Bacteria 833
147 Ga0307414_10767535 3300032004 Bacteria 877
148 Ga0307411_10659660 3300032005 Bacteria 907
149 Ga0307415_100296881 3300032126 Bacteria 1337
150 Ga0307415_100659370 3300032126 Bacteria 939
151 Ga0373954_0419738 3300035118 Bacteria 662
152 Ga0373925_0693872 3300037068 Bacteria 839
153 Ga0395900_0006451 3300037418 Bacteria 12227
154 Ga0395905_0003438 3300037471 Bacteria 16945
155 Ga0395905_0361355 3300037471 Bacteria 1345
156 Ga0436364_0278305 3300037853 Bacteria 1862
157 Ga0436364_0797104 3300037853 Bacteria 1470
158 Ga0436364_0989430 3300037853 Bacteria 3863
159 Ga0436364_0996710 3300037853 Bacteria 18555
160 Ga0436364_1299695 3300037853 Bacteria 536
161 Ga0436365_1544370 3300039437 Bacteria 1404
162 Ga0436365_1789972 3300039437 Bacteria 840
163 Ga0436360_1298731 3300039438 Bacteria 594
164 Ga0436362_0500227 3300039453 Bacteria 583
165 Ga0436362_0637079 3300039453 Bacteria 590
166 Ga0436362_0863438 3300039453 Bacteria 934
167 Ga0436362_1248249 3300039453 Bacteria 2131
168 Ga0451800_0733340 3300041459 Bacteria 672
169 Ga0451800_0931992 3300041459 Bacteria 911
170 Ga0451847_0195858 3300041503 Bacteria 521
171 Ga0451849_1361864 3300041505 Bacteria 563
172 Ga0451853_0594177 3300041512 Bacteria 1306
173 Ga0439455_0060537 3300042012 Bacteria 1004
174 Ga0450910_087029 3300042147 Bacteria 551
175 Ga0439458_0033606 3300042157 Bacteria 1229
176 Ga0439459_0105513 3300042438 Bacteria 695
177 Ga0466972_0462756 3300044658 Bacteria 596
178 Ga0466961_0222576 3300044693 Bacteria 1163
179 Ga0466963_0000019 3300044694 Bacteria 56949
180 Ga0466963_0000291 3300044694 Bacteria 22648
181 Ga0466963_0202436 3300044694 Bacteria 1389
182 Ga0466963_0375194 3300044694 Bacteria 1002
183 Ga0466964_0034938 3300044706 Bacteria 2008
184 Ga0466964_0268505 3300044706 Bacteria 848
185 Ga0466964_0298493 3300044706 Bacteria 811
186 Ga0466971_0047059 3300044719 Bacteria 1939
187 Ga0466968_0066285 3300044735 Bacteria 1564
188 Ga0466957_0005765 3300044842 Bacteria 6958
189 Ga0466957_0256563 3300044842 Bacteria 1164
190 Ga0466957_1214670 3300044842 Bacteria 546
191 Ga0466960_0019932 3300044901 Bacteria 2963
192 Ga0466960_0517947 3300044901 Bacteria 700
193 Ga0466960_0520900 3300044901 Bacteria 698
194 Ga0466960_0672105 3300044901 Bacteria 619
195 Ga0466959_0473815 3300045049 Bacteria 848
196 Ga0466958_0898687 3300045836 Bacteria 578
197 Ga0466967_0039172 3300045976 Bacteria 4072
198 Ga0466967_0159173 3300045976 Bacteria 2118
199 Ga0466967_0204128 3300045976 Bacteria 1873
200 Ga0466967_0681873 3300045976 Bacteria 1017
201 Ga0466967_0700297 3300045976 Bacteria 1003
202 Ga0466967_2288920 3300045976 Bacteria 536
203 Ga0495590_0361618 3300046457 Bacteria 553
204 Ga0495651_0195731 3300046462 Bacteria 1419
205 Ga0495662_0000995 3300046476 Bacteria 13875
206 Ga0495608_0000001 3300046511 Bacteria 411278
207 Ga0495587_0386058 3300046536 Bacteria 779
208 Ga0495635_0648433 3300046663 Bacteria 687
209 Ga0495657_0000002 3300046675 Bacteria 411958
210 Ga0495657_0224893 3300046675 Bacteria 1137
211 Ga0495649_0003897 3300046694 Bacteria 9870
212 Ga0495660_0478033 3300046810 Bacteria 535
213 Ga0495672_0022128 3300047320 Bacteria 4138
214 Ga0495675_0000246 3300047444 Bacteria 39013
215 Ga0495686_0011279 3300047472 Bacteria 6299
216 Ga0496100_0032998 3300048903 Bacteria 3235
217 Ga0496100_0327019 3300048903 Bacteria 1153
218 Ga0496101_0169505 3300048904 Bacteria 1677
219 Ga0496101_0598767 3300048904 Bacteria 871
220 Ga0496102_0058845 3300048905 Bacteria 3512
221 Ga0496102_0299864 3300048905 Bacteria 1514
222 Ga0496103_0128834 3300048906 Bacteria 1615
223 Ga0496103_0440447 3300048906 Bacteria 836
224 Ga0496104_0000013 3300048907 Bacteria 397163
225 Ga0496104_0056437 3300048907 Bacteria 3714
226 Ga0496104_0367833 3300048907 Bacteria 1350
227 Ga0496105_0000006 3300048908 Bacteria 393578
228 Ga0496105_0042884 3300048908 Bacteria 3731
229 Ga0496105_0763367 3300048908 Bacteria 738
230 Ga0496106_0063860 3300048909 Bacteria 2799
231 Ga0496106_0169950 3300048909 Bacteria 1728
232 Ga0496107_0085877 3300048910 Bacteria 2296
233 Ga0496108_0034486 3300048911 Bacteria 4205
234 Ga0496108_0038176 3300048911 Bacteria 4001
235 Ga0496108_0402423 3300048911 Bacteria 1196
236 Ga0496109_0055238 3300048912 Bacteria 3622
237 Ga0496109_0093228 3300048912 Bacteria 2787
238 Ga0496109_0130650 3300048912 Bacteria 2344
239 Ga0496109_1121713 3300048912 Bacteria 723
240 Ga0496110_0080317 3300048913 Bacteria 2905
241 Ga0496110_0349787 3300048913 Bacteria 1346
242 Ga0496110_0449701 3300048913 Bacteria 1174
243 Ga0496110_1679297 3300048913 Bacteria 545
244 Ga0496111_0065845 3300048914 Bacteria 2630
245 Ga0496111_0228903 3300048914 Bacteria 1381
246 Ga0496111_0300759 3300048914 Bacteria 1189
247 Ga0496112_0044515 3300048915 Bacteria 4349
248 Ga0496112_0141316 3300048915 Bacteria 2376
249 Ga0496112_0918970 3300048915 Bacteria 797
250 Ga0496113_0069993 3300048916 Bacteria 2665
251 Ga0496113_0531836 3300048916 Bacteria 943
252 Ga0496114_0149218 3300048917 Bacteria 2028
253 Ga0496114_0281261 3300048917 Bacteria 1467
254 Ga0496119_0435466 3300048922 Bacteria 620
255 Ga0496120_0355403 3300048923 Bacteria 657
256 Ga0501033_0276213 3300049570 Bacteria 1187
257 Ga0501040_0206259 3300049576 Bacteria 1396
258 Ga0501042_0242434 3300049578 Bacteria 1301
259 Ga0501042_0926883 3300049578 Bacteria 634
260 Ga0501067_0000778 3300049583 Bacteria 17137
261 Ga0501068_0001216 3300049584 Bacteria 13677
262 Ga0501069_0148668 3300049585 Bacteria 1345
263 Ga0501069_0714885 3300049585 Bacteria 605
264 Ga0501072_0003320 3300049588 Bacteria 12107
265 Ga0501074_0085509 3300049590 Bacteria 2260
266 Ga0501076_0041965 3300049592 Bacteria 3602
267 Ga0501076_0049212 3300049592 Bacteria 3333
268 Ga0501081_0008152 3300049743 Bacteria 6800
269 Ga0501081_0310538 3300049743 Bacteria 1158
270 Ga0501045_0197742 3300049824 Bacteria 1498
271 Ga0501045_0198639 3300049824 Bacteria 1494
272 nmdc:mga00v17_69335_c1 3300050491 Bacteria 2182
273 nmdc:mga0yw44_117798_c1 3300050492 Bacteria 1708
274 nmdc:mga0yw44_169553_c1 3300050492 Bacteria 1433
275 nmdc:mga0yw44_251235_c1 3300050492 Bacteria 1177
276 nmdc:mga05p37_1832986_c1 3300050507 Bacteria 583
277 nmdc:mga05p37_4798_c1 3300050507 Bacteria 15804
278 nmdc:mga0qj67_171957_c1 3300050509 Bacteria 1759
279 nmdc:mga06r32_1733_c2 3300050510 Bacteria 8517
280 nmdc:mga08y16_22938_c1 3300050511 Bacteria 6589
281 nmdc:mga0a205_19940_c1 3300050515 Bacteria 6326
282 Ga0495601_0433631 3300053077 Bacteria 851
283 Ga0495595_0000001 3300053084 Bacteria 495226
284 Ga0495595_0117601 3300053084 Bacteria 1293
285 Ga0495619_0000143 3300053085 Bacteria 53216
286 Ga0495619_0290440 3300053085 Bacteria 1133
287 Ga0500616_0162084 3300053153 Bacteria 1024
288 Ga0501082_0980839 3300060353 Bacteria 739
289 Ga0501082_1017238 3300060353 Bacteria 725
290 Ga0530510_0001592 3300061734 Bacteria 15315
291 2515722419 2515154129 Bacteria 5584369
292 2869074479 2869068681 Bacteria 7205615
293 Ga0105242_11708389
294 JGI25406J46586_10021727
295 JGI25407J50210_10001082
296 Ga0070658_10965628
297 Ga0070683_100831225
298 Ga0070690_101013059
299 Ga0068869_100314203
300 Ga0068868_100080626
301 Ga0068868_100088365
302 Ga0068868_101219971
303 Ga0070660_100824635
304 Ga0070668_100741762
305 Ga0070688_100204713
306 Ga0070711_100301628
307 Ga0070700_100024699
308 Ga0070700_100286884
309 Ga0070708_100038151
310 Ga0068867_100042190
311 Ga0070685_10113412
312 Ga0070706_100003993
313 Ga0070707_100078585
314 Ga0070698_100031905
315 Ga0070699_100140687
316 Ga0070684_100058047
317 Ga0070665_100942126
318 Ga0070704_100007433
319 Ga0068857_100502781
320 Ga0070702_100030389
321 Ga0070702_100133450
322 Ga0070702_100419255
323 Ga0068852_100365333
324 Ga0068859_100168791
325 Ga0068864_101776622
326 Ga0068861_100094245
327 Ga0068861_100215853
328 Ga0068870_10161825
329 Ga0068858_100077265
330 Ga0068858_100105329
331 Ga0081455_10120279
332 Ga0081538_10000490
333 Ga0081539_10004290
334 Ga0081539_10025416
335 Ga0070717_10000005
336 Ga0070717_10056246
337 Ga0075365_10001325
338 Ga0075365_10020348
339 Ga0075363_100971022
340 Ga0075430_100337659
341 Ga0075431_100300357
342 Ga0075433_10023364
343 Ga0097620_100168790
344 Ga0075435_100567026
345 Ga0105251_10269128
346 Ga0111539_10041164
347 Ga0111539_10176277
348 Ga0111539_12104318
349 Ga0105245_10043904
350 Ga0105245_10055911
351 Ga0114129_10023870
352 Ga0105243_10041011
353 Ga0105243_10051157
354 Ga0105241_10464610
355 Ga0105242_10120397
356 Ga0105242_10363178
357 Ga0105248_11187741
358 Ga0105248_11677207
359 Ga0105249_10120749
360 Ga0105249_10128079
361 Ga0105239_10185868
362 Ga0105246_10236855
363 Ga0105246_10617181
364 Ga0157373_10196638
365 Ga0157373_10437426
366 Ga0157371_11531254
367 Ga0157374_11240489
368 Ga0157372_10593645
369 Ga0157375_10246261
370 Ga0163163_10463550
371 Ga0163163_12176542
372 Ga0157380_10778285
373 Ga0182008_10099841
374 Ga0182008_10617018
375 Ga0157377_10113325
376 Ga0157379_10019296
377 Ga0157379_10289359
378 Ga0157379_10659107
379 Ga0157376_10651721
380 Ga0163161_10139663
381 Ga0213875_10024303
382 Ga0213875_10101621
383 Ga0207656_10551411
384 Ga0207642_10115491
385 Ga0207688_10351106
386 Ga0207647_10369453
387 Ga0207643_10050576
388 Ga0207684_10008660
389 Ga0207654_10283551
390 Ga0207662_10116146
391 Ga0207652_10572775
392 Ga0207646_10030961
393 Ga0207650_10250623
394 Ga0207687_10016515
395 Ga0207644_10224396
396 Ga0207690_10276297
397 Ga0207686_10102157
398 Ga0207686_10349238
399 Ga0207709_10029843
400 Ga0207709_10184007
401 Ga0207665_10660904
402 Ga0207689_10408167
403 Ga0207679_10202729
404 Ga0207679_10919632
405 Ga0207651_10159055
406 Ga0207712_10264226
407 Ga0207668_10165087
408 Ga0207677_10062862
409 Ga0207677_10149590
410 Ga0207703_10075996
411 Ga0207703_10132354
412 Ga0207639_11779488
413 Ga0207708_10046907
414 Ga0207708_10276479
415 Ga0207641_11180176
416 Ga0207648_10079292
417 Ga0207648_10315051
418 Ga0207676_10206495
419 Ga0207676_11014833
420 Ga0207674_10185464
421 Ga0207675_100279377
422 Ga0207698_10061633
423 Ga0207698_10210861
424 Ga0207428_10063566
425 Ga0207428_10820771
426 Ga0268266_10877180
427 Ga0268265_10585965
428 Ga0268264_10248202
429 Ga0307405_10918008
430 Ga0307413_10089404
431 Ga0307410_10086080
432 Ga0307406_10015247
433 Ga0307406_10140579
434 Ga0307406_10403214
435 Ga0307407_11175798
436 Ga0307412_11213024
437 Ga0307409_100583210
438 Ga0307409_101053434
439 Ga0307414_10767535
440 Ga0307411_10659660
441 Ga0307415_100296881
442 Ga0307415_100659370
443 Ga0373954_0419738
444 Ga0373925_0693872
445 Ga0395900_0006451
446 Ga0395905_0003438
447 Ga0395905_0361355
448 Ga0436364_0278305
449 Ga0436364_0797104
450 Ga0436364_0989430
451 Ga0436364_0996710
452 Ga0436364_1299695
453 Ga0436365_1544370
454 Ga0436365_1789972
455 Ga0436360_1298731
456 Ga0436362_0500227
457 Ga0436362_0637079
458 Ga0436362_0863438
459 Ga0436362_1248249
460 Ga0451800_0733340
461 Ga0451800_0931992
462 Ga0451847_0195858
463 Ga0451849_1361864
464 Ga0451853_0594177
465 Ga0439455_0060537
466 Ga0450910_087029
467 Ga0439458_0033606
468 Ga0439459_0105513
469 Ga0466972_0462756
470 Ga0466961_0222576
471 Ga0466963_0000019
472 Ga0466963_0000291
473 Ga0466963_0202436
474 Ga0466963_0375194
475 Ga0466964_0034938
476 Ga0466964_0268505
477 Ga0466964_0298493
478 Ga0466971_0047059
479 Ga0466968_0066285
480 Ga0466957_0005765
481 Ga0466957_0256563
482 Ga0466957_1214670
483 Ga0466960_0019932
484 Ga0466960_0517947
485 Ga0466960_0520900
486 Ga0466960_0672105
487 Ga0466959_0473815
488 Ga0466958_0898687
489 Ga0466967_0039172
490 Ga0466967_0159173
491 Ga0466967_0204128
492 Ga0466967_0681873
493 Ga0466967_0700297
494 Ga0466967_2288920
495 Ga0495590_0361618
496 Ga0495651_0195731
497 Ga0495662_0000995
498 Ga0495608_0000001
499 Ga0495587_0386058
500 Ga0495635_0648433
501 Ga0495657_0000002
502 Ga0495657_0224893
503 Ga0495649_0003897
504 Ga0495660_0478033
505 Ga0495672_0022128
506 Ga0495675_0000246
507 Ga0495686_0011279
508 Ga0496100_0032998
509 Ga0496100_0327019
510 Ga0496101_0169505
511 Ga0496101_0598767
512 Ga0496102_0058845
513 Ga0496102_0299864
514 Ga0496103_0128834
515 Ga0496103_0440447
516 Ga0496104_0000013
517 Ga0496104_0056437
518 Ga0496104_0367833
519 Ga0496105_0000006
520 Ga0496105_0042884
521 Ga0496105_0763367
522 Ga0496106_0063860
523 Ga0496106_0169950
524 Ga0496107_0085877
525 Ga0496108_0034486
526 Ga0496108_0038176
527 Ga0496108_0402423
528 Ga0496109_0055238
529 Ga0496109_0093228
530 Ga0496109_0130650
531 Ga0496109_1121713
532 Ga0496110_0080317
533 Ga0496110_0349787
534 Ga0496110_0449701
535 Ga0496110_1679297
536 Ga0496111_0065845
537 Ga0496111_0228903
538 Ga0496111_0300759
539 Ga0496112_0044515
540 Ga0496112_0141316
541 Ga0496112_0918970
542 Ga0496113_0069993
543 Ga0496113_0531836
544 Ga0496114_0149218
545 Ga0496114_0281261
546 Ga0496119_0435466
547 Ga0496120_0355403
548 Ga0501033_0276213
549 Ga0501040_0206259
550 Ga0501042_0242434
551 Ga0501042_0926883
552 Ga0501067_0000778
553 Ga0501068_0001216
554 Ga0501069_0148668
555 Ga0501069_0714885
556 Ga0501072_0003320
557 Ga0501074_0085509
558 Ga0501076_0041965
559 Ga0501076_0049212
560 Ga0501081_0008152
561 Ga0501081_0310538
562 Ga0501045_0197742
563 Ga0501045_0198639
564 nmdc:mga00v17_69335_c1
565 nmdc:mga0yw44_117798_c1
566 nmdc:mga0yw44_169553_c1
567 nmdc:mga0yw44_251235_c1
568 nmdc:mga05p37_1832986_c1
569 nmdc:mga05p37_4798_c1
570 nmdc:mga0qj67_171957_c1
571 nmdc:mga06r32_1733_c2
572 nmdc:mga08y16_22938_c1
573 nmdc:mga0a205_19940_c1
574 Ga0495601_0433631
575 Ga0495595_0000001
576 Ga0495595_0117601
577 Ga0495619_0000143
578 Ga0495619_0290440
579 Ga0500616_0162084
580 Ga0501082_0980839
581 Ga0501082_1017238
582 Ga0530510_0001592
583 2515722419
584 2869074479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

9

144

0.95

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

133

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9539 1 146
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9413 1 146
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8061 4 143
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8054 4 143
6bnx-assembly1.cif.gz_A crystal structure of v278e-glyoxalase i mutant from zea mays in space group p6(3) 0.792 5 146
ID Description Score Start End Superfamily
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9391 2 146 3.10.180.10
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9327 2 146 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9094 93 146 3.30.720.110
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8393 9 144 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8248 9 144 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6V8K4V9-F1-model_v4 VOC domain-containing protein 0.9851 3 146 GO:0004493
GO:0046491
AF-A0A831X7M7-F1-model_v4 VOC family protein 0.9841 26 146
AF-A0A536LG09-F1-model_v4 VOC family protein 0.9817 1 146 GO:0004493
GO:0046491
AF-S4MHG5-F1-model_v4 VOC domain-containing protein 0.9805 2 133 GO:0004493
GO:0046491
AF-A0A510TKB3-F1-model_v4 VOC domain-containing protein 0.9792 1 146 GO:0004493
GO:0046491

Map