F390936
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 220 | 286 | 592 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10021159|Ga0163163_100211594 |
| Length | 627 |
| Sequence | LNVNGTGGRCHFADSIVARADGPPRSKAVKVMVVDIAIVGAGGAGLRAAIAAAEADPALNIVLVSKVYPMRSHTVAAEGGSAGVTQRHDSLEHHFNDTVTGGEWLCDQDVVDYFVAHCTEEMVRLEHWGCPWSRLADGHVNVRAFGGMKIERTWFAADKTGFHILHTLFQTSIKYPAITRLDEHFCTALVVDDGRCYGVVAIDISSGEFTFVAAKAVVIATGGAGRVFLQNTNGGIVTGDGMAMVYRHGVALRDMEFVQYHPTCMPGSGLLFTEACRGEGGILTNKDGYRYLQDYGLGPPDPWPRNKAMELGPRDRLSQAFWHEERKGRTIATRNGAAVNLDLRHLGAKKLRERLPQICELAESFLGIDPAERPVPVRPAVHYTMGGILVNRETASTLTGLYAVGECSSIGIHGANRLGSNSLAELGVFGKVAGEAAARCARSLPPGPMATLKKQADDVRRRAVDLIRNEAGGERLAVLRDAMAQSMETGCGIYRLDAQMKQTCHTLAELKNRYRRLRLDDTSRAWNTEWLAAIELGYQLDVAQAMAHSAFARKESRGAHSRLDGFEQRDDANFLKHTLAVYRADGPPAISYMPVNITRSAPGKRAYGAEGEHLEGYRKEQTQGTNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 3 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 4 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 5 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 6 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 74 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 75 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 121 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 122 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 124 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 125 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 130 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 133 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 134 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 135 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 136 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 137 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 138 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 171 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 172 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 173 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 181 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 182 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 183 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 184 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 210 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 211 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 212 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 213 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 214 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 215 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 216 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 217 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 218 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.95 |
| Metatranscriptomes | 0 |
| Isolates | 2.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.45 |
| Nodule | 0 |
| Rhizoplane | 5.48 |
| Rhizosphere | 88.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10110308 | 3300005293 | Bacteria | 2599 |
| 2 | Ga0070676_10041461 | 3300005328 | Bacteria | 2670 |
| 3 | Ga0070690_100026833 | 3300005330 | Bacteria | 3556 |
| 4 | Ga0070690_100027602 | 3300005330 | Bacteria | 3509 |
| 5 | Ga0068869_100040928 | 3300005334 | Bacteria | 3315 |
| 6 | Ga0068868_100017290 | 3300005338 | Bacteria | 5369 |
| 7 | Ga0070660_100028084 | 3300005339 | Bacteria | 4207 |
| 8 | Ga0070687_100025768 | 3300005343 | Bacteria | 2825 |
| 9 | Ga0070668_100009541 | 3300005347 | Bacteria | 7202 |
| 10 | Ga0070669_100080964 | 3300005353 | Bacteria | 2418 |
| 11 | Ga0070671_100012882 | 3300005355 | Bacteria | 6741 |
| 12 | Ga0070671_100018499 | 3300005355 | Bacteria | 5660 |
| 13 | Ga0070671_100076938 | 3300005355 | Bacteria | 2788 |
| 14 | Ga0070673_100005848 | 3300005364 | Bacteria | 7930 |
| 15 | Ga0070673_100013152 | 3300005364 | Bacteria | 5712 |
| 16 | Ga0070688_100001719 | 3300005365 | Bacteria | 10924 |
| 17 | Ga0070659_100009610 | 3300005366 | Bacteria | 7109 |
| 18 | Ga0070714_100072896 | 3300005435 | Bacteria | 2974 |
| 19 | Ga0070713_100000028 | 3300005436 | Bacteria | 93227 |
| 20 | Ga0070710_10023008 | 3300005437 | Bacteria | 3269 |
| 21 | Ga0070711_100027125 | 3300005439 | Bacteria | 3758 |
| 22 | Ga0070708_100000095 | 3300005445 | Bacteria | 58224 |
| 23 | Ga0070663_100059013 | 3300005455 | Bacteria | 2757 |
| 24 | Ga0070678_100002350 | 3300005456 | Bacteria | 10334 |
| 25 | Ga0070662_100000028 | 3300005457 | Bacteria | 83508 |
| 26 | Ga0068867_100000501 | 3300005459 | Bacteria | 26078 |
| 27 | Ga0068867_100023259 | 3300005459 | Bacteria | 4436 |
| 28 | Ga0068867_100067493 | 3300005459 | Bacteria | 2667 |
| 29 | Ga0070685_10007520 | 3300005466 | Bacteria | 5577 |
| 30 | Ga0070685_10062956 | 3300005466 | Bacteria | 2176 |
| 31 | Ga0070707_100089387 | 3300005468 | Bacteria | 2981 |
| 32 | Ga0070698_100015099 | 3300005471 | Bacteria | 8165 |
| 33 | Ga0070679_100034668 | 3300005530 | Bacteria | 5002 |
| 34 | Ga0068853_100004389 | 3300005539 | Bacteria | 10921 |
| 35 | Ga0070672_100004378 | 3300005543 | Bacteria | 9247 |
| 36 | Ga0070672_100053559 | 3300005543 | Bacteria | 3155 |
| 37 | Ga0070695_100030574 | 3300005545 | Bacteria | 3354 |
| 38 | Ga0070693_100002721 | 3300005547 | Bacteria | 8130 |
| 39 | Ga0070665_100035877 | 3300005548 | Bacteria | 4989 |
| 40 | Ga0068855_100007386 | 3300005563 | Bacteria | 13303 |
| 41 | Ga0068855_100015533 | 3300005563 | Bacteria | 9166 |
| 42 | Ga0070664_100006748 | 3300005564 | Bacteria | 9255 |
| 43 | Ga0070664_100089790 | 3300005564 | Bacteria | 2659 |
| 44 | Ga0068856_100004393 | 3300005614 | Bacteria | 14050 |
| 45 | Ga0068856_100068638 | 3300005614 | Bacteria | 3505 |
| 46 | Ga0068859_100000518 | 3300005617 | Bacteria | 38274 |
| 47 | Ga0068866_10004313 | 3300005718 | Bacteria | 5839 |
| 48 | Ga0068866_10006129 | 3300005718 | Bacteria | 5002 |
| 49 | Ga0068861_100024138 | 3300005719 | Bacteria | 4394 |
| 50 | Ga0068870_10023381 | 3300005840 | Bacteria | 3047 |
| 51 | Ga0068863_100004210 | 3300005841 | Bacteria | 14209 |
| 52 | Ga0068863_100051756 | 3300005841 | Bacteria | 3891 |
| 53 | Ga0068858_100007654 | 3300005842 | Bacteria | 10434 |
| 54 | Ga0068858_100109404 | 3300005842 | Bacteria | 2580 |
| 55 | Ga0068860_100017155 | 3300005843 | Bacteria | 7058 |
| 56 | Ga0068860_100051416 | 3300005843 | Bacteria | 3921 |
| 57 | Ga0097621_100033186 | 3300006237 | Bacteria | 4109 |
| 58 | Ga0068871_100022815 | 3300006358 | Bacteria | 4831 |
| 59 | Ga0075428_100001908 | 3300006844 | Bacteria | 22367 |
| 60 | Ga0075428_100059236 | 3300006844 | Bacteria | 4193 |
| 61 | Ga0075430_100118389 | 3300006846 | Bacteria | 2208 |
| 62 | Ga0075434_100030885 | 3300006871 | Bacteria | 5279 |
| 63 | Ga0075429_100028246 | 3300006880 | Bacteria | 4871 |
| 64 | Ga0068865_100012581 | 3300006881 | Bacteria | 5331 |
| 65 | Ga0097620_100000518 | 3300006931 | Bacteria | 38274 |
| 66 | Ga0075435_100051008 | 3300007076 | Bacteria | 3331 |
| 67 | Ga0111539_10018988 | 3300009094 | Bacteria | 8499 |
| 68 | Ga0111539_10029850 | 3300009094 | Bacteria | 6634 |
| 69 | Ga0105243_10051211 | 3300009148 | Bacteria | 3265 |
| 70 | Ga0105243_10056514 | 3300009148 | Bacteria | 3122 |
| 71 | Ga0105241_10015571 | 3300009174 | Bacteria | 5573 |
| 72 | Ga0105242_10038116 | 3300009176 | Bacteria | 3863 |
| 73 | Ga0105248_10095345 | 3300009177 | Bacteria | 3350 |
| 74 | Ga0105238_10011219 | 3300009551 | Bacteria | 9016 |
| 75 | Ga0105238_10128244 | 3300009551 | Bacteria | 2515 |
| 76 | Ga0157371_10000210 | 3300013102 | Bacteria | 84791 |
| 77 | Ga0157369_10069186 | 3300013105 | Bacteria | 3793 |
| 78 | Ga0157374_10055838 | 3300013296 | Bacteria | 3687 |
| 79 | Ga0157374_10076146 | 3300013296 | Bacteria | 3172 |
| 80 | Ga0157378_10005086 | 3300013297 | Bacteria | 11555 |
| 81 | Ga0157378_10005529 | 3300013297 | Bacteria | 11066 |
| 82 | Ga0163162_10003443 | 3300013306 | Bacteria | 15110 |
| 83 | Ga0157372_10003657 | 3300013307 | Bacteria | 16524 |
| 84 | Ga0157372_10015272 | 3300013307 | Bacteria | 8225 |
| 85 | Ga0157375_10055640 | 3300013308 | Bacteria | 3902 |
| 86 | Ga0163163_10021159 | 3300014325 | Bacteria | 6136 |
| 87 | Ga0163163_10055601 | 3300014325 | Bacteria | 3912 |
| 88 | Ga0157380_10078584 | 3300014326 | Bacteria | 2692 |
| 89 | Ga0157379_10090075 | 3300014968 | Bacteria | 2752 |
| 90 | Ga0213872_10014392 | 3300021361 | Bacteria | 3691 |
| 91 | Ga0213872_10024620 | 3300021361 | Bacteria | 2769 |
| 92 | Ga0213871_10004743 | 3300021441 | Bacteria | 2747 |
| 93 | Ga0209677_100592 | 3300025253 | Bacteria | 19729 |
| 94 | Ga0209051_1022341 | 3300025303 | Bacteria | 2665 |
| 95 | Ga0207682_10003443 | 3300025893 | Bacteria | 6875 |
| 96 | Ga0207642_10023312 | 3300025899 | Bacteria | 2470 |
| 97 | Ga0207680_10009918 | 3300025903 | Bacteria | 4744 |
| 98 | Ga0207643_10030230 | 3300025908 | Bacteria | 3013 |
| 99 | Ga0207684_10035581 | 3300025910 | Bacteria | 4228 |
| 100 | Ga0207693_10000236 | 3300025915 | Bacteria | 50870 |
| 101 | Ga0207663_10033365 | 3300025916 | Bacteria | 3066 |
| 102 | Ga0207657_10000682 | 3300025919 | Bacteria | 36172 |
| 103 | Ga0207657_10038747 | 3300025919 | Bacteria | 4239 |
| 104 | Ga0207681_10071806 | 3300025923 | Bacteria | 2416 |
| 105 | Ga0207681_10083245 | 3300025923 | Bacteria | 2264 |
| 106 | Ga0207681_10085386 | 3300025923 | Bacteria | 2240 |
| 107 | Ga0207694_10023295 | 3300025924 | Bacteria | 4701 |
| 108 | Ga0207650_10013558 | 3300025925 | Bacteria | 5647 |
| 109 | Ga0207659_10035202 | 3300025926 | Bacteria | 3459 |
| 110 | Ga0207687_10035626 | 3300025927 | Bacteria | 3386 |
| 111 | Ga0207700_10058697 | 3300025928 | Bacteria | 2908 |
| 112 | Ga0207644_10012751 | 3300025931 | Bacteria | 5589 |
| 113 | Ga0207644_10014884 | 3300025931 | Bacteria | 5214 |
| 114 | Ga0207644_10026663 | 3300025931 | Bacteria | 3985 |
| 115 | Ga0207690_10002006 | 3300025932 | Bacteria | 12465 |
| 116 | Ga0207706_10000114 | 3300025933 | Bacteria | 86582 |
| 117 | Ga0207706_10015435 | 3300025933 | Bacteria | 6900 |
| 118 | Ga0207706_10047172 | 3300025933 | Bacteria | 3813 |
| 119 | Ga0207686_10004032 | 3300025934 | Bacteria | 7879 |
| 120 | Ga0207669_10027161 | 3300025937 | Bacteria | 3128 |
| 121 | Ga0207704_10010256 | 3300025938 | Bacteria | 4561 |
| 122 | Ga0207711_10036014 | 3300025941 | Bacteria | 4197 |
| 123 | Ga0207689_10016148 | 3300025942 | Bacteria | 6322 |
| 124 | Ga0207689_10046871 | 3300025942 | Bacteria | 3571 |
| 125 | Ga0207679_10005560 | 3300025945 | Bacteria | 7898 |
| 126 | Ga0207679_10102581 | 3300025945 | Bacteria | 2240 |
| 127 | Ga0207667_10007115 | 3300025949 | Bacteria | 13503 |
| 128 | Ga0207667_10105808 | 3300025949 | Bacteria | 2903 |
| 129 | Ga0207651_10003811 | 3300025960 | Bacteria | 7473 |
| 130 | Ga0207658_10040554 | 3300025986 | Bacteria | 3366 |
| 131 | Ga0207677_10009171 | 3300026023 | Bacteria | 5556 |
| 132 | Ga0207703_10029840 | 3300026035 | Bacteria | 4305 |
| 133 | Ga0207703_10047271 | 3300026035 | Bacteria | 3469 |
| 134 | Ga0207639_10033928 | 3300026041 | Bacteria | 3769 |
| 135 | Ga0207708_10010719 | 3300026075 | Bacteria | 6813 |
| 136 | Ga0207702_10007941 | 3300026078 | Bacteria | 8991 |
| 137 | Ga0207702_10030145 | 3300026078 | Bacteria | 4519 |
| 138 | Ga0207641_10037697 | 3300026088 | Bacteria | 4038 |
| 139 | Ga0207648_10004276 | 3300026089 | Bacteria | 14725 |
| 140 | Ga0207648_10035587 | 3300026089 | Bacteria | 4387 |
| 141 | Ga0207676_10009534 | 3300026095 | Bacteria | 6910 |
| 142 | Ga0207676_10019786 | 3300026095 | Bacteria | 4916 |
| 143 | Ga0207676_10060025 | 3300026095 | Bacteria | 3006 |
| 144 | Ga0207675_100038536 | 3300026118 | Bacteria | 4460 |
| 145 | Ga0207683_10001186 | 3300026121 | Bacteria | 23608 |
| 146 | Ga0207683_10017677 | 3300026121 | Bacteria | 6080 |
| 147 | Ga0207428_10011721 | 3300027907 | Bacteria | 7731 |
| 148 | Ga0268264_10023544 | 3300028381 | Bacteria | 5021 |
| 149 | Ga0265330_10013464 | 3300031235 | Bacteria | 3811 |
| 150 | Ga0265339_10051514 | 3300031249 | Bacteria | 2246 |
| 151 | Ga0307508_10000001 | 3300031616 | Bacteria | 553635 |
| 152 | Ga0265314_10055496 | 3300031711 | Bacteria | 2734 |
| 153 | Ga0265314_10065564 | 3300031711 | Bacteria | 2452 |
| 154 | Ga0307416_100017129 | 3300032002 | Bacteria | 5058 |
| 155 | Ga0373945_0002421 | 3300035116 | Bacteria | 5853 |
| 156 | Ga0373954_0000084 | 3300035118 | Bacteria | 33354 |
| 157 | Ga0373956_0006845 | 3300035119 | Bacteria | 4576 |
| 158 | Ga0373956_0030962 | 3300035119 | Bacteria | 2341 |
| 159 | Ga0373946_0011781 | 3300035171 | Bacteria | 3269 |
| 160 | Ga0373924_0001985 | 3300035410 | Bacteria | 6802 |
| 161 | Ga0373924_0006555 | 3300035410 | Bacteria | 4175 |
| 162 | Ga0373931_0012254 | 3300035691 | Bacteria | 4152 |
| 163 | Ga0373927_0004884 | 3300035695 | Bacteria | 9317 |
| 164 | Ga0373927_0015400 | 3300035695 | Bacteria | 5054 |
| 165 | Ga0373933_0000105 | 3300035724 | Bacteria | 53488 |
| 166 | Ga0373937_0033827 | 3300036401 | Bacteria | 4646 |
| 167 | Ga0316584_0066631 | 3300036712 | Bacteria | 2698 |
| 168 | Ga0373925_0006010 | 3300037068 | Bacteria | 8989 |
| 169 | Ga0373925_0143860 | 3300037068 | Bacteria | 1868 |
| 170 | Ga0395905_0003515 | 3300037471 | Bacteria | 16709 |
| 171 | Ga0395905_0004424 | 3300037471 | Bacteria | 14604 |
| 172 | Ga0395905_0182293 | 3300037471 | Bacteria | 1971 |
| 173 | Ga0436360_0085165 | 3300039438 | Bacteria | 8407 |
| 174 | Ga0436360_1300535 | 3300039438 | Bacteria | 4394 |
| 175 | Ga0436361_0582192 | 3300039447 | Bacteria | 3845 |
| 176 | Ga0436361_0772948 | 3300039447 | Bacteria | 4377 |
| 177 | Ga0436361_0774340 | 3300039447 | Bacteria | 12095 |
| 178 | Ga0439453_0005576 | 3300041408 | Bacteria | 1923 |
| 179 | Ga0439451_014808 | 3300042009 | Bacteria | 1573 |
| 180 | Ga0451577_0011083 | 3300042876 | Bacteria | 8559 |
| 181 | Ga0453684_0011706 | 3300044712 | Bacteria | 14632 |
| 182 | Ga0451576_0001640 | 3300045051 | Bacteria | 37361 |
| 183 | Ga0451576_0055766 | 3300045051 | Bacteria | 4133 |
| 184 | Ga0451576_0187661 | 3300045051 | Bacteria | 2159 |
| 185 | Ga0495603_0011578 | 3300046455 | Bacteria | 5336 |
| 186 | Ga0495629_0007109 | 3300046459 | Bacteria | 8246 |
| 187 | Ga0495629_0022813 | 3300046459 | Bacteria | 4459 |
| 188 | Ga0495641_0021622 | 3300046461 | Bacteria | 3233 |
| 189 | Ga0495653_0001471 | 3300046463 | Bacteria | 18364 |
| 190 | Ga0495580_0033906 | 3300046472 | Bacteria | 3676 |
| 191 | Ga0495582_0007016 | 3300046473 | Bacteria | 6264 |
| 192 | Ga0495639_0003106 | 3300046475 | Bacteria | 7223 |
| 193 | Ga0495639_0019564 | 3300046475 | Bacteria | 2956 |
| 194 | Ga0495662_0012884 | 3300046476 | Bacteria | 4073 |
| 195 | Ga0495664_0008825 | 3300046477 | Bacteria | 5632 |
| 196 | Ga0495594_0017763 | 3300046499 | Bacteria | 3761 |
| 197 | Ga0495630_0045388 | 3300046517 | Bacteria | 3283 |
| 198 | Ga0495640_0014307 | 3300046533 | Bacteria | 6009 |
| 199 | Ga0495621_0011663 | 3300046539 | Bacteria | 2725 |
| 200 | Ga0495645_0102657 | 3300046543 | Bacteria | 2032 |
| 201 | Ga0495667_0010024 | 3300046559 | Bacteria | 6417 |
| 202 | Ga0495656_0021257 | 3300046615 | Bacteria | 2525 |
| 203 | Ga0495634_0007388 | 3300046642 | Bacteria | 8268 |
| 204 | Ga0495635_0000636 | 3300046663 | Bacteria | 22538 |
| 205 | Ga0495657_0065950 | 3300046675 | Bacteria | 2380 |
| 206 | Ga0495599_0003673 | 3300046678 | Bacteria | 8997 |
| 207 | Ga0495623_0017213 | 3300046679 | Bacteria | 4668 |
| 208 | Ga0495647_0008734 | 3300046681 | Bacteria | 3411 |
| 209 | Ga0495613_0023517 | 3300046689 | Bacteria | 4591 |
| 210 | Ga0495604_0003160 | 3300047317 | Bacteria | 13167 |
| 211 | Ga0495674_0006653 | 3300047319 | Bacteria | 11076 |
| 212 | Ga0495674_0047882 | 3300047319 | Bacteria | 3787 |
| 213 | Ga0495676_0028187 | 3300047321 | Bacteria | 4801 |
| 214 | Ga0495680_0001883 | 3300047322 | Bacteria | 22052 |
| 215 | Ga0495684_0000666 | 3300047471 | Bacteria | 27678 |
| 216 | Ga0495593_0005206 | 3300047673 | Bacteria | 7686 |
| 217 | Ga0495593_0022196 | 3300047673 | Bacteria | 3541 |
| 218 | Ga0495602_0042888 | 3300048088 | Bacteria | 4117 |
| 219 | Ga0496102_0005699 | 3300048905 | Bacteria | 10576 |
| 220 | Ga0496104_0021636 | 3300048907 | Bacteria | 5905 |
| 221 | Ga0496105_0001039 | 3300048908 | Bacteria | 19207 |
| 222 | Ga0496106_0012385 | 3300048909 | Bacteria | 6297 |
| 223 | Ga0496107_0112969 | 3300048910 | Bacteria | 1998 |
| 224 | Ga0496108_0005993 | 3300048911 | Bacteria | 9846 |
| 225 | Ga0496108_0052039 | 3300048911 | Bacteria | 3431 |
| 226 | Ga0496109_0003480 | 3300048912 | Bacteria | 13148 |
| 227 | Ga0496109_0026052 | 3300048912 | Bacteria | 5211 |
| 228 | Ga0496110_0009513 | 3300048913 | Bacteria | 7866 |
| 229 | Ga0496111_0001725 | 3300048914 | Bacteria | 12795 |
| 230 | Ga0496112_0012922 | 3300048915 | Bacteria | 7691 |
| 231 | Ga0496112_0241701 | 3300048915 | Bacteria | 1758 |
| 232 | Ga0496113_0000537 | 3300048916 | Bacteria | 18713 |
| 233 | Ga0496113_0006511 | 3300048916 | Bacteria | 7412 |
| 234 | Ga0496115_0038223 | 3300048918 | Bacteria | 3807 |
| 235 | Ga0496118_0017748 | 3300048921 | Bacteria | 6459 |
| 236 | Ga0496119_0067380 | 3300048922 | Bacteria | 2111 |
| 237 | Ga0496121_0023248 | 3300048924 | Bacteria | 5977 |
| 238 | Ga0501032_0033679 | 3300049569 | Bacteria | 3509 |
| 239 | Ga0501033_0000693 | 3300049570 | Bacteria | 31157 |
| 240 | Ga0501036_0014957 | 3300049572 | Bacteria | 6473 |
| 241 | Ga0501040_0000047 | 3300049576 | Bacteria | 55739 |
| 242 | Ga0501041_0000619 | 3300049577 | Bacteria | 18562 |
| 243 | Ga0501042_0000431 | 3300049578 | Bacteria | 21324 |
| 244 | Ga0501042_0029564 | 3300049578 | Bacteria | 3865 |
| 245 | Ga0501046_0001055 | 3300049580 | Bacteria | 26972 |
| 246 | Ga0501047_0059822 | 3300049581 | Bacteria | 3678 |
| 247 | Ga0501068_0015037 | 3300049584 | Bacteria | 4437 |
| 248 | Ga0501071_0012022 | 3300049587 | Bacteria | 5851 |
| 249 | Ga0501071_0063502 | 3300049587 | Bacteria | 2678 |
| 250 | Ga0501072_0001155 | 3300049588 | Bacteria | 19638 |
| 251 | Ga0501074_0038422 | 3300049590 | Bacteria | 3469 |
| 252 | Ga0501075_0000506 | 3300049591 | Bacteria | 23460 |
| 253 | Ga0501075_0007285 | 3300049591 | Bacteria | 7671 |
| 254 | Ga0501076_0000100 | 3300049592 | Bacteria | 46870 |
| 255 | Ga0501077_0000852 | 3300049593 | Bacteria | 18412 |
| 256 | Ga0501077_0021545 | 3300049593 | Bacteria | 4079 |
| 257 | Ga0501077_0061609 | 3300049593 | Bacteria | 2381 |
| 258 | Ga0501080_0104027 | 3300049742 | Bacteria | 2633 |
| 259 | Ga0501035_0074155 | 3300049822 | Bacteria | 3011 |
| 260 | Ga0501044_0065055 | 3300049823 | Bacteria | 3719 |
| 261 | nmdc:mga09592_568_c1 | 3300050508 | Bacteria | 28030 |
| 262 | nmdc:mga09592_8419_c1 | 3300050508 | Bacteria | 8385 |
| 263 | nmdc:mga0qj67_54479_c1 | 3300050509 | Bacteria | 3167 |
| 264 | nmdc:mga08y16_6916_c1 | 3300050511 | Bacteria | 11894 |
| 265 | nmdc:mga08y16_77267_c1 | 3300050511 | Bacteria | 3471 |
| 266 | nmdc:mga0n895_19762_c1 | 3300050512 | Bacteria | 6267 |
| 267 | nmdc:mga0n895_95529_c1 | 3300050512 | Bacteria | 2977 |
| 268 | nmdc:mga08x19_24429_c1 | 3300050514 | Bacteria | 3756 |
| 269 | Ga0495612_0007518 | 3300053078 | Bacteria | 4453 |
| 270 | Ga0495619_0004437 | 3300053085 | Bacteria | 8950 |
| 271 | Ga0495619_0049631 | 3300053085 | Bacteria | 2768 |
| 272 | Ga0500566_0000313 | 3300053094 | Bacteria | 26190 |
| 273 | Ga0500640_008092 | 3300053095 | Bacteria | 4136 |
| 274 | Ga0500572_000129 | 3300053111 | Bacteria | 25501 |
| 275 | Ga0500608_002838 | 3300053122 | Bacteria | 6401 |
| 276 | Ga0500559_0000440 | 3300053136 | Bacteria | 29510 |
| 277 | Ga0500559_0002043 | 3300053136 | Bacteria | 10798 |
| 278 | Ga0500603_000246 | 3300053150 | Bacteria | 14245 |
| 279 | Ga0500603_003832 | 3300053150 | Bacteria | 3219 |
| 280 | Ga0500630_000052 | 3300053159 | Bacteria | 34496 |
| 281 | Ga0500639_000123 | 3300053163 | Bacteria | 37026 |
| 282 | Ga0500636_0009215 | 3300053177 | Bacteria | 5736 |
| 283 | Ga0501084_0073310 | 3300054114 | Bacteria | 2867 |
| 284 | Ga0501082_0003521 | 3300060353 | Bacteria | 13678 |
| 285 | Ga0501082_0049156 | 3300060353 | Bacteria | 3636 |
| 286 | Ga0530510_0001307 | 3300061734 | Bacteria | 16640 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_0772948 | Ga0436361_0772948_2841_4352 | 503 |
| 2 | 3300039447 | Ga0436361_0774340 | Ga0436361_0774340_10559_12070 | 503 |
| 3 | 3300042009 | Ga0439451_014808 | Ga0439451_014808_24_1547 | 505 |
| 4 | 3300041408 | Ga0439453_0005576 | Ga0439453_0005576_14_1600 | 528 |
| 5 | 3300021441 | Ga0213871_10004743 | Ga0213871_100047432 | 539 |
| 6 | 3300039438 | Ga0436360_0085165 | Ga0436360_0085165_3877_5646 | 539 |
| 7 | 3300048915 | Ga0496112_0241701 | Ga0496112_0241701_124_1746 | 540 |
| 8 | 3300037068 | Ga0373925_0143860 | Ga0373925_0143860_21_1655 | 541 |
| 9 | 3300025928 | Ga0207700_10058697 | Ga0207700_100586973 | 542 |
| 10 | 3300025923 | Ga0207681_10071806 | Ga0207681_100718061 | 548 |
| 11 | 3300025931 | Ga0207644_10012751 | Ga0207644_100127515 | 551 |
| 12 | 3300035695 | Ga0373927_0004884 | Ga0373927_0004884_7099_8844 | 551 |
| 13 | 3300035724 | Ga0373933_0000105 | Ga0373933_0000105_10207_11952 | 551 |
| 14 | 3300049581 | Ga0501047_0059822 | Ga0501047_0059822_796_2592 | 552 |
| 15 | 3300049823 | Ga0501044_0065055 | Ga0501044_0065055_401_2197 | 552 |
| 16 | 3300014325 | Ga0163163_10055601 | Ga0163163_100556013 | 556 |
| 17 | 3300025303 | Ga0209051_1022341 | Ga0209051_10223411 | 556 |
| 18 | 3300031616 | Ga0307508_10000001 | Ga0307508_10000001342 | 557 |
| 19 | 3300005355 | Ga0070671_100018499 | Ga0070671_1000184994 | 558 |
| 20 | 3300013297 | Ga0157378_10005529 | Ga0157378_1000552910 | 558 |
| 21 | 3300025931 | Ga0207644_10026663 | Ga0207644_100266632 | 558 |
| 22 | 3300049593 | Ga0501077_0061609 | Ga0501077_0061609_446_2215 | 560 |
| 23 | 3300007076 | Ga0075435_100051008 | Ga0075435_1000510082 | 561 |
| 24 | 3300006871 | Ga0075434_100030885 | Ga0075434_1000308856 | 563 |
| 25 | 3300050512 | nmdc:mga0n895_19762_c1 | nmdc:mga0n895_19762_c1_1242_3005 | 563 |
| 26 | 3300053177 | Ga0500636_0009215 | Ga0500636_0009215_4029_5723 | 563 |
| 27 | 3300046543 | Ga0495645_0102657 | Ga0495645_0102657_104_1894 | 566 |
| 28 | 3300048922 | Ga0496119_0067380 | Ga0496119_0067380_23_1726 | 566 |
| 29 | 3300035118 | Ga0373954_0000084 | Ga0373954_0000084_2848_4707 | 567 |
| 30 | 3300035119 | Ga0373956_0006845 | Ga0373956_0006845_2202_4061 | 567 |
| 31 | 3300035410 | Ga0373924_0001985 | Ga0373924_0001985_1831_3690 | 567 |
| 32 | 3300046459 | Ga0495629_0007109 | Ga0495629_0007109_4813_6672 | 567 |
| 33 | 3300046463 | Ga0495653_0001471 | Ga0495653_0001471_1025_2884 | 567 |
| 34 | 3300046533 | Ga0495640_0014307 | Ga0495640_0014307_2737_4596 | 567 |
| 35 | 3300046559 | Ga0495667_0010024 | Ga0495667_0010024_338_2197 | 567 |
| 36 | 3300046642 | Ga0495634_0007388 | Ga0495634_0007388_6312_8171 | 567 |
| 37 | 3300046663 | Ga0495635_0000636 | Ga0495635_0000636_1934_3793 | 567 |
| 38 | 3300046678 | Ga0495599_0003673 | Ga0495599_0003673_4135_5994 | 567 |
| 39 | 3300046679 | Ga0495623_0017213 | Ga0495623_0017213_521_2380 | 567 |
| 40 | 3300047317 | Ga0495604_0003160 | Ga0495604_0003160_10971_12830 | 567 |
| 41 | 3300047319 | Ga0495674_0047882 | Ga0495674_0047882_1592_3451 | 567 |
| 42 | 3300047322 | Ga0495680_0001883 | Ga0495680_0001883_15609_17468 | 567 |
| 43 | 3300047471 | Ga0495684_0000666 | Ga0495684_0000666_4843_6702 | 567 |
| 44 | 3300047673 | Ga0495593_0005206 | Ga0495593_0005206_794_2653 | 567 |
| 45 | 3300048088 | Ga0495602_0042888 | Ga0495602_0042888_1458_3317 | 567 |
| 46 | 3300053085 | Ga0495619_0004437 | Ga0495619_0004437_5123_6982 | 567 |
| 47 | 3300046615 | Ga0495656_0021257 | Ga0495656_0021257_606_2357 | 568 |
| 48 | 3300032002 | Ga0307416_100017129 | Ga0307416_1000171292 | 570 |
| 49 | 3300005545 | Ga0070695_100030574 | Ga0070695_1000305744 | 573 |
| 50 | 3300009094 | Ga0111539_10029850 | Ga0111539_100298505 | 573 |
| 51 | 3300006844 | Ga0075428_100001908 | Ga0075428_1000019086 | 579 |
| 52 | 3300006880 | Ga0075429_100028246 | Ga0075429_1000282465 | 579 |
| 53 | 3300009094 | Ga0111539_10018988 | Ga0111539_100189883 | 579 |
| 54 | 3300027907 | Ga0207428_10011721 | Ga0207428_100117215 | 579 |
| 55 | 3300035691 | Ga0373931_0012254 | Ga0373931_0012254_1733_3502 | 579 |
| 56 | 3300039438 | Ga0436360_1300535 | Ga0436360_1300535_1029_2801 | 579 |
| 57 | 3300049569 | Ga0501032_0033679 | Ga0501032_0033679_290_2053 | 579 |
| 58 | 3300049570 | Ga0501033_0000693 | Ga0501033_0000693_9558_11321 | 579 |
| 59 | 3300049572 | Ga0501036_0014957 | Ga0501036_0014957_4181_5944 | 579 |
| 60 | 3300049576 | Ga0501040_0000047 | Ga0501040_0000047_40302_42065 | 579 |
| 61 | 3300049577 | Ga0501041_0000619 | Ga0501041_0000619_3788_5551 | 579 |
| 62 | 3300049578 | Ga0501042_0000431 | Ga0501042_0000431_7088_8851 | 579 |
| 63 | 3300049578 | Ga0501042_0029564 | Ga0501042_0029564_980_2749 | 579 |
| 64 | 3300049580 | Ga0501046_0001055 | Ga0501046_0001055_2421_4184 | 579 |
| 65 | 3300049584 | Ga0501068_0015037 | Ga0501068_0015037_1762_3531 | 579 |
| 66 | 3300049587 | Ga0501071_0012022 | Ga0501071_0012022_425_2188 | 579 |
| 67 | 3300049588 | Ga0501072_0001155 | Ga0501072_0001155_3675_5438 | 579 |
| 68 | 3300049590 | Ga0501074_0038422 | Ga0501074_0038422_619_2382 | 579 |
| 69 | 3300049591 | Ga0501075_0000506 | Ga0501075_0000506_12916_14679 | 579 |
| 70 | 3300049591 | Ga0501075_0007285 | Ga0501075_0007285_1055_2824 | 579 |
| 71 | 3300049592 | Ga0501076_0000100 | Ga0501076_0000100_13687_15450 | 579 |
| 72 | 3300049593 | Ga0501077_0000852 | Ga0501077_0000852_13372_15135 | 579 |
| 73 | 3300049593 | Ga0501077_0021545 | Ga0501077_0021545_1431_3200 | 579 |
| 74 | 3300049742 | Ga0501080_0104027 | Ga0501080_0104027_770_2533 | 579 |
| 75 | 3300049822 | Ga0501035_0074155 | Ga0501035_0074155_295_2064 | 579 |
| 76 | 3300050508 | nmdc:mga09592_8419_c1 | nmdc:mga09592_8419_c1_5734_7479 | 579 |
| 77 | 3300050511 | nmdc:mga08y16_6916_c1 | nmdc:mga08y16_6916_c1_6686_8431 | 579 |
| 78 | 3300054114 | Ga0501084_0073310 | Ga0501084_0073310_982_2751 | 579 |
| 79 | 3300060353 | Ga0501082_0003521 | Ga0501082_0003521_10108_11877 | 579 |
| 80 | 3300060353 | Ga0501082_0049156 | Ga0501082_0049156_1617_3380 | 579 |
| 81 | 3300061734 | Ga0530510_0001307 | Ga0530510_0001307_436_2199 | 579 |
| 82 | 3300005436 | Ga0070713_100000028 | Ga0070713_10000002846 | 580 |
| 83 | 3300006846 | Ga0075430_100118389 | Ga0075430_1001183892 | 580 |
| 84 | 3300031235 | Ga0265330_10013464 | Ga0265330_100134642 | 580 |
| 85 | 3300049587 | Ga0501071_0063502 | Ga0501071_0063502_286_2061 | 580 |
| 86 | 3300050508 | nmdc:mga09592_568_c1 | nmdc:mga09592_568_c1_5175_6971 | 580 |
| 87 | 3300050509 | nmdc:mga0qj67_54479_c1 | nmdc:mga0qj67_54479_c1_675_2471 | 580 |
| 88 | 3300005353 | Ga0070669_100080964 | Ga0070669_1000809642 | 583 |
| 89 | 3300006844 | Ga0075428_100059236 | Ga0075428_1000592365 | 583 |
| 90 | 3300025923 | Ga0207681_10085386 | Ga0207681_100853861 | 583 |
| 91 | 3300045051 | Ga0451576_0001640 | Ga0451576_0001640_19946_21775 | 583 |
| 92 | 3300050511 | nmdc:mga08y16_77267_c1 | nmdc:mga08y16_77267_c1_1214_2965 | 583 |
| 93 | iso_pu_bacteria | 2690315857 | 2691331067 | 583 |
| 94 | iso_pu_bacteria | 2919534386 | 2919534625 | 583 |
| 95 | 3300037471 | Ga0395905_0003515 | Ga0395905_0003515_13247_15061 | 585 |
| 96 | 3300006237 | Ga0097621_100033186 | Ga0097621_1000331865 | 587 |
| 97 | iso_pu_bacteria | 2846033681 | 2846035828 | 587 |
| 98 | iso_pu_bacteria | 2846037992 | 2846040374 | 587 |
| 99 | 3300037471 | Ga0395905_0182293 | Ga0395905_0182293_16_1833 | 588 |
| 100 | 3300045051 | Ga0451576_0055766 | Ga0451576_0055766_1624_3399 | 588 |
| 101 | 3300046539 | Ga0495621_0011663 | Ga0495621_0011663_37_1833 | 588 |
| 102 | 3300050512 | nmdc:mga0n895_95529_c1 | nmdc:mga0n895_95529_c1_1118_2917 | 588 |
| 103 | 3300050514 | nmdc:mga08x19_24429_c1 | nmdc:mga08x19_24429_c1_391_2190 | 588 |
| 104 | iso_pu_bacteria | 2547132103 | 2547372963 | 589 |
| 105 | iso_pu_bacteria | 2843690924 | 2843694027 | 589 |
| 106 | 3300005364 | Ga0070673_100013152 | Ga0070673_1000131525 | 592 |
| 107 | 3300005366 | Ga0070659_100009610 | Ga0070659_1000096107 | 592 |
| 108 | 3300005457 | Ga0070662_100000028 | Ga0070662_10000002873 | 592 |
| 109 | 3300005539 | Ga0068853_100004389 | Ga0068853_1000043894 | 592 |
| 110 | 3300005543 | Ga0070672_100053559 | Ga0070672_1000535592 | 592 |
| 111 | 3300005563 | Ga0068855_100007386 | Ga0068855_1000073867 | 592 |
| 112 | 3300005564 | Ga0070664_100006748 | Ga0070664_1000067486 | 592 |
| 113 | 3300005614 | Ga0068856_100004393 | Ga0068856_1000043937 | 592 |
| 114 | 3300013102 | Ga0157371_10000210 | Ga0157371_1000021027 | 592 |
| 115 | 3300013105 | Ga0157369_10069186 | Ga0157369_100691862 | 592 |
| 116 | 3300013307 | Ga0157372_10003657 | Ga0157372_100036576 | 592 |
| 117 | 3300025919 | Ga0207657_10000682 | Ga0207657_100006829 | 592 |
| 118 | 3300025932 | Ga0207690_10002006 | Ga0207690_1000200612 | 592 |
| 119 | 3300025933 | Ga0207706_10000114 | Ga0207706_1000011446 | 592 |
| 120 | 3300025945 | Ga0207679_10005560 | Ga0207679_100055604 | 592 |
| 121 | 3300025949 | Ga0207667_10007115 | Ga0207667_100071156 | 592 |
| 122 | 3300025960 | Ga0207651_10003811 | Ga0207651_100038115 | 592 |
| 123 | 3300026078 | Ga0207702_10007941 | Ga0207702_100079417 | 592 |
| 124 | 3300048905 | Ga0496102_0005699 | Ga0496102_0005699_7506_9308 | 592 |
| 125 | 3300048909 | Ga0496106_0012385 | Ga0496106_0012385_2207_4009 | 592 |
| 126 | 3300035116 | Ga0373945_0002421 | Ga0373945_0002421_3817_5601 | 593 |
| 127 | 3300036712 | Ga0316584_0066631 | Ga0316584_0066631_706_2493 | 593 |
| 128 | 3300046477 | Ga0495664_0008825 | Ga0495664_0008825_614_2398 | 593 |
| 129 | 3300048908 | Ga0496105_0001039 | Ga0496105_0001039_1805_3595 | 593 |
| 130 | 3300048911 | Ga0496108_0005993 | Ga0496108_0005993_7343_9133 | 593 |
| 131 | 3300048912 | Ga0496109_0026052 | Ga0496109_0026052_3396_5186 | 593 |
| 132 | 3300048915 | Ga0496112_0012922 | Ga0496112_0012922_1358_3148 | 593 |
| 133 | 3300048916 | Ga0496113_0000537 | Ga0496113_0000537_4107_5897 | 593 |
| 134 | 3300053150 | Ga0500603_003832 | Ga0500603_003832_708_2492 | 593 |
| 135 | 3300025942 | Ga0207689_10046871 | Ga0207689_100468713 | 594 |
| 136 | 3300025949 | Ga0207667_10105808 | Ga0207667_101058082 | 594 |
| 137 | 3300053094 | Ga0500566_0000313 | Ga0500566_0000313_5742_7562 | 594 |
| 138 | 3300053095 | Ga0500640_008092 | Ga0500640_008092_1062_2882 | 594 |
| 139 | 3300053111 | Ga0500572_000129 | Ga0500572_000129_5919_7739 | 594 |
| 140 | 3300053122 | Ga0500608_002838 | Ga0500608_002838_2207_4027 | 594 |
| 141 | 3300053136 | Ga0500559_0000440 | Ga0500559_0000440_23150_24958 | 594 |
| 142 | 3300053136 | Ga0500559_0002043 | Ga0500559_0002043_7442_9262 | 594 |
| 143 | 3300053150 | Ga0500603_000246 | Ga0500603_000246_7335_9155 | 594 |
| 144 | 3300053159 | Ga0500630_000052 | Ga0500630_000052_4309_6129 | 594 |
| 145 | 3300053163 | Ga0500639_000123 | Ga0500639_000123_28225_30045 | 594 |
| 146 | 3300005339 | Ga0070660_100028084 | Ga0070660_1000280843 | 595 |
| 147 | 3300005435 | Ga0070714_100072896 | Ga0070714_1000728962 | 595 |
| 148 | 3300005530 | Ga0070679_100034668 | Ga0070679_1000346683 | 595 |
| 149 | 3300005563 | Ga0068855_100015533 | Ga0068855_1000155335 | 595 |
| 150 | 3300025919 | Ga0207657_10038747 | Ga0207657_100387473 | 595 |
| 151 | 3300031711 | Ga0265314_10055496 | Ga0265314_100554962 | 595 |
| 152 | 3300042876 | Ga0451577_0011083 | Ga0451577_0011083_2229_4019 | 595 |
| 153 | 3300005468 | Ga0070707_100089387 | Ga0070707_1000893872 | 596 |
| 154 | 3300005471 | Ga0070698_100015099 | Ga0070698_1000150992 | 596 |
| 155 | 3300005564 | Ga0070664_100089790 | Ga0070664_1000897902 | 596 |
| 156 | 3300005614 | Ga0068856_100068638 | Ga0068856_1000686382 | 596 |
| 157 | 3300009174 | Ga0105241_10015571 | Ga0105241_100155713 | 596 |
| 158 | 3300009551 | Ga0105238_10011219 | Ga0105238_100112198 | 596 |
| 159 | 3300013307 | Ga0157372_10015272 | Ga0157372_100152722 | 596 |
| 160 | 3300021361 | Ga0213872_10014392 | Ga0213872_100143922 | 596 |
| 161 | 3300021361 | Ga0213872_10024620 | Ga0213872_100246202 | 596 |
| 162 | 3300025253 | Ga0209677_100592 | Ga0209677_10059213 | 596 |
| 163 | 3300025910 | Ga0207684_10035581 | Ga0207684_100355812 | 596 |
| 164 | 3300025924 | Ga0207694_10023295 | Ga0207694_100232953 | 596 |
| 165 | 3300025945 | Ga0207679_10102581 | Ga0207679_101025811 | 596 |
| 166 | 3300026095 | Ga0207676_10060025 | Ga0207676_100600252 | 596 |
| 167 | 3300035171 | Ga0373946_0011781 | Ga0373946_0011781_362_2155 | 596 |
| 168 | 3300035695 | Ga0373927_0015400 | Ga0373927_0015400_963_2762 | 596 |
| 169 | 3300036401 | Ga0373937_0033827 | Ga0373937_0033827_1870_3663 | 596 |
| 170 | 3300037471 | Ga0395905_0004424 | Ga0395905_0004424_3618_5408 | 596 |
| 171 | 3300039447 | Ga0436361_0582192 | Ga0436361_0582192_1376_3166 | 596 |
| 172 | 3300044712 | Ga0453684_0011706 | Ga0453684_0011706_1866_3656 | 596 |
| 173 | 3300045051 | Ga0451576_0187661 | Ga0451576_0187661_268_2058 | 596 |
| 174 | 3300046455 | Ga0495603_0011578 | Ga0495603_0011578_2120_3913 | 596 |
| 175 | 3300046459 | Ga0495629_0022813 | Ga0495629_0022813_1276_3069 | 596 |
| 176 | 3300046461 | Ga0495641_0021622 | Ga0495641_0021622_411_2204 | 596 |
| 177 | 3300046472 | Ga0495580_0033906 | Ga0495580_0033906_260_2053 | 596 |
| 178 | 3300046473 | Ga0495582_0007016 | Ga0495582_0007016_3220_5013 | 596 |
| 179 | 3300046475 | Ga0495639_0019564 | Ga0495639_0019564_134_1927 | 596 |
| 180 | 3300046476 | Ga0495662_0012884 | Ga0495662_0012884_896_2689 | 596 |
| 181 | 3300046499 | Ga0495594_0017763 | Ga0495594_0017763_520_2313 | 596 |
| 182 | 3300046517 | Ga0495630_0045388 | Ga0495630_0045388_1271_3064 | 596 |
| 183 | 3300046675 | Ga0495657_0065950 | Ga0495657_0065950_211_2004 | 596 |
| 184 | 3300046681 | Ga0495647_0008734 | Ga0495647_0008734_1176_2969 | 596 |
| 185 | 3300046689 | Ga0495613_0023517 | Ga0495613_0023517_1995_3788 | 596 |
| 186 | 3300047319 | Ga0495674_0006653 | Ga0495674_0006653_2980_4773 | 596 |
| 187 | 3300047321 | Ga0495676_0028187 | Ga0495676_0028187_2309_4102 | 596 |
| 188 | 3300048910 | Ga0496107_0112969 | Ga0496107_0112969_138_1928 | 596 |
| 189 | 3300048911 | Ga0496108_0052039 | Ga0496108_0052039_1398_3188 | 596 |
| 190 | 3300048912 | Ga0496109_0003480 | Ga0496109_0003480_3419_5209 | 596 |
| 191 | 3300048913 | Ga0496110_0009513 | Ga0496110_0009513_2205_3995 | 596 |
| 192 | 3300048914 | Ga0496111_0001725 | Ga0496111_0001725_8953_10743 | 596 |
| 193 | 3300048916 | Ga0496113_0006511 | Ga0496113_0006511_4939_6729 | 596 |
| 194 | 3300048921 | Ga0496118_0017748 | Ga0496118_0017748_2537_4330 | 596 |
| 195 | 3300048924 | Ga0496121_0023248 | Ga0496121_0023248_963_2756 | 596 |
| 196 | 3300053078 | Ga0495612_0007518 | Ga0495612_0007518_2184_3977 | 596 |
| 197 | 3300053085 | Ga0495619_0049631 | Ga0495619_0049631_379_2178 | 596 |
| 198 | 3300005330 | Ga0070690_100026833 | Ga0070690_1000268334 | 597 |
| 199 | 3300005347 | Ga0070668_100009541 | Ga0070668_1000095415 | 597 |
| 200 | 3300005355 | Ga0070671_100012882 | Ga0070671_1000128821 | 597 |
| 201 | 3300005364 | Ga0070673_100005848 | Ga0070673_1000058485 | 597 |
| 202 | 3300005365 | Ga0070688_100001719 | Ga0070688_1000017197 | 597 |
| 203 | 3300005437 | Ga0070710_10023008 | Ga0070710_100230082 | 597 |
| 204 | 3300005439 | Ga0070711_100027125 | Ga0070711_1000271253 | 597 |
| 205 | 3300005445 | Ga0070708_100000095 | Ga0070708_10000009533 | 597 |
| 206 | 3300005455 | Ga0070663_100059013 | Ga0070663_1000590132 | 597 |
| 207 | 3300005456 | Ga0070678_100002350 | Ga0070678_1000023507 | 597 |
| 208 | 3300005459 | Ga0068867_100000501 | Ga0068867_1000005017 | 597 |
| 209 | 3300005459 | Ga0068867_100023259 | Ga0068867_1000232594 | 597 |
| 210 | 3300005459 | Ga0068867_100067493 | Ga0068867_1000674932 | 597 |
| 211 | 3300005466 | Ga0070685_10062956 | Ga0070685_100629562 | 597 |
| 212 | 3300005543 | Ga0070672_100004378 | Ga0070672_1000043784 | 597 |
| 213 | 3300005547 | Ga0070693_100002721 | Ga0070693_1000027216 | 597 |
| 214 | 3300005548 | Ga0070665_100035877 | Ga0070665_1000358774 | 597 |
| 215 | 3300005617 | Ga0068859_100000518 | Ga0068859_1000005184 | 597 |
| 216 | 3300005718 | Ga0068866_10006129 | Ga0068866_100061292 | 597 |
| 217 | 3300005719 | Ga0068861_100024138 | Ga0068861_1000241383 | 597 |
| 218 | 3300005840 | Ga0068870_10023381 | Ga0068870_100233812 | 597 |
| 219 | 3300005841 | Ga0068863_100004210 | Ga0068863_10000421013 | 597 |
| 220 | 3300005842 | Ga0068858_100007654 | Ga0068858_1000076544 | 597 |
| 221 | 3300005842 | Ga0068858_100109404 | Ga0068858_1001094042 | 597 |
| 222 | 3300005843 | Ga0068860_100017155 | Ga0068860_1000171556 | 597 |
| 223 | 3300006881 | Ga0068865_100012581 | Ga0068865_1000125812 | 597 |
| 224 | 3300006931 | Ga0097620_100000518 | Ga0097620_10000051836 | 597 |
| 225 | 3300009148 | Ga0105243_10051211 | Ga0105243_100512112 | 597 |
| 226 | 3300009148 | Ga0105243_10056514 | Ga0105243_100565142 | 597 |
| 227 | 3300009176 | Ga0105242_10038116 | Ga0105242_100381162 | 597 |
| 228 | 3300009177 | Ga0105248_10095345 | Ga0105248_100953452 | 597 |
| 229 | 3300009551 | Ga0105238_10128244 | Ga0105238_101282442 | 597 |
| 230 | 3300013296 | Ga0157374_10055838 | Ga0157374_100558383 | 597 |
| 231 | 3300013296 | Ga0157374_10076146 | Ga0157374_100761463 | 597 |
| 232 | 3300013297 | Ga0157378_10005086 | Ga0157378_100050864 | 597 |
| 233 | 3300013306 | Ga0163162_10003443 | Ga0163162_100034433 | 597 |
| 234 | 3300013308 | Ga0157375_10055640 | Ga0157375_100556403 | 597 |
| 235 | 3300014326 | Ga0157380_10078584 | Ga0157380_100785843 | 597 |
| 236 | 3300014968 | Ga0157379_10090075 | Ga0157379_100900752 | 597 |
| 237 | 3300025899 | Ga0207642_10023312 | Ga0207642_100233122 | 597 |
| 238 | 3300025903 | Ga0207680_10009918 | Ga0207680_100099183 | 597 |
| 239 | 3300025915 | Ga0207693_10000236 | Ga0207693_1000023636 | 597 |
| 240 | 3300025916 | Ga0207663_10033365 | Ga0207663_100333652 | 597 |
| 241 | 3300025923 | Ga0207681_10083245 | Ga0207681_100832452 | 597 |
| 242 | 3300025927 | Ga0207687_10035626 | Ga0207687_100356263 | 597 |
| 243 | 3300025933 | Ga0207706_10015435 | Ga0207706_100154353 | 597 |
| 244 | 3300025934 | Ga0207686_10004032 | Ga0207686_100040323 | 597 |
| 245 | 3300025937 | Ga0207669_10027161 | Ga0207669_100271613 | 597 |
| 246 | 3300025986 | Ga0207658_10040554 | Ga0207658_100405543 | 597 |
| 247 | 3300026023 | Ga0207677_10009171 | Ga0207677_100091713 | 597 |
| 248 | 3300026035 | Ga0207703_10029840 | Ga0207703_100298402 | 597 |
| 249 | 3300026041 | Ga0207639_10033928 | Ga0207639_100339283 | 597 |
| 250 | 3300026078 | Ga0207702_10030145 | Ga0207702_100301455 | 597 |
| 251 | 3300026089 | Ga0207648_10004276 | Ga0207648_100042767 | 597 |
| 252 | 3300026089 | Ga0207648_10035587 | Ga0207648_100355875 | 597 |
| 253 | 3300026095 | Ga0207676_10009534 | Ga0207676_100095345 | 597 |
| 254 | 3300026118 | Ga0207675_100038536 | Ga0207675_1000385363 | 597 |
| 255 | 3300026121 | Ga0207683_10001186 | Ga0207683_100011869 | 597 |
| 256 | 3300035119 | Ga0373956_0030962 | Ga0373956_0030962_345_2141 | 597 |
| 257 | 3300035410 | Ga0373924_0006555 | Ga0373924_0006555_576_2372 | 597 |
| 258 | 3300046475 | Ga0495639_0003106 | Ga0495639_0003106_5402_7198 | 597 |
| 259 | 3300047673 | Ga0495593_0022196 | Ga0495593_0022196_105_1901 | 597 |
| 260 | 3300037068 | Ga0373925_0006010 | Ga0373925_0006010_7085_8887 | 599 |
| 261 | 3300031249 | Ga0265339_10051514 | Ga0265339_100515141 | 603 |
| 262 | 3300031711 | Ga0265314_10065564 | Ga0265314_100655641 | 603 |
| 263 | 3300014325 | Ga0163163_10021159 | Ga0163163_100211594 | 609 |
| 264 | 3300048907 | Ga0496104_0021636 | Ga0496104_0021636_283_2166 | 609 |
| 265 | 3300048918 | Ga0496115_0038223 | Ga0496115_0038223_186_2069 | 609 |
| 266 | 3300005293 | Ga0065715_10110308 | Ga0065715_101103082 | 610 |
| 267 | 3300005328 | Ga0070676_10041461 | Ga0070676_100414612 | 610 |
| 268 | 3300005330 | Ga0070690_100027602 | Ga0070690_1000276022 | 610 |
| 269 | 3300005334 | Ga0068869_100040928 | Ga0068869_1000409284 | 610 |
| 270 | 3300005338 | Ga0068868_100017290 | Ga0068868_1000172904 | 610 |
| 271 | 3300005343 | Ga0070687_100025768 | Ga0070687_1000257682 | 610 |
| 272 | 3300005355 | Ga0070671_100076938 | Ga0070671_1000769381 | 610 |
| 273 | 3300005466 | Ga0070685_10007520 | Ga0070685_100075206 | 610 |
| 274 | 3300005718 | Ga0068866_10004313 | Ga0068866_100043133 | 610 |
| 275 | 3300005841 | Ga0068863_100051756 | Ga0068863_1000517562 | 610 |
| 276 | 3300005843 | Ga0068860_100051416 | Ga0068860_1000514164 | 610 |
| 277 | 3300006358 | Ga0068871_100022815 | Ga0068871_1000228154 | 610 |
| 278 | 3300025893 | Ga0207682_10003443 | Ga0207682_100034435 | 610 |
| 279 | 3300025908 | Ga0207643_10030230 | Ga0207643_100302302 | 610 |
| 280 | 3300025925 | Ga0207650_10013558 | Ga0207650_100135584 | 610 |
| 281 | 3300025926 | Ga0207659_10035202 | Ga0207659_100352021 | 610 |
| 282 | 3300025931 | Ga0207644_10014884 | Ga0207644_100148844 | 610 |
| 283 | 3300025933 | Ga0207706_10047172 | Ga0207706_100471724 | 610 |
| 284 | 3300025938 | Ga0207704_10010256 | Ga0207704_100102563 | 610 |
| 285 | 3300025941 | Ga0207711_10036014 | Ga0207711_100360142 | 610 |
| 286 | 3300025942 | Ga0207689_10016148 | Ga0207689_100161482 | 610 |
| 287 | 3300026035 | Ga0207703_10047271 | Ga0207703_100472712 | 610 |
| 288 | 3300026075 | Ga0207708_10010719 | Ga0207708_100107194 | 610 |
| 289 | 3300026088 | Ga0207641_10037697 | Ga0207641_100376973 | 610 |
| 290 | 3300026095 | Ga0207676_10019786 | Ga0207676_100197862 | 610 |
| 291 | 3300026121 | Ga0207683_10017677 | Ga0207683_100176774 | 610 |
| 292 | 3300028381 | Ga0268264_10023544 | Ga0268264_100235444 | 610 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6awf-assembly2.cif.gz_E | escherichia coli quinol:fumarate reductase crystallized without dicarboxylate | 0.9488 | 14 | 588 |
| 6awf-assembly2.cif.gz_E | escherichia coli quinol:fumarate reductase crystallized without dicarboxylate | 0.9469 | 14 | 588 |
| 3dzb-assembly1.cif.gz_B | crystal structure of prephenate dehydrogenase from streptococcus thermophilus | 0.9425 | 20 | 51 |
| 3cir-assembly1.cif.gz_A | e. coli quinol fumarate reductase frda t234a mutation | 0.9419 | 14 | 588 |
| 3dzb-assembly1.cif.gz_A | crystal structure of prephenate dehydrogenase from streptococcus thermophilus | 0.9411 | 20 | 51 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0E3X3_17_318_3.50.50.100 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; | 0.981 | 20 | 52 | 3.50.50.100 |
| 1e7pA03 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain | 0.9646 | 435 | 547 | 1.20.58.100 |
| af_P00363_423_542_1.20.58.100 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain | 0.9643 | 435 | 553 | 1.20.58.100 |
| af_Q5A1E8_478_589_1.20.58.100 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain | 0.9602 | 445 | 547 | 1.20.58.100 |
| af_O53370_435_542_1.20.58.100 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain | 0.9602 | 446 | 549 | 1.20.58.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S9E1J2-F1-model_v4 | Fumarate reductase/succinate dehydrogenase flavoprotein-like C-terminal domain-containing protein | 0.9667 | 455 | 561 |
GO:0000104
GO:0005886 GO:0006113 GO:0009055 GO:0009061 GO:0050660 |
| AF-A0A7Y2UMI2-F1-model_v4 | Fumarate reductase/succinate dehydrogenase flavoprotein-like C-terminal domain-containing protein | 0.9515 | 449 | 580 |
GO:0000104
GO:0005886 GO:0009055 GO:0009061 GO:0050660 |
| AF-A0A2N2A581-F1-model_v4 | Fumarate reductase (Quinol) flavoprotein subunit | 0.9479 | 406 | 594 |
GO:0000104
GO:0005886 GO:0009055 GO:0009061 GO:0050660 |
| AF-A0A3B8HLU9-F1-model_v4 | Succinate dehydrogenase/fumarate reductase flavoprotein subunit | 0.9456 | 464 | 592 |
GO:0000104
GO:0005886 GO:0009055 GO:0009061 GO:0050660 |
| AF-A0A3C7WEM0-F1-model_v4 | Succinate dehydrogenase/fumarate reductase flavoprotein subunit | 0.9429 | 454 | 602 |
GO:0000104
GO:0005886 GO:0009055 GO:0009061 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar