F390936

General Info

Members Datasets Scaffolds Average Seq Length
292 220 286 592

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10021159|Ga0163163_100211594
Length 627
Sequence LNVNGTGGRCHFADSIVARADGPPRSKAVKVMVVDIAIVGAGGAGLRAAIAAAEADPALNIVLVSKVYPMRSHTVAAEGGSAGVTQRHDSLEHHFNDTVTGGEWLCDQDVVDYFVAHCTEEMVRLEHWGCPWSRLADGHVNVRAFGGMKIERTWFAADKTGFHILHTLFQTSIKYPAITRLDEHFCTALVVDDGRCYGVVAIDISSGEFTFVAAKAVVIATGGAGRVFLQNTNGGIVTGDGMAMVYRHGVALRDMEFVQYHPTCMPGSGLLFTEACRGEGGILTNKDGYRYLQDYGLGPPDPWPRNKAMELGPRDRLSQAFWHEERKGRTIATRNGAAVNLDLRHLGAKKLRERLPQICELAESFLGIDPAERPVPVRPAVHYTMGGILVNRETASTLTGLYAVGECSSIGIHGANRLGSNSLAELGVFGKVAGEAAARCARSLPPGPMATLKKQADDVRRRAVDLIRNEAGGERLAVLRDAMAQSMETGCGIYRLDAQMKQTCHTLAELKNRYRRLRLDDTSRAWNTEWLAAIELGYQLDVAQAMAHSAFARKESRGAHSRLDGFEQRDDANFLKHTLAVYRADGPPAISYMPVNITRSAPGKRAYGAEGEHLEGYRKEQTQGTNP

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
3 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
4 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
5 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
6 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
135 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
210 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
211 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
212 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
215 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
216 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 0
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.45
Nodule 0
Rhizoplane 5.48
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10110308 3300005293 Bacteria 2599
2 Ga0070676_10041461 3300005328 Bacteria 2670
3 Ga0070690_100026833 3300005330 Bacteria 3556
4 Ga0070690_100027602 3300005330 Bacteria 3509
5 Ga0068869_100040928 3300005334 Bacteria 3315
6 Ga0068868_100017290 3300005338 Bacteria 5369
7 Ga0070660_100028084 3300005339 Bacteria 4207
8 Ga0070687_100025768 3300005343 Bacteria 2825
9 Ga0070668_100009541 3300005347 Bacteria 7202
10 Ga0070669_100080964 3300005353 Bacteria 2418
11 Ga0070671_100012882 3300005355 Bacteria 6741
12 Ga0070671_100018499 3300005355 Bacteria 5660
13 Ga0070671_100076938 3300005355 Bacteria 2788
14 Ga0070673_100005848 3300005364 Bacteria 7930
15 Ga0070673_100013152 3300005364 Bacteria 5712
16 Ga0070688_100001719 3300005365 Bacteria 10924
17 Ga0070659_100009610 3300005366 Bacteria 7109
18 Ga0070714_100072896 3300005435 Bacteria 2974
19 Ga0070713_100000028 3300005436 Bacteria 93227
20 Ga0070710_10023008 3300005437 Bacteria 3269
21 Ga0070711_100027125 3300005439 Bacteria 3758
22 Ga0070708_100000095 3300005445 Bacteria 58224
23 Ga0070663_100059013 3300005455 Bacteria 2757
24 Ga0070678_100002350 3300005456 Bacteria 10334
25 Ga0070662_100000028 3300005457 Bacteria 83508
26 Ga0068867_100000501 3300005459 Bacteria 26078
27 Ga0068867_100023259 3300005459 Bacteria 4436
28 Ga0068867_100067493 3300005459 Bacteria 2667
29 Ga0070685_10007520 3300005466 Bacteria 5577
30 Ga0070685_10062956 3300005466 Bacteria 2176
31 Ga0070707_100089387 3300005468 Bacteria 2981
32 Ga0070698_100015099 3300005471 Bacteria 8165
33 Ga0070679_100034668 3300005530 Bacteria 5002
34 Ga0068853_100004389 3300005539 Bacteria 10921
35 Ga0070672_100004378 3300005543 Bacteria 9247
36 Ga0070672_100053559 3300005543 Bacteria 3155
37 Ga0070695_100030574 3300005545 Bacteria 3354
38 Ga0070693_100002721 3300005547 Bacteria 8130
39 Ga0070665_100035877 3300005548 Bacteria 4989
40 Ga0068855_100007386 3300005563 Bacteria 13303
41 Ga0068855_100015533 3300005563 Bacteria 9166
42 Ga0070664_100006748 3300005564 Bacteria 9255
43 Ga0070664_100089790 3300005564 Bacteria 2659
44 Ga0068856_100004393 3300005614 Bacteria 14050
45 Ga0068856_100068638 3300005614 Bacteria 3505
46 Ga0068859_100000518 3300005617 Bacteria 38274
47 Ga0068866_10004313 3300005718 Bacteria 5839
48 Ga0068866_10006129 3300005718 Bacteria 5002
49 Ga0068861_100024138 3300005719 Bacteria 4394
50 Ga0068870_10023381 3300005840 Bacteria 3047
51 Ga0068863_100004210 3300005841 Bacteria 14209
52 Ga0068863_100051756 3300005841 Bacteria 3891
53 Ga0068858_100007654 3300005842 Bacteria 10434
54 Ga0068858_100109404 3300005842 Bacteria 2580
55 Ga0068860_100017155 3300005843 Bacteria 7058
56 Ga0068860_100051416 3300005843 Bacteria 3921
57 Ga0097621_100033186 3300006237 Bacteria 4109
58 Ga0068871_100022815 3300006358 Bacteria 4831
59 Ga0075428_100001908 3300006844 Bacteria 22367
60 Ga0075428_100059236 3300006844 Bacteria 4193
61 Ga0075430_100118389 3300006846 Bacteria 2208
62 Ga0075434_100030885 3300006871 Bacteria 5279
63 Ga0075429_100028246 3300006880 Bacteria 4871
64 Ga0068865_100012581 3300006881 Bacteria 5331
65 Ga0097620_100000518 3300006931 Bacteria 38274
66 Ga0075435_100051008 3300007076 Bacteria 3331
67 Ga0111539_10018988 3300009094 Bacteria 8499
68 Ga0111539_10029850 3300009094 Bacteria 6634
69 Ga0105243_10051211 3300009148 Bacteria 3265
70 Ga0105243_10056514 3300009148 Bacteria 3122
71 Ga0105241_10015571 3300009174 Bacteria 5573
72 Ga0105242_10038116 3300009176 Bacteria 3863
73 Ga0105248_10095345 3300009177 Bacteria 3350
74 Ga0105238_10011219 3300009551 Bacteria 9016
75 Ga0105238_10128244 3300009551 Bacteria 2515
76 Ga0157371_10000210 3300013102 Bacteria 84791
77 Ga0157369_10069186 3300013105 Bacteria 3793
78 Ga0157374_10055838 3300013296 Bacteria 3687
79 Ga0157374_10076146 3300013296 Bacteria 3172
80 Ga0157378_10005086 3300013297 Bacteria 11555
81 Ga0157378_10005529 3300013297 Bacteria 11066
82 Ga0163162_10003443 3300013306 Bacteria 15110
83 Ga0157372_10003657 3300013307 Bacteria 16524
84 Ga0157372_10015272 3300013307 Bacteria 8225
85 Ga0157375_10055640 3300013308 Bacteria 3902
86 Ga0163163_10021159 3300014325 Bacteria 6136
87 Ga0163163_10055601 3300014325 Bacteria 3912
88 Ga0157380_10078584 3300014326 Bacteria 2692
89 Ga0157379_10090075 3300014968 Bacteria 2752
90 Ga0213872_10014392 3300021361 Bacteria 3691
91 Ga0213872_10024620 3300021361 Bacteria 2769
92 Ga0213871_10004743 3300021441 Bacteria 2747
93 Ga0209677_100592 3300025253 Bacteria 19729
94 Ga0209051_1022341 3300025303 Bacteria 2665
95 Ga0207682_10003443 3300025893 Bacteria 6875
96 Ga0207642_10023312 3300025899 Bacteria 2470
97 Ga0207680_10009918 3300025903 Bacteria 4744
98 Ga0207643_10030230 3300025908 Bacteria 3013
99 Ga0207684_10035581 3300025910 Bacteria 4228
100 Ga0207693_10000236 3300025915 Bacteria 50870
101 Ga0207663_10033365 3300025916 Bacteria 3066
102 Ga0207657_10000682 3300025919 Bacteria 36172
103 Ga0207657_10038747 3300025919 Bacteria 4239
104 Ga0207681_10071806 3300025923 Bacteria 2416
105 Ga0207681_10083245 3300025923 Bacteria 2264
106 Ga0207681_10085386 3300025923 Bacteria 2240
107 Ga0207694_10023295 3300025924 Bacteria 4701
108 Ga0207650_10013558 3300025925 Bacteria 5647
109 Ga0207659_10035202 3300025926 Bacteria 3459
110 Ga0207687_10035626 3300025927 Bacteria 3386
111 Ga0207700_10058697 3300025928 Bacteria 2908
112 Ga0207644_10012751 3300025931 Bacteria 5589
113 Ga0207644_10014884 3300025931 Bacteria 5214
114 Ga0207644_10026663 3300025931 Bacteria 3985
115 Ga0207690_10002006 3300025932 Bacteria 12465
116 Ga0207706_10000114 3300025933 Bacteria 86582
117 Ga0207706_10015435 3300025933 Bacteria 6900
118 Ga0207706_10047172 3300025933 Bacteria 3813
119 Ga0207686_10004032 3300025934 Bacteria 7879
120 Ga0207669_10027161 3300025937 Bacteria 3128
121 Ga0207704_10010256 3300025938 Bacteria 4561
122 Ga0207711_10036014 3300025941 Bacteria 4197
123 Ga0207689_10016148 3300025942 Bacteria 6322
124 Ga0207689_10046871 3300025942 Bacteria 3571
125 Ga0207679_10005560 3300025945 Bacteria 7898
126 Ga0207679_10102581 3300025945 Bacteria 2240
127 Ga0207667_10007115 3300025949 Bacteria 13503
128 Ga0207667_10105808 3300025949 Bacteria 2903
129 Ga0207651_10003811 3300025960 Bacteria 7473
130 Ga0207658_10040554 3300025986 Bacteria 3366
131 Ga0207677_10009171 3300026023 Bacteria 5556
132 Ga0207703_10029840 3300026035 Bacteria 4305
133 Ga0207703_10047271 3300026035 Bacteria 3469
134 Ga0207639_10033928 3300026041 Bacteria 3769
135 Ga0207708_10010719 3300026075 Bacteria 6813
136 Ga0207702_10007941 3300026078 Bacteria 8991
137 Ga0207702_10030145 3300026078 Bacteria 4519
138 Ga0207641_10037697 3300026088 Bacteria 4038
139 Ga0207648_10004276 3300026089 Bacteria 14725
140 Ga0207648_10035587 3300026089 Bacteria 4387
141 Ga0207676_10009534 3300026095 Bacteria 6910
142 Ga0207676_10019786 3300026095 Bacteria 4916
143 Ga0207676_10060025 3300026095 Bacteria 3006
144 Ga0207675_100038536 3300026118 Bacteria 4460
145 Ga0207683_10001186 3300026121 Bacteria 23608
146 Ga0207683_10017677 3300026121 Bacteria 6080
147 Ga0207428_10011721 3300027907 Bacteria 7731
148 Ga0268264_10023544 3300028381 Bacteria 5021
149 Ga0265330_10013464 3300031235 Bacteria 3811
150 Ga0265339_10051514 3300031249 Bacteria 2246
151 Ga0307508_10000001 3300031616 Bacteria 553635
152 Ga0265314_10055496 3300031711 Bacteria 2734
153 Ga0265314_10065564 3300031711 Bacteria 2452
154 Ga0307416_100017129 3300032002 Bacteria 5058
155 Ga0373945_0002421 3300035116 Bacteria 5853
156 Ga0373954_0000084 3300035118 Bacteria 33354
157 Ga0373956_0006845 3300035119 Bacteria 4576
158 Ga0373956_0030962 3300035119 Bacteria 2341
159 Ga0373946_0011781 3300035171 Bacteria 3269
160 Ga0373924_0001985 3300035410 Bacteria 6802
161 Ga0373924_0006555 3300035410 Bacteria 4175
162 Ga0373931_0012254 3300035691 Bacteria 4152
163 Ga0373927_0004884 3300035695 Bacteria 9317
164 Ga0373927_0015400 3300035695 Bacteria 5054
165 Ga0373933_0000105 3300035724 Bacteria 53488
166 Ga0373937_0033827 3300036401 Bacteria 4646
167 Ga0316584_0066631 3300036712 Bacteria 2698
168 Ga0373925_0006010 3300037068 Bacteria 8989
169 Ga0373925_0143860 3300037068 Bacteria 1868
170 Ga0395905_0003515 3300037471 Bacteria 16709
171 Ga0395905_0004424 3300037471 Bacteria 14604
172 Ga0395905_0182293 3300037471 Bacteria 1971
173 Ga0436360_0085165 3300039438 Bacteria 8407
174 Ga0436360_1300535 3300039438 Bacteria 4394
175 Ga0436361_0582192 3300039447 Bacteria 3845
176 Ga0436361_0772948 3300039447 Bacteria 4377
177 Ga0436361_0774340 3300039447 Bacteria 12095
178 Ga0439453_0005576 3300041408 Bacteria 1923
179 Ga0439451_014808 3300042009 Bacteria 1573
180 Ga0451577_0011083 3300042876 Bacteria 8559
181 Ga0453684_0011706 3300044712 Bacteria 14632
182 Ga0451576_0001640 3300045051 Bacteria 37361
183 Ga0451576_0055766 3300045051 Bacteria 4133
184 Ga0451576_0187661 3300045051 Bacteria 2159
185 Ga0495603_0011578 3300046455 Bacteria 5336
186 Ga0495629_0007109 3300046459 Bacteria 8246
187 Ga0495629_0022813 3300046459 Bacteria 4459
188 Ga0495641_0021622 3300046461 Bacteria 3233
189 Ga0495653_0001471 3300046463 Bacteria 18364
190 Ga0495580_0033906 3300046472 Bacteria 3676
191 Ga0495582_0007016 3300046473 Bacteria 6264
192 Ga0495639_0003106 3300046475 Bacteria 7223
193 Ga0495639_0019564 3300046475 Bacteria 2956
194 Ga0495662_0012884 3300046476 Bacteria 4073
195 Ga0495664_0008825 3300046477 Bacteria 5632
196 Ga0495594_0017763 3300046499 Bacteria 3761
197 Ga0495630_0045388 3300046517 Bacteria 3283
198 Ga0495640_0014307 3300046533 Bacteria 6009
199 Ga0495621_0011663 3300046539 Bacteria 2725
200 Ga0495645_0102657 3300046543 Bacteria 2032
201 Ga0495667_0010024 3300046559 Bacteria 6417
202 Ga0495656_0021257 3300046615 Bacteria 2525
203 Ga0495634_0007388 3300046642 Bacteria 8268
204 Ga0495635_0000636 3300046663 Bacteria 22538
205 Ga0495657_0065950 3300046675 Bacteria 2380
206 Ga0495599_0003673 3300046678 Bacteria 8997
207 Ga0495623_0017213 3300046679 Bacteria 4668
208 Ga0495647_0008734 3300046681 Bacteria 3411
209 Ga0495613_0023517 3300046689 Bacteria 4591
210 Ga0495604_0003160 3300047317 Bacteria 13167
211 Ga0495674_0006653 3300047319 Bacteria 11076
212 Ga0495674_0047882 3300047319 Bacteria 3787
213 Ga0495676_0028187 3300047321 Bacteria 4801
214 Ga0495680_0001883 3300047322 Bacteria 22052
215 Ga0495684_0000666 3300047471 Bacteria 27678
216 Ga0495593_0005206 3300047673 Bacteria 7686
217 Ga0495593_0022196 3300047673 Bacteria 3541
218 Ga0495602_0042888 3300048088 Bacteria 4117
219 Ga0496102_0005699 3300048905 Bacteria 10576
220 Ga0496104_0021636 3300048907 Bacteria 5905
221 Ga0496105_0001039 3300048908 Bacteria 19207
222 Ga0496106_0012385 3300048909 Bacteria 6297
223 Ga0496107_0112969 3300048910 Bacteria 1998
224 Ga0496108_0005993 3300048911 Bacteria 9846
225 Ga0496108_0052039 3300048911 Bacteria 3431
226 Ga0496109_0003480 3300048912 Bacteria 13148
227 Ga0496109_0026052 3300048912 Bacteria 5211
228 Ga0496110_0009513 3300048913 Bacteria 7866
229 Ga0496111_0001725 3300048914 Bacteria 12795
230 Ga0496112_0012922 3300048915 Bacteria 7691
231 Ga0496112_0241701 3300048915 Bacteria 1758
232 Ga0496113_0000537 3300048916 Bacteria 18713
233 Ga0496113_0006511 3300048916 Bacteria 7412
234 Ga0496115_0038223 3300048918 Bacteria 3807
235 Ga0496118_0017748 3300048921 Bacteria 6459
236 Ga0496119_0067380 3300048922 Bacteria 2111
237 Ga0496121_0023248 3300048924 Bacteria 5977
238 Ga0501032_0033679 3300049569 Bacteria 3509
239 Ga0501033_0000693 3300049570 Bacteria 31157
240 Ga0501036_0014957 3300049572 Bacteria 6473
241 Ga0501040_0000047 3300049576 Bacteria 55739
242 Ga0501041_0000619 3300049577 Bacteria 18562
243 Ga0501042_0000431 3300049578 Bacteria 21324
244 Ga0501042_0029564 3300049578 Bacteria 3865
245 Ga0501046_0001055 3300049580 Bacteria 26972
246 Ga0501047_0059822 3300049581 Bacteria 3678
247 Ga0501068_0015037 3300049584 Bacteria 4437
248 Ga0501071_0012022 3300049587 Bacteria 5851
249 Ga0501071_0063502 3300049587 Bacteria 2678
250 Ga0501072_0001155 3300049588 Bacteria 19638
251 Ga0501074_0038422 3300049590 Bacteria 3469
252 Ga0501075_0000506 3300049591 Bacteria 23460
253 Ga0501075_0007285 3300049591 Bacteria 7671
254 Ga0501076_0000100 3300049592 Bacteria 46870
255 Ga0501077_0000852 3300049593 Bacteria 18412
256 Ga0501077_0021545 3300049593 Bacteria 4079
257 Ga0501077_0061609 3300049593 Bacteria 2381
258 Ga0501080_0104027 3300049742 Bacteria 2633
259 Ga0501035_0074155 3300049822 Bacteria 3011
260 Ga0501044_0065055 3300049823 Bacteria 3719
261 nmdc:mga09592_568_c1 3300050508 Bacteria 28030
262 nmdc:mga09592_8419_c1 3300050508 Bacteria 8385
263 nmdc:mga0qj67_54479_c1 3300050509 Bacteria 3167
264 nmdc:mga08y16_6916_c1 3300050511 Bacteria 11894
265 nmdc:mga08y16_77267_c1 3300050511 Bacteria 3471
266 nmdc:mga0n895_19762_c1 3300050512 Bacteria 6267
267 nmdc:mga0n895_95529_c1 3300050512 Bacteria 2977
268 nmdc:mga08x19_24429_c1 3300050514 Bacteria 3756
269 Ga0495612_0007518 3300053078 Bacteria 4453
270 Ga0495619_0004437 3300053085 Bacteria 8950
271 Ga0495619_0049631 3300053085 Bacteria 2768
272 Ga0500566_0000313 3300053094 Bacteria 26190
273 Ga0500640_008092 3300053095 Bacteria 4136
274 Ga0500572_000129 3300053111 Bacteria 25501
275 Ga0500608_002838 3300053122 Bacteria 6401
276 Ga0500559_0000440 3300053136 Bacteria 29510
277 Ga0500559_0002043 3300053136 Bacteria 10798
278 Ga0500603_000246 3300053150 Bacteria 14245
279 Ga0500603_003832 3300053150 Bacteria 3219
280 Ga0500630_000052 3300053159 Bacteria 34496
281 Ga0500639_000123 3300053163 Bacteria 37026
282 Ga0500636_0009215 3300053177 Bacteria 5736
283 Ga0501084_0073310 3300054114 Bacteria 2867
284 Ga0501082_0003521 3300060353 Bacteria 13678
285 Ga0501082_0049156 3300060353 Bacteria 3636
286 Ga0530510_0001307 3300061734 Bacteria 16640

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0772948 Ga0436361_0772948_2841_4352 503
2 3300039447 Ga0436361_0774340 Ga0436361_0774340_10559_12070 503
3 3300042009 Ga0439451_014808 Ga0439451_014808_24_1547 505
4 3300041408 Ga0439453_0005576 Ga0439453_0005576_14_1600 528
5 3300021441 Ga0213871_10004743 Ga0213871_100047432 539
6 3300039438 Ga0436360_0085165 Ga0436360_0085165_3877_5646 539
7 3300048915 Ga0496112_0241701 Ga0496112_0241701_124_1746 540
8 3300037068 Ga0373925_0143860 Ga0373925_0143860_21_1655 541
9 3300025928 Ga0207700_10058697 Ga0207700_100586973 542
10 3300025923 Ga0207681_10071806 Ga0207681_100718061 548
11 3300025931 Ga0207644_10012751 Ga0207644_100127515 551
12 3300035695 Ga0373927_0004884 Ga0373927_0004884_7099_8844 551
13 3300035724 Ga0373933_0000105 Ga0373933_0000105_10207_11952 551
14 3300049581 Ga0501047_0059822 Ga0501047_0059822_796_2592 552
15 3300049823 Ga0501044_0065055 Ga0501044_0065055_401_2197 552
16 3300014325 Ga0163163_10055601 Ga0163163_100556013 556
17 3300025303 Ga0209051_1022341 Ga0209051_10223411 556
18 3300031616 Ga0307508_10000001 Ga0307508_10000001342 557
19 3300005355 Ga0070671_100018499 Ga0070671_1000184994 558
20 3300013297 Ga0157378_10005529 Ga0157378_1000552910 558
21 3300025931 Ga0207644_10026663 Ga0207644_100266632 558
22 3300049593 Ga0501077_0061609 Ga0501077_0061609_446_2215 560
23 3300007076 Ga0075435_100051008 Ga0075435_1000510082 561
24 3300006871 Ga0075434_100030885 Ga0075434_1000308856 563
25 3300050512 nmdc:mga0n895_19762_c1 nmdc:mga0n895_19762_c1_1242_3005 563
26 3300053177 Ga0500636_0009215 Ga0500636_0009215_4029_5723 563
27 3300046543 Ga0495645_0102657 Ga0495645_0102657_104_1894 566
28 3300048922 Ga0496119_0067380 Ga0496119_0067380_23_1726 566
29 3300035118 Ga0373954_0000084 Ga0373954_0000084_2848_4707 567
30 3300035119 Ga0373956_0006845 Ga0373956_0006845_2202_4061 567
31 3300035410 Ga0373924_0001985 Ga0373924_0001985_1831_3690 567
32 3300046459 Ga0495629_0007109 Ga0495629_0007109_4813_6672 567
33 3300046463 Ga0495653_0001471 Ga0495653_0001471_1025_2884 567
34 3300046533 Ga0495640_0014307 Ga0495640_0014307_2737_4596 567
35 3300046559 Ga0495667_0010024 Ga0495667_0010024_338_2197 567
36 3300046642 Ga0495634_0007388 Ga0495634_0007388_6312_8171 567
37 3300046663 Ga0495635_0000636 Ga0495635_0000636_1934_3793 567
38 3300046678 Ga0495599_0003673 Ga0495599_0003673_4135_5994 567
39 3300046679 Ga0495623_0017213 Ga0495623_0017213_521_2380 567
40 3300047317 Ga0495604_0003160 Ga0495604_0003160_10971_12830 567
41 3300047319 Ga0495674_0047882 Ga0495674_0047882_1592_3451 567
42 3300047322 Ga0495680_0001883 Ga0495680_0001883_15609_17468 567
43 3300047471 Ga0495684_0000666 Ga0495684_0000666_4843_6702 567
44 3300047673 Ga0495593_0005206 Ga0495593_0005206_794_2653 567
45 3300048088 Ga0495602_0042888 Ga0495602_0042888_1458_3317 567
46 3300053085 Ga0495619_0004437 Ga0495619_0004437_5123_6982 567
47 3300046615 Ga0495656_0021257 Ga0495656_0021257_606_2357 568
48 3300032002 Ga0307416_100017129 Ga0307416_1000171292 570
49 3300005545 Ga0070695_100030574 Ga0070695_1000305744 573
50 3300009094 Ga0111539_10029850 Ga0111539_100298505 573
51 3300006844 Ga0075428_100001908 Ga0075428_1000019086 579
52 3300006880 Ga0075429_100028246 Ga0075429_1000282465 579
53 3300009094 Ga0111539_10018988 Ga0111539_100189883 579
54 3300027907 Ga0207428_10011721 Ga0207428_100117215 579
55 3300035691 Ga0373931_0012254 Ga0373931_0012254_1733_3502 579
56 3300039438 Ga0436360_1300535 Ga0436360_1300535_1029_2801 579
57 3300049569 Ga0501032_0033679 Ga0501032_0033679_290_2053 579
58 3300049570 Ga0501033_0000693 Ga0501033_0000693_9558_11321 579
59 3300049572 Ga0501036_0014957 Ga0501036_0014957_4181_5944 579
60 3300049576 Ga0501040_0000047 Ga0501040_0000047_40302_42065 579
61 3300049577 Ga0501041_0000619 Ga0501041_0000619_3788_5551 579
62 3300049578 Ga0501042_0000431 Ga0501042_0000431_7088_8851 579
63 3300049578 Ga0501042_0029564 Ga0501042_0029564_980_2749 579
64 3300049580 Ga0501046_0001055 Ga0501046_0001055_2421_4184 579
65 3300049584 Ga0501068_0015037 Ga0501068_0015037_1762_3531 579
66 3300049587 Ga0501071_0012022 Ga0501071_0012022_425_2188 579
67 3300049588 Ga0501072_0001155 Ga0501072_0001155_3675_5438 579
68 3300049590 Ga0501074_0038422 Ga0501074_0038422_619_2382 579
69 3300049591 Ga0501075_0000506 Ga0501075_0000506_12916_14679 579
70 3300049591 Ga0501075_0007285 Ga0501075_0007285_1055_2824 579
71 3300049592 Ga0501076_0000100 Ga0501076_0000100_13687_15450 579
72 3300049593 Ga0501077_0000852 Ga0501077_0000852_13372_15135 579
73 3300049593 Ga0501077_0021545 Ga0501077_0021545_1431_3200 579
74 3300049742 Ga0501080_0104027 Ga0501080_0104027_770_2533 579
75 3300049822 Ga0501035_0074155 Ga0501035_0074155_295_2064 579
76 3300050508 nmdc:mga09592_8419_c1 nmdc:mga09592_8419_c1_5734_7479 579
77 3300050511 nmdc:mga08y16_6916_c1 nmdc:mga08y16_6916_c1_6686_8431 579
78 3300054114 Ga0501084_0073310 Ga0501084_0073310_982_2751 579
79 3300060353 Ga0501082_0003521 Ga0501082_0003521_10108_11877 579
80 3300060353 Ga0501082_0049156 Ga0501082_0049156_1617_3380 579
81 3300061734 Ga0530510_0001307 Ga0530510_0001307_436_2199 579
82 3300005436 Ga0070713_100000028 Ga0070713_10000002846 580
83 3300006846 Ga0075430_100118389 Ga0075430_1001183892 580
84 3300031235 Ga0265330_10013464 Ga0265330_100134642 580
85 3300049587 Ga0501071_0063502 Ga0501071_0063502_286_2061 580
86 3300050508 nmdc:mga09592_568_c1 nmdc:mga09592_568_c1_5175_6971 580
87 3300050509 nmdc:mga0qj67_54479_c1 nmdc:mga0qj67_54479_c1_675_2471 580
88 3300005353 Ga0070669_100080964 Ga0070669_1000809642 583
89 3300006844 Ga0075428_100059236 Ga0075428_1000592365 583
90 3300025923 Ga0207681_10085386 Ga0207681_100853861 583
91 3300045051 Ga0451576_0001640 Ga0451576_0001640_19946_21775 583
92 3300050511 nmdc:mga08y16_77267_c1 nmdc:mga08y16_77267_c1_1214_2965 583
93 iso_pu_bacteria 2690315857 2691331067 583
94 iso_pu_bacteria 2919534386 2919534625 583
95 3300037471 Ga0395905_0003515 Ga0395905_0003515_13247_15061 585
96 3300006237 Ga0097621_100033186 Ga0097621_1000331865 587
97 iso_pu_bacteria 2846033681 2846035828 587
98 iso_pu_bacteria 2846037992 2846040374 587
99 3300037471 Ga0395905_0182293 Ga0395905_0182293_16_1833 588
100 3300045051 Ga0451576_0055766 Ga0451576_0055766_1624_3399 588
101 3300046539 Ga0495621_0011663 Ga0495621_0011663_37_1833 588
102 3300050512 nmdc:mga0n895_95529_c1 nmdc:mga0n895_95529_c1_1118_2917 588
103 3300050514 nmdc:mga08x19_24429_c1 nmdc:mga08x19_24429_c1_391_2190 588
104 iso_pu_bacteria 2547132103 2547372963 589
105 iso_pu_bacteria 2843690924 2843694027 589
106 3300005364 Ga0070673_100013152 Ga0070673_1000131525 592
107 3300005366 Ga0070659_100009610 Ga0070659_1000096107 592
108 3300005457 Ga0070662_100000028 Ga0070662_10000002873 592
109 3300005539 Ga0068853_100004389 Ga0068853_1000043894 592
110 3300005543 Ga0070672_100053559 Ga0070672_1000535592 592
111 3300005563 Ga0068855_100007386 Ga0068855_1000073867 592
112 3300005564 Ga0070664_100006748 Ga0070664_1000067486 592
113 3300005614 Ga0068856_100004393 Ga0068856_1000043937 592
114 3300013102 Ga0157371_10000210 Ga0157371_1000021027 592
115 3300013105 Ga0157369_10069186 Ga0157369_100691862 592
116 3300013307 Ga0157372_10003657 Ga0157372_100036576 592
117 3300025919 Ga0207657_10000682 Ga0207657_100006829 592
118 3300025932 Ga0207690_10002006 Ga0207690_1000200612 592
119 3300025933 Ga0207706_10000114 Ga0207706_1000011446 592
120 3300025945 Ga0207679_10005560 Ga0207679_100055604 592
121 3300025949 Ga0207667_10007115 Ga0207667_100071156 592
122 3300025960 Ga0207651_10003811 Ga0207651_100038115 592
123 3300026078 Ga0207702_10007941 Ga0207702_100079417 592
124 3300048905 Ga0496102_0005699 Ga0496102_0005699_7506_9308 592
125 3300048909 Ga0496106_0012385 Ga0496106_0012385_2207_4009 592
126 3300035116 Ga0373945_0002421 Ga0373945_0002421_3817_5601 593
127 3300036712 Ga0316584_0066631 Ga0316584_0066631_706_2493 593
128 3300046477 Ga0495664_0008825 Ga0495664_0008825_614_2398 593
129 3300048908 Ga0496105_0001039 Ga0496105_0001039_1805_3595 593
130 3300048911 Ga0496108_0005993 Ga0496108_0005993_7343_9133 593
131 3300048912 Ga0496109_0026052 Ga0496109_0026052_3396_5186 593
132 3300048915 Ga0496112_0012922 Ga0496112_0012922_1358_3148 593
133 3300048916 Ga0496113_0000537 Ga0496113_0000537_4107_5897 593
134 3300053150 Ga0500603_003832 Ga0500603_003832_708_2492 593
135 3300025942 Ga0207689_10046871 Ga0207689_100468713 594
136 3300025949 Ga0207667_10105808 Ga0207667_101058082 594
137 3300053094 Ga0500566_0000313 Ga0500566_0000313_5742_7562 594
138 3300053095 Ga0500640_008092 Ga0500640_008092_1062_2882 594
139 3300053111 Ga0500572_000129 Ga0500572_000129_5919_7739 594
140 3300053122 Ga0500608_002838 Ga0500608_002838_2207_4027 594
141 3300053136 Ga0500559_0000440 Ga0500559_0000440_23150_24958 594
142 3300053136 Ga0500559_0002043 Ga0500559_0002043_7442_9262 594
143 3300053150 Ga0500603_000246 Ga0500603_000246_7335_9155 594
144 3300053159 Ga0500630_000052 Ga0500630_000052_4309_6129 594
145 3300053163 Ga0500639_000123 Ga0500639_000123_28225_30045 594
146 3300005339 Ga0070660_100028084 Ga0070660_1000280843 595
147 3300005435 Ga0070714_100072896 Ga0070714_1000728962 595
148 3300005530 Ga0070679_100034668 Ga0070679_1000346683 595
149 3300005563 Ga0068855_100015533 Ga0068855_1000155335 595
150 3300025919 Ga0207657_10038747 Ga0207657_100387473 595
151 3300031711 Ga0265314_10055496 Ga0265314_100554962 595
152 3300042876 Ga0451577_0011083 Ga0451577_0011083_2229_4019 595
153 3300005468 Ga0070707_100089387 Ga0070707_1000893872 596
154 3300005471 Ga0070698_100015099 Ga0070698_1000150992 596
155 3300005564 Ga0070664_100089790 Ga0070664_1000897902 596
156 3300005614 Ga0068856_100068638 Ga0068856_1000686382 596
157 3300009174 Ga0105241_10015571 Ga0105241_100155713 596
158 3300009551 Ga0105238_10011219 Ga0105238_100112198 596
159 3300013307 Ga0157372_10015272 Ga0157372_100152722 596
160 3300021361 Ga0213872_10014392 Ga0213872_100143922 596
161 3300021361 Ga0213872_10024620 Ga0213872_100246202 596
162 3300025253 Ga0209677_100592 Ga0209677_10059213 596
163 3300025910 Ga0207684_10035581 Ga0207684_100355812 596
164 3300025924 Ga0207694_10023295 Ga0207694_100232953 596
165 3300025945 Ga0207679_10102581 Ga0207679_101025811 596
166 3300026095 Ga0207676_10060025 Ga0207676_100600252 596
167 3300035171 Ga0373946_0011781 Ga0373946_0011781_362_2155 596
168 3300035695 Ga0373927_0015400 Ga0373927_0015400_963_2762 596
169 3300036401 Ga0373937_0033827 Ga0373937_0033827_1870_3663 596
170 3300037471 Ga0395905_0004424 Ga0395905_0004424_3618_5408 596
171 3300039447 Ga0436361_0582192 Ga0436361_0582192_1376_3166 596
172 3300044712 Ga0453684_0011706 Ga0453684_0011706_1866_3656 596
173 3300045051 Ga0451576_0187661 Ga0451576_0187661_268_2058 596
174 3300046455 Ga0495603_0011578 Ga0495603_0011578_2120_3913 596
175 3300046459 Ga0495629_0022813 Ga0495629_0022813_1276_3069 596
176 3300046461 Ga0495641_0021622 Ga0495641_0021622_411_2204 596
177 3300046472 Ga0495580_0033906 Ga0495580_0033906_260_2053 596
178 3300046473 Ga0495582_0007016 Ga0495582_0007016_3220_5013 596
179 3300046475 Ga0495639_0019564 Ga0495639_0019564_134_1927 596
180 3300046476 Ga0495662_0012884 Ga0495662_0012884_896_2689 596
181 3300046499 Ga0495594_0017763 Ga0495594_0017763_520_2313 596
182 3300046517 Ga0495630_0045388 Ga0495630_0045388_1271_3064 596
183 3300046675 Ga0495657_0065950 Ga0495657_0065950_211_2004 596
184 3300046681 Ga0495647_0008734 Ga0495647_0008734_1176_2969 596
185 3300046689 Ga0495613_0023517 Ga0495613_0023517_1995_3788 596
186 3300047319 Ga0495674_0006653 Ga0495674_0006653_2980_4773 596
187 3300047321 Ga0495676_0028187 Ga0495676_0028187_2309_4102 596
188 3300048910 Ga0496107_0112969 Ga0496107_0112969_138_1928 596
189 3300048911 Ga0496108_0052039 Ga0496108_0052039_1398_3188 596
190 3300048912 Ga0496109_0003480 Ga0496109_0003480_3419_5209 596
191 3300048913 Ga0496110_0009513 Ga0496110_0009513_2205_3995 596
192 3300048914 Ga0496111_0001725 Ga0496111_0001725_8953_10743 596
193 3300048916 Ga0496113_0006511 Ga0496113_0006511_4939_6729 596
194 3300048921 Ga0496118_0017748 Ga0496118_0017748_2537_4330 596
195 3300048924 Ga0496121_0023248 Ga0496121_0023248_963_2756 596
196 3300053078 Ga0495612_0007518 Ga0495612_0007518_2184_3977 596
197 3300053085 Ga0495619_0049631 Ga0495619_0049631_379_2178 596
198 3300005330 Ga0070690_100026833 Ga0070690_1000268334 597
199 3300005347 Ga0070668_100009541 Ga0070668_1000095415 597
200 3300005355 Ga0070671_100012882 Ga0070671_1000128821 597
201 3300005364 Ga0070673_100005848 Ga0070673_1000058485 597
202 3300005365 Ga0070688_100001719 Ga0070688_1000017197 597
203 3300005437 Ga0070710_10023008 Ga0070710_100230082 597
204 3300005439 Ga0070711_100027125 Ga0070711_1000271253 597
205 3300005445 Ga0070708_100000095 Ga0070708_10000009533 597
206 3300005455 Ga0070663_100059013 Ga0070663_1000590132 597
207 3300005456 Ga0070678_100002350 Ga0070678_1000023507 597
208 3300005459 Ga0068867_100000501 Ga0068867_1000005017 597
209 3300005459 Ga0068867_100023259 Ga0068867_1000232594 597
210 3300005459 Ga0068867_100067493 Ga0068867_1000674932 597
211 3300005466 Ga0070685_10062956 Ga0070685_100629562 597
212 3300005543 Ga0070672_100004378 Ga0070672_1000043784 597
213 3300005547 Ga0070693_100002721 Ga0070693_1000027216 597
214 3300005548 Ga0070665_100035877 Ga0070665_1000358774 597
215 3300005617 Ga0068859_100000518 Ga0068859_1000005184 597
216 3300005718 Ga0068866_10006129 Ga0068866_100061292 597
217 3300005719 Ga0068861_100024138 Ga0068861_1000241383 597
218 3300005840 Ga0068870_10023381 Ga0068870_100233812 597
219 3300005841 Ga0068863_100004210 Ga0068863_10000421013 597
220 3300005842 Ga0068858_100007654 Ga0068858_1000076544 597
221 3300005842 Ga0068858_100109404 Ga0068858_1001094042 597
222 3300005843 Ga0068860_100017155 Ga0068860_1000171556 597
223 3300006881 Ga0068865_100012581 Ga0068865_1000125812 597
224 3300006931 Ga0097620_100000518 Ga0097620_10000051836 597
225 3300009148 Ga0105243_10051211 Ga0105243_100512112 597
226 3300009148 Ga0105243_10056514 Ga0105243_100565142 597
227 3300009176 Ga0105242_10038116 Ga0105242_100381162 597
228 3300009177 Ga0105248_10095345 Ga0105248_100953452 597
229 3300009551 Ga0105238_10128244 Ga0105238_101282442 597
230 3300013296 Ga0157374_10055838 Ga0157374_100558383 597
231 3300013296 Ga0157374_10076146 Ga0157374_100761463 597
232 3300013297 Ga0157378_10005086 Ga0157378_100050864 597
233 3300013306 Ga0163162_10003443 Ga0163162_100034433 597
234 3300013308 Ga0157375_10055640 Ga0157375_100556403 597
235 3300014326 Ga0157380_10078584 Ga0157380_100785843 597
236 3300014968 Ga0157379_10090075 Ga0157379_100900752 597
237 3300025899 Ga0207642_10023312 Ga0207642_100233122 597
238 3300025903 Ga0207680_10009918 Ga0207680_100099183 597
239 3300025915 Ga0207693_10000236 Ga0207693_1000023636 597
240 3300025916 Ga0207663_10033365 Ga0207663_100333652 597
241 3300025923 Ga0207681_10083245 Ga0207681_100832452 597
242 3300025927 Ga0207687_10035626 Ga0207687_100356263 597
243 3300025933 Ga0207706_10015435 Ga0207706_100154353 597
244 3300025934 Ga0207686_10004032 Ga0207686_100040323 597
245 3300025937 Ga0207669_10027161 Ga0207669_100271613 597
246 3300025986 Ga0207658_10040554 Ga0207658_100405543 597
247 3300026023 Ga0207677_10009171 Ga0207677_100091713 597
248 3300026035 Ga0207703_10029840 Ga0207703_100298402 597
249 3300026041 Ga0207639_10033928 Ga0207639_100339283 597
250 3300026078 Ga0207702_10030145 Ga0207702_100301455 597
251 3300026089 Ga0207648_10004276 Ga0207648_100042767 597
252 3300026089 Ga0207648_10035587 Ga0207648_100355875 597
253 3300026095 Ga0207676_10009534 Ga0207676_100095345 597
254 3300026118 Ga0207675_100038536 Ga0207675_1000385363 597
255 3300026121 Ga0207683_10001186 Ga0207683_100011869 597
256 3300035119 Ga0373956_0030962 Ga0373956_0030962_345_2141 597
257 3300035410 Ga0373924_0006555 Ga0373924_0006555_576_2372 597
258 3300046475 Ga0495639_0003106 Ga0495639_0003106_5402_7198 597
259 3300047673 Ga0495593_0022196 Ga0495593_0022196_105_1901 597
260 3300037068 Ga0373925_0006010 Ga0373925_0006010_7085_8887 599
261 3300031249 Ga0265339_10051514 Ga0265339_100515141 603
262 3300031711 Ga0265314_10065564 Ga0265314_100655641 603
263 3300014325 Ga0163163_10021159 Ga0163163_100211594 609
264 3300048907 Ga0496104_0021636 Ga0496104_0021636_283_2166 609
265 3300048918 Ga0496115_0038223 Ga0496115_0038223_186_2069 609
266 3300005293 Ga0065715_10110308 Ga0065715_101103082 610
267 3300005328 Ga0070676_10041461 Ga0070676_100414612 610
268 3300005330 Ga0070690_100027602 Ga0070690_1000276022 610
269 3300005334 Ga0068869_100040928 Ga0068869_1000409284 610
270 3300005338 Ga0068868_100017290 Ga0068868_1000172904 610
271 3300005343 Ga0070687_100025768 Ga0070687_1000257682 610
272 3300005355 Ga0070671_100076938 Ga0070671_1000769381 610
273 3300005466 Ga0070685_10007520 Ga0070685_100075206 610
274 3300005718 Ga0068866_10004313 Ga0068866_100043133 610
275 3300005841 Ga0068863_100051756 Ga0068863_1000517562 610
276 3300005843 Ga0068860_100051416 Ga0068860_1000514164 610
277 3300006358 Ga0068871_100022815 Ga0068871_1000228154 610
278 3300025893 Ga0207682_10003443 Ga0207682_100034435 610
279 3300025908 Ga0207643_10030230 Ga0207643_100302302 610
280 3300025925 Ga0207650_10013558 Ga0207650_100135584 610
281 3300025926 Ga0207659_10035202 Ga0207659_100352021 610
282 3300025931 Ga0207644_10014884 Ga0207644_100148844 610
283 3300025933 Ga0207706_10047172 Ga0207706_100471724 610
284 3300025938 Ga0207704_10010256 Ga0207704_100102563 610
285 3300025941 Ga0207711_10036014 Ga0207711_100360142 610
286 3300025942 Ga0207689_10016148 Ga0207689_100161482 610
287 3300026035 Ga0207703_10047271 Ga0207703_100472712 610
288 3300026075 Ga0207708_10010719 Ga0207708_100107194 610
289 3300026088 Ga0207641_10037697 Ga0207641_100376973 610
290 3300026095 Ga0207676_10019786 Ga0207676_100197862 610
291 3300026121 Ga0207683_10017677 Ga0207683_100176774 610
292 3300028381 Ga0268264_10023544 Ga0268264_100235444 610

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

35

423

0.97

PF02910

Succ_DH_flav_C

Fumarate reductase flavoprotein C-term

480

607

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6awf-assembly2.cif.gz_E escherichia coli quinol:fumarate reductase crystallized without dicarboxylate 0.9488 14 588
6awf-assembly2.cif.gz_E escherichia coli quinol:fumarate reductase crystallized without dicarboxylate 0.9469 14 588
3dzb-assembly1.cif.gz_B crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.9425 20 51
3cir-assembly1.cif.gz_A e. coli quinol fumarate reductase frda t234a mutation 0.9419 14 588
3dzb-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.9411 20 51
ID Description Score Start End Superfamily
af_Q0E3X3_17_318_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.981 20 52 3.50.50.100
1e7pA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9646 435 547 1.20.58.100
af_P00363_423_542_1.20.58.100 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9643 435 553 1.20.58.100
af_Q5A1E8_478_589_1.20.58.100 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9602 445 547 1.20.58.100
af_O53370_435_542_1.20.58.100 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9602 446 549 1.20.58.100
ID Description Score Start End GO Terms
AF-A0A7S9E1J2-F1-model_v4 Fumarate reductase/succinate dehydrogenase flavoprotein-like C-terminal domain-containing protein 0.9667 455 561 GO:0000104
GO:0005886
GO:0006113
GO:0009055
GO:0009061
GO:0050660
AF-A0A7Y2UMI2-F1-model_v4 Fumarate reductase/succinate dehydrogenase flavoprotein-like C-terminal domain-containing protein 0.9515 449 580 GO:0000104
GO:0005886
GO:0009055
GO:0009061
GO:0050660
AF-A0A2N2A581-F1-model_v4 Fumarate reductase (Quinol) flavoprotein subunit 0.9479 406 594 GO:0000104
GO:0005886
GO:0009055
GO:0009061
GO:0050660
AF-A0A3B8HLU9-F1-model_v4 Succinate dehydrogenase/fumarate reductase flavoprotein subunit 0.9456 464 592 GO:0000104
GO:0005886
GO:0009055
GO:0009061
GO:0050660
AF-A0A3C7WEM0-F1-model_v4 Succinate dehydrogenase/fumarate reductase flavoprotein subunit 0.9429 454 602 GO:0000104
GO:0005886
GO:0009055
GO:0009061
GO:0050660

Feature Viewer

pLDDT pTM Quality
81.5 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map