F391114

General Info

Members Datasets Scaffolds Average Seq Length
292 206 277 142

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0045985|Ga0495605_0045985_1256_1741
Length 161
Sequence MVDPERPHGAPIGANATMKYLHAMLRVHDLDATSTFFTQGLGLKETHRKESQAGRFTLVYFGAPENPEAEVELTYNWPAEDGVVEDYGSARNFGHLAFEVDDIYATCAHLQAMGIVINRPPRDGHMAFVRSPDLISIELLQKGGALPPSEPWASMPNTGVW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2643221591 Devosia sp. Root685 Isolate Unclassified
6 2643221695 Lysobacter sp. Root494 Isolate Unclassified
7 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
8 2818991457 Xanthomonas translucens 569 Isolate Unclassified
9 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
10 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
11 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
12 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
13 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
14 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
141 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
148 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
205 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
206 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.47
Metatranscriptomes 2.4
Isolates 5.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0.34
Rhizoplane 3.77
Rhizosphere 82.53
Stem 0
Stem Tuber 0
Unclassified 11.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2777537 2162886007 Bacteria 1497
2 MBSR1b_contig_2473481 2162886012 Bacteria 1069
3 JGI24736J21556_1006250 3300001904 Bacteria 2008
4 JGI24740J21852_10005548 3300001979 Bacteria 5315
5 rootH1_10078607 3300003316 Bacteria 1351
6 rootH2_10018900 3300003320 Bacteria 2505
7 rootH2_10021741 3300003320 Bacteria 9254
8 rootH1_10098282 3300003323 Bacteria 1402
9 rootH1_10164417 3300003323 Bacteria 2887
10 Ga0055531_10006914 3300003794 Bacteria 6318
11 Ga0055531_10010520 3300003794 Bacteria 4585
12 Ga0058692_1000045 3300003856 Bacteria 115083
13 Ga0065704_10136630 3300005289 Bacteria 1563
14 Ga0065704_10154515 3300005289 Bacteria 1402
15 Ga0065712_10069163 3300005290 Bacteria 7849
16 Ga0065715_10099678 3300005293 Bacteria 3382
17 Ga0070658_10139873 3300005327 Bacteria 2022
18 Ga0070658_10722639 3300005327 Bacteria 865
19 Ga0070683_100160779 3300005329 Bacteria 2131
20 Ga0070683_100305543 3300005329 Bacteria 1513
21 Ga0070683_100357048 3300005329 Bacteria 1392
22 Ga0070670_100001880 3300005331 Bacteria 17138
23 Ga0070670_100019597 3300005331 Bacteria 5807
24 Ga0070677_10215334 3300005333 Bacteria 935
25 Ga0070666_10016569 3300005335 Bacteria 4716
26 Ga0070680_100019193 3300005336 Bacteria 5417
27 Ga0070680_100027328 3300005336 Bacteria 4569
28 Ga0070682_100111762 3300005337 Bacteria 1822
29 Ga0070682_100166042 3300005337 Bacteria 1529
30 Ga0070682_100704534 3300005337 Bacteria 810
31 Ga0070682_101686117 3300005337 Bacteria 550
32 Ga0070660_100001754 3300005339 Bacteria 14877
33 Ga0070660_100084835 3300005339 Bacteria 2490
34 Ga0070691_10001365 3300005341 Bacteria 10419
35 Ga0070691_10071844 3300005341 Bacteria 1680
36 Ga0070661_100023394 3300005344 Bacteria 4427
37 Ga0070661_100037197 3300005344 Bacteria 3540
38 Ga0070692_10035130 3300005345 Bacteria 2536
39 Ga0070668_100128443 3300005347 Bacteria 2032
40 Ga0070675_100027084 3300005354 Bacteria 4604
41 Ga0070671_100001083 3300005355 Bacteria 20150
42 Ga0070673_100003519 3300005364 Bacteria 9762
43 Ga0070659_100090032 3300005366 Bacteria 2458
44 Ga0070659_100523474 3300005366 Bacteria 1013
45 Ga0070667_100010941 3300005367 Bacteria 7505
46 Ga0070663_100074040 3300005455 Bacteria 2486
47 Ga0070663_100225620 3300005455 Bacteria 1473
48 Ga0070681_10085502 3300005458 Bacteria 3106
49 Ga0070681_10127721 3300005458 Bacteria 2475
50 Ga0070679_100119483 3300005530 Bacteria 2620
51 Ga0070679_100373635 3300005530 Bacteria 1372
52 Ga0070684_100141862 3300005535 Bacteria 2172
53 Ga0068853_100030024 3300005539 Bacteria 4588
54 Ga0068853_100390968 3300005539 Bacteria 1300
55 Ga0070672_100003201 3300005543 Bacteria 10594
56 Ga0070696_100069503 3300005546 Bacteria 2475
57 Ga0070665_100353558 3300005548 Bacteria 1475
58 Ga0070665_100358388 3300005548 Bacteria 1464
59 Ga0068855_100037437 3300005563 Bacteria 5768
60 Ga0070664_100002846 3300005564 Bacteria 13995
61 Ga0070664_100057253 3300005564 Bacteria 3313
62 Ga0068857_100287766 3300005577 Bacteria 1513
63 Ga0068859_102311853 3300005617 Bacteria 593
64 Ga0068864_100021777 3300005618 Bacteria 5370
65 Ga0068870_10298002 3300005840 Bacteria 1017
66 Ga0081539_10152219 3300005985 Bacteria 1111
67 Ga0068871_100241372 3300006358 Bacteria 1571
68 Ga0097620_102311978 3300006931 Bacteria 593
69 Ga0105251_10004729 3300009011 Bacteria 9127
70 Ga0105240_10168694 3300009093 Bacteria 2594
71 Ga0105240_10290397 3300009093 Bacteria 1875
72 Ga0105243_10020458 3300009148 Bacteria 5018
73 Ga0105243_11021672 3300009148 Bacteria 831
74 Ga0105241_10314405 3300009174 Bacteria 1348
75 Ga0105248_10001364 3300009177 Bacteria 27266
76 Ga0105237_10004010 3300009545 Bacteria 17216
77 Ga0105238_10007572 3300009551 Bacteria 10880
78 Ga0105028_110740 3300009993 Bacteria 962
79 Ga0157373_10164129 3300013100 Bacteria 1563
80 Ga0157371_10033231 3300013102 Bacteria 3708
81 Ga0157370_10012444 3300013104 Bacteria 8822
82 Ga0157370_10434548 3300013104 Bacteria 1207
83 Ga0157372_10108533 3300013307 Bacteria 3177
84 Ga0157372_10280803 3300013307 Bacteria 1936
85 Ga0157375_10022297 3300013308 Bacteria 5826
86 Ga0163163_10146388 3300014325 Bacteria 2406
87 Ga0157380_10037940 3300014326 Bacteria 3738
88 Ga0182005_1098821 3300015265 Bacteria 816
89 Ga0163161_10102893 3300017792 Bacteria 2128
90 Ga0206356_10003094 3300020070 Bacteria 5103
91 Ga0206351_10171413 3300020077 Bacteria 1332
92 Ga0206352_10265849 3300020078 Bacteria 3529
93 Ga0206354_11003205 3300020081 Bacteria 2736
94 Ga0206353_11008563 3300020082 Bacteria 4871
95 Ga0154015_1468556 3300020610 Bacteria 4675
96 Ga0213871_10061544 3300021441 Bacteria 1046
97 Ga0224712_10216576 3300022467 Bacteria 875
98 Ga0209677_103724 3300025253 Bacteria 4770
99 Ga0209564_1017005 3300025295 Bacteria 2862
100 Ga0209257_1000091 3300025304 Bacteria 270637
101 Ga0207697_10426409 3300025315 Bacteria 589
102 Ga0207713_1004463 3300025735 Bacteria 9066
103 Ga0207680_10020234 3300025903 Bacteria 3577
104 Ga0207647_10002143 3300025904 Bacteria 15080
105 Ga0207645_11068693 3300025907 Bacteria 545
106 Ga0207705_10000425 3300025909 Bacteria 36857
107 Ga0207705_10004563 3300025909 Bacteria 10460
108 Ga0207705_10020771 3300025909 Bacteria 4687
109 Ga0207654_10099313 3300025911 Bacteria 1790
110 Ga0207654_10838110 3300025911 Bacteria 665
111 Ga0207707_10004320 3300025912 Bacteria 12581
112 Ga0207707_10068820 3300025912 Bacteria 3085
113 Ga0207695_10062744 3300025913 Bacteria 3835
114 Ga0207695_10174849 3300025913 Bacteria 2070
115 Ga0207671_10002252 3300025914 Bacteria 20883
116 Ga0207660_10007082 3300025917 Bacteria 7263
117 Ga0207660_10008193 3300025917 Bacteria 6763
118 Ga0207657_10000446 3300025919 Bacteria 43822
119 Ga0207657_10148443 3300025919 Bacteria 1911
120 Ga0207649_10097446 3300025920 Bacteria 1939
121 Ga0207649_10176817 3300025920 Bacteria 1491
122 Ga0207649_10401754 3300025920 Bacteria 1025
123 Ga0207652_10007132 3300025921 Bacteria 9013
124 Ga0207652_10007939 3300025921 Bacteria 8522
125 Ga0207681_10185848 3300025923 Bacteria 1586
126 Ga0207650_10001425 3300025925 Bacteria 17234
127 Ga0207650_10012550 3300025925 Bacteria 5846
128 Ga0207650_10076427 3300025925 Bacteria 2530
129 Ga0207659_10001814 3300025926 Bacteria 12637
130 Ga0207644_10004480 3300025931 Bacteria 9068
131 Ga0207690_10087538 3300025932 Bacteria 2192
132 Ga0207690_10092854 3300025932 Bacteria 2137
133 Ga0207706_10029510 3300025933 Bacteria 4896
134 Ga0207709_10010619 3300025935 Bacteria 5074
135 Ga0207691_10004708 3300025940 Bacteria 13206
136 Ga0207711_10009316 3300025941 Bacteria 8196
137 Ga0207661_10090078 3300025944 Bacteria 2553
138 Ga0207661_10816963 3300025944 Bacteria 858
139 Ga0207679_10001295 3300025945 Bacteria 15798
140 Ga0207679_10093476 3300025945 Bacteria 2332
141 Ga0207667_10016754 3300025949 Bacteria 8268
142 Ga0207667_10018294 3300025949 Bacteria 7863
143 Ga0207668_11290021 3300025972 Bacteria 657
144 Ga0207640_10001821 3300025981 Bacteria 11435
145 Ga0207640_10614964 3300025981 Bacteria 921
146 Ga0207658_10050001 3300025986 Bacteria 3074
147 Ga0207639_10460115 3300026041 Bacteria 1156
148 Ga0207639_11415614 3300026041 Bacteria 652
149 Ga0207678_10018276 3300026067 Bacteria 6157
150 Ga0207678_10029838 3300026067 Bacteria 4761
151 Ga0207678_10263741 3300026067 Bacteria 1476
152 Ga0207702_10003564 3300026078 Bacteria 14163
153 Ga0207676_10114033 3300026095 Bacteria 2267
154 Ga0207674_10088602 3300026116 Bacteria 3088
155 Ga0207674_10140847 3300026116 Bacteria 2371
156 Ga0207698_10007097 3300026142 Bacteria 7017
157 Ga0209371_1000043 3300027312 Bacteria 331009
158 Ga0268266_10200726 3300028379 Bacteria 1825
159 Ga0268266_10226333 3300028379 Bacteria 1721
160 Ga0268266_11304097 3300028379 Bacteria 701
161 Ga0265338_11009103 3300028800 Bacteria 563
162 Ga0268256_1000044 3300030500 Bacteria 330997
163 Ga0307508_10021367 3300031616 Bacteria 5884
164 Ga0265314_10004913 3300031711 Bacteria 12211
165 Ga0316576_10716041 3300031727 Bacteria 724
166 Ga0307405_10190784 3300031731 Bacteria 1480
167 Ga0307405_11134291 3300031731 Bacteria 673
168 Ga0316577_10211540 3300031733 Bacteria 1096
169 Ga0307413_10372950 3300031824 Bacteria 1109
170 Ga0307407_10576656 3300031903 Bacteria 835
171 Ga0307412_10005843 3300031911 Bacteria 6925
172 Ga0307412_10089723 3300031911 Bacteria 2147
173 Ga0307409_100951009 3300031995 Bacteria 875
174 Ga0307414_10210556 3300032004 Bacteria 1588
175 Ga0307414_10235623 3300032004 Bacteria 1512
176 Ga0307414_10781943 3300032004 Bacteria 869
177 Ga0307414_11387903 3300032004 Bacteria 653
178 Ga0307415_101684393 3300032126 Bacteria 611
179 Ga0307510_10133281 3300033180 Bacteria 2150
180 Ga0316582_0019607 3300036647 Bacteria 3963
181 Ga0316584_0065190 3300036712 Bacteria 2728
182 Ga0400490_03773 3300038726 Bacteria 1453
183 Ga0400488_11518 3300038741 Bacteria 1068
184 Ga0436365_1492824 3300039437 Bacteria 1038
185 Ga0436360_0796430 3300039438 Bacteria 1715
186 Ga0436361_0476896 3300039447 Bacteria 5622
187 Ga0436361_0511979 3300039447 Bacteria 569
188 Ga0436363_1084536 3300039450 Bacteria 821
189 Ga0439439_0071840 3300041406 Bacteria 928
190 Ga0451797_0447246 3300041453 Bacteria 1317
191 Ga0451800_0204184 3300041459 Bacteria 4229
192 Ga0451802_0984141 3300041460 Bacteria 548
193 Ga0451806_478065 3300041462 Bacteria 1703
194 Ga0451807_0030447 3300041486 Bacteria 1630
195 Ga0451837_1405388 3300041494 Bacteria 912
196 Ga0439445_0007344 3300042004 Bacteria 2554
197 Ga0466969_0002632 3300044656 Bacteria 9599
198 Ga0466961_0035576 3300044693 Bacteria 3198
199 Ga0466963_0065014 3300044694 Bacteria 2445
200 Ga0453684_0000437 3300044712 Bacteria 169900
201 Ga0466971_0009978 3300044719 Bacteria 4149
202 Ga0466970_0076424 3300044765 Bacteria 1804
203 Ga0466959_0000300 3300045049 Bacteria 29361
204 Ga0451576_0000081 3300045051 Bacteria 239875
205 Ga0466958_0118433 3300045836 Bacteria 1656
206 Ga0495605_0045985 3300046474 Bacteria 2148
207 Ga0495606_0022293 3300046507 Bacteria 4616
208 Ga0495606_0089246 3300046507 Bacteria 1899
209 Ga0495633_0166666 3300046558 Bacteria 1016
210 Ga0495669_0000751 3300046684 Bacteria 13943
211 Ga0496101_0559359 3300048904 Bacteria 904
212 Ga0496108_0327486 3300048911 Bacteria 1336
213 Ga0496109_1629628 3300048912 Bacteria 579
214 Ga0496110_0008150 3300048913 Bacteria 8418
215 Ga0496111_0002639 3300048914 Bacteria 10873
216 Ga0496114_0474228 3300048917 Bacteria 1107
217 Ga0496117_0006915 3300048920 Bacteria 11249
218 Ga0496118_0029822 3300048921 Bacteria 4565
219 Ga0496119_0007697 3300048922 Bacteria 9639
220 Ga0496120_0000320 3300048923 Bacteria 79515
221 Ga0496122_0000315 3300048925 Bacteria 106323
222 Ga0496122_0001858 3300048925 Bacteria 32188
223 Ga0496123_0000149 3300048926 Bacteria 142962
224 Ga0496123_0005563 3300048926 Bacteria 12619
225 Ga0496124_0000006 3300048927 Bacteria 904259
226 Ga0496124_0000403 3300048927 Bacteria 78615
227 Ga0496124_0162188 3300048927 Bacteria 1741
228 Ga0496124_0202180 3300048927 Bacteria 1510
229 Ga0496126_0007646 3300048929 Bacteria 11797
230 Ga0496126_0230764 3300048929 Bacteria 1551
231 Ga0501031_0086381 3300049568 Bacteria 2045
232 Ga0501031_0785572 3300049568 Bacteria 611
233 Ga0501032_0121375 3300049569 Bacteria 1727
234 Ga0501033_0317075 3300049570 Bacteria 1095
235 Ga0501033_0985482 3300049570 Bacteria 564
236 Ga0501034_0000521 3300049571 Bacteria 61943
237 Ga0501034_0038647 3300049571 Bacteria 4832
238 Ga0501034_0538339 3300049571 Bacteria 1078
239 Ga0501036_0051123 3300049572 Bacteria 3499
240 Ga0501037_0009459 3300049573 Bacteria 7155
241 Ga0501037_0025976 3300049573 Bacteria 4326
242 Ga0501038_0065266 3300049574 Bacteria 3102
243 Ga0501039_0067818 3300049575 Bacteria 2770
244 Ga0501039_1073014 3300049575 Bacteria 625
245 Ga0501043_0041740 3300049579 Bacteria 3604
246 Ga0501043_0328027 3300049579 Bacteria 1166
247 Ga0501047_0026715 3300049581 Bacteria 5556
248 Ga0501047_0081043 3300049581 Bacteria 3120
249 Ga0501047_0370006 3300049581 Bacteria 1268
250 Ga0501069_0139561 3300049585 Bacteria 1390
251 Ga0501069_0770353 3300049585 Bacteria 582
252 Ga0501070_0000014 3300049586 Bacteria 180454
253 Ga0501070_0008355 3300049586 Bacteria 8748
254 Ga0501070_0008907 3300049586 Bacteria 8483
255 Ga0501071_0111639 3300049587 Bacteria 2021
256 Ga0501073_0146455 3300049589 Bacteria 1636
257 Ga0501074_0097917 3300049590 Bacteria 2099
258 Ga0501079_0098379 3300049741 Bacteria 2268
259 Ga0501079_0325936 3300049741 Bacteria 1202
260 Ga0501080_0001353 3300049742 Bacteria 20479
261 Ga0501080_0146144 3300049742 Bacteria 2185
262 Ga0501035_0001780 3300049822 Bacteria 21770
263 Ga0501035_0002920 3300049822 Bacteria 16452
264 Ga0501035_0059846 3300049822 Bacteria 3392
265 Ga0501035_0072830 3300049822 Bacteria 3040
266 Ga0501035_0179332 3300049822 Bacteria 1826
267 Ga0501035_0233108 3300049822 Bacteria 1568
268 Ga0501044_0022525 3300049823 Bacteria 6712
269 Ga0501044_0084197 3300049823 Bacteria 3214
270 Ga0501044_0092728 3300049823 Bacteria 3046
271 Ga0501044_0113781 3300049823 Bacteria 2712
272 Ga0501044_0157719 3300049823 Bacteria 2248
273 Ga0501044_0508456 3300049823 Bacteria 1105
274 nmdc:mga0a205_567347_c1 3300050515 Bacteria 989
275 Ga0500651_0117466 3300053093 Bacteria 1618
276 Ga0466962_0001477 3300061719 Bacteria 10968
277 Ga0530510_0710948 3300061734 Bacteria 766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10152219 Ga0081539_101522191 125
2 3300042004 Ga0439445_0007344 Ga0439445_0007344_1417_1818 128
3 3300039450 Ga0436363_1084536 Ga0436363_1084536_286_684 132
4 3300049571 Ga0501034_0538339 Ga0501034_0538339_412_810 132
5 3300038726 Ga0400490_03773 Ga0400490_03773_842_1243 133
6 3300038741 Ga0400488_11518 Ga0400488_11518_203_604 133
7 3300049581 Ga0501047_0026715 Ga0501047_0026715_1398_1820 133
8 3300049586 Ga0501070_0008907 Ga0501070_0008907_6338_6760 133
9 3300049589 Ga0501073_0146455 Ga0501073_0146455_471_893 133
10 3300049590 Ga0501074_0097917 Ga0501074_0097917_826_1248 133
11 3300049822 Ga0501035_0002920 Ga0501035_0002920_15705_16127 133
12 3300049823 Ga0501044_0508456 Ga0501044_0508456_398_820 133
13 iso_pu_bacteria 2751185897 2753767018 133
14 3300049822 Ga0501035_0233108 Ga0501035_0233108_1151_1555 134
15 iso_pu_bacteria 2643221591 2643963869 134
16 iso_pu_bacteria 2928531327 2928535583 134
17 iso_pu_bacteria 2513237087 2513589162 135
18 iso_pu_bacteria 2643221579 2643909285 136
19 iso_pu_bacteria 2643221695 2644530074 136
20 iso_pu_bacteria 2818991457 2819661165 136
21 iso_pu_bacteria 2842780639 2842782244 136
22 iso_pu_bacteria 2852684882 2852687022 136
23 iso_pu_bacteria 2919130084 2919131194 136
24 iso_pu_bacteria 2923516293 2923517299 136
25 iso_pu_bacteria 2929195423 2929196434 136
26 iso_pu_bacteria 8021622325 8021624988 136
27 iso_pu_bacteria 8021626552 8021626749 136
28 iso_pu_bacteria 8021648035 8021651839 136
29 3300005329 Ga0070683_100160779 Ga0070683_1001607793 137
30 3300031616 Ga0307508_10021367 Ga0307508_100213674 137
31 3300031911 Ga0307412_10005843 Ga0307412_100058434 137
32 3300031911 Ga0307412_10089723 Ga0307412_100897233 137
33 3300033180 Ga0307510_10133281 Ga0307510_101332812 137
34 3300041460 Ga0451802_0984141 Ga0451802_0984141_106_531 137
35 2162886012 MBSR1b_contig_2473481 MBSR1b_0413.00003790 138
36 3300005290 Ga0065712_10069163 Ga0065712_100691636 138
37 3300005293 Ga0065715_10099678 Ga0065715_100996781 138
38 3300005327 Ga0070658_10139873 Ga0070658_101398733 138
39 3300005327 Ga0070658_10722639 Ga0070658_107226392 138
40 3300005329 Ga0070683_100357048 Ga0070683_1003570482 138
41 3300005331 Ga0070670_100001880 Ga0070670_10000188014 138
42 3300005333 Ga0070677_10215334 Ga0070677_102153341 138
43 3300005335 Ga0070666_10016569 Ga0070666_100165694 138
44 3300005337 Ga0070682_100704534 Ga0070682_1007045341 138
45 3300005344 Ga0070661_100023394 Ga0070661_1000233943 138
46 3300005347 Ga0070668_100128443 Ga0070668_1001284434 138
47 3300005354 Ga0070675_100027084 Ga0070675_1000270845 138
48 3300005355 Ga0070671_100001083 Ga0070671_1000010838 138
49 3300005364 Ga0070673_100003519 Ga0070673_10000351911 138
50 3300005366 Ga0070659_100523474 Ga0070659_1005234741 138
51 3300005367 Ga0070667_100010941 Ga0070667_1000109416 138
52 3300005455 Ga0070663_100225620 Ga0070663_1002256202 138
53 3300005543 Ga0070672_100003201 Ga0070672_1000032016 138
54 3300005548 Ga0070665_100353558 Ga0070665_1003535582 138
55 3300005564 Ga0070664_100002846 Ga0070664_10000284610 138
56 3300005564 Ga0070664_100057253 Ga0070664_1000572534 138
57 3300005618 Ga0068864_100021777 Ga0068864_1000217774 138
58 3300005840 Ga0068870_10298002 Ga0068870_102980022 138
59 3300006358 Ga0068871_100241372 Ga0068871_1002413722 138
60 3300009093 Ga0105240_10168694 Ga0105240_101686942 138
61 3300009148 Ga0105243_11021672 Ga0105243_110216722 138
62 3300009177 Ga0105248_10001364 Ga0105248_1000136426 138
63 3300009545 Ga0105237_10004010 Ga0105237_100040109 138
64 3300013308 Ga0157375_10022297 Ga0157375_100222976 138
65 3300014325 Ga0163163_10146388 Ga0163163_101463882 138
66 3300017792 Ga0163161_10102893 Ga0163161_101028931 138
67 3300021441 Ga0213871_10061544 Ga0213871_100615441 138
68 3300025295 Ga0209564_1017005 Ga0209564_10170053 138
69 3300025315 Ga0207697_10426409 Ga0207697_104264091 138
70 3300025903 Ga0207680_10020234 Ga0207680_100202345 138
71 3300025907 Ga0207645_11068693 Ga0207645_110686931 138
72 3300025909 Ga0207705_10020771 Ga0207705_100207711 138
73 3300025913 Ga0207695_10174849 Ga0207695_101748494 138
74 3300025914 Ga0207671_10002252 Ga0207671_100022529 138
75 3300025920 Ga0207649_10176817 Ga0207649_101768172 138
76 3300025920 Ga0207649_10401754 Ga0207649_104017542 138
77 3300025925 Ga0207650_10001425 Ga0207650_1000142515 138
78 3300025925 Ga0207650_10076427 Ga0207650_100764273 138
79 3300025926 Ga0207659_10001814 Ga0207659_1000181414 138
80 3300025931 Ga0207644_10004480 Ga0207644_100044802 138
81 3300025933 Ga0207706_10029510 Ga0207706_100295102 138
82 3300025940 Ga0207691_10004708 Ga0207691_100047086 138
83 3300025941 Ga0207711_10009316 Ga0207711_100093164 138
84 3300025944 Ga0207661_10816963 Ga0207661_108169632 138
85 3300025945 Ga0207679_10001295 Ga0207679_1000129511 138
86 3300025945 Ga0207679_10093476 Ga0207679_100934762 138
87 3300025972 Ga0207668_11290021 Ga0207668_112900212 138
88 3300025981 Ga0207640_10614964 Ga0207640_106149642 138
89 3300025986 Ga0207658_10050001 Ga0207658_100500014 138
90 3300026067 Ga0207678_10263741 Ga0207678_102637412 138
91 3300026095 Ga0207676_10114033 Ga0207676_101140332 138
92 3300026116 Ga0207674_10140847 Ga0207674_101408473 138
93 3300028379 Ga0268266_10200726 Ga0268266_102007261 138
94 3300028800 Ga0265338_11009103 Ga0265338_110091031 138
95 3300031731 Ga0307405_11134291 Ga0307405_111342911 138
96 3300031824 Ga0307413_10372950 Ga0307413_103729502 138
97 3300031903 Ga0307407_10576656 Ga0307407_105766562 138
98 3300032004 Ga0307414_10210556 Ga0307414_102105563 138
99 3300032004 Ga0307414_10235623 Ga0307414_102356232 138
100 3300032126 Ga0307415_101684393 Ga0307415_1016843931 138
101 3300039437 Ga0436365_1492824 Ga0436365_1492824_511_930 138
102 3300039438 Ga0436360_0796430 Ga0436360_0796430_84_521 138
103 3300039447 Ga0436361_0511979 Ga0436361_0511979_96_533 138
104 3300046684 Ga0495669_0000751 Ga0495669_0000751_6626_7042 138
105 3300048904 Ga0496101_0559359 Ga0496101_0559359_51_467 138
106 3300048911 Ga0496108_0327486 Ga0496108_0327486_210_626 138
107 3300048912 Ga0496109_1629628 Ga0496109_1629628_52_468 138
108 3300048913 Ga0496110_0008150 Ga0496110_0008150_7360_7776 138
109 3300048914 Ga0496111_0002639 Ga0496111_0002639_7050_7466 138
110 3300048917 Ga0496114_0474228 Ga0496114_0474228_612_1028 138
111 3300048927 Ga0496124_0162188 Ga0496124_0162188_589_1005 138
112 3300048927 Ga0496124_0202180 Ga0496124_0202180_526_942 138
113 3300049585 Ga0501069_0770353 Ga0501069_0770353_55_492 138
114 3300061734 Ga0530510_0710948 Ga0530510_0710948_133_549 138
115 3300003320 rootH2_10021741 rootH2_100217416 139
116 3300005336 Ga0070680_100019193 Ga0070680_1000191933 139
117 3300005337 Ga0070682_100166042 Ga0070682_1001660422 139
118 3300005337 Ga0070682_101686117 Ga0070682_1016861171 139
119 3300005339 Ga0070660_100001754 Ga0070660_1000017549 139
120 3300005341 Ga0070691_10001365 Ga0070691_100013657 139
121 3300005455 Ga0070663_100074040 Ga0070663_1000740403 139
122 3300005458 Ga0070681_10085502 Ga0070681_100855023 139
123 3300005530 Ga0070679_100119483 Ga0070679_1001194833 139
124 3300005539 Ga0068853_100390968 Ga0068853_1003909682 139
125 3300005563 Ga0068855_100037437 Ga0068855_1000374377 139
126 3300005617 Ga0068859_102311853 Ga0068859_1023118531 139
127 3300006931 Ga0097620_102311978 Ga0097620_1023119781 139
128 3300009551 Ga0105238_10007572 Ga0105238_100075729 139
129 3300013104 Ga0157370_10012444 Ga0157370_100124445 139
130 3300013104 Ga0157370_10434548 Ga0157370_104345481 139
131 3300013307 Ga0157372_10108533 Ga0157372_101085332 139
132 3300014326 Ga0157380_10037940 Ga0157380_100379403 139
133 3300025909 Ga0207705_10000425 Ga0207705_100004253 139
134 3300025911 Ga0207654_10838110 Ga0207654_108381102 139
135 3300025912 Ga0207707_10004320 Ga0207707_100043207 139
136 3300025917 Ga0207660_10007082 Ga0207660_100070821 139
137 3300025919 Ga0207657_10000446 Ga0207657_1000044633 139
138 3300025921 Ga0207652_10007132 Ga0207652_100071324 139
139 3300025932 Ga0207690_10092854 Ga0207690_100928543 139
140 3300025949 Ga0207667_10018294 Ga0207667_100182943 139
141 3300026041 Ga0207639_11415614 Ga0207639_114156141 139
142 3300026067 Ga0207678_10029838 Ga0207678_100298385 139
143 3300031711 Ga0265314_10004913 Ga0265314_100049133 139
144 3300031727 Ga0316576_10716041 Ga0316576_107160412 139
145 3300031733 Ga0316577_10211540 Ga0316577_102115402 139
146 3300032004 Ga0307414_11387903 Ga0307414_113879032 139
147 3300036647 Ga0316582_0019607 Ga0316582_0019607_2972_3421 139
148 3300036712 Ga0316584_0065190 Ga0316584_0065190_779_1201 139
149 3300039447 Ga0436361_0476896 Ga0436361_0476896_20_439 139
150 3300044712 Ga0453684_0000437 Ga0453684_0000437_155221_155640 139
151 3300045051 Ga0451576_0000081 Ga0451576_0000081_14261_14680 139
152 3300048929 Ga0496126_0230764 Ga0496126_0230764_509_949 139
153 3300049568 Ga0501031_0086381 Ga0501031_0086381_408_839 139
154 3300049568 Ga0501031_0785572 Ga0501031_0785572_39_479 139
155 3300049569 Ga0501032_0121375 Ga0501032_0121375_171_602 139
156 3300049570 Ga0501033_0317075 Ga0501033_0317075_160_600 139
157 3300049571 Ga0501034_0038647 Ga0501034_0038647_3434_3865 139
158 3300049572 Ga0501036_0051123 Ga0501036_0051123_98_529 139
159 3300049573 Ga0501037_0009459 Ga0501037_0009459_6322_6762 139
160 3300049573 Ga0501037_0025976 Ga0501037_0025976_1765_2196 139
161 3300049574 Ga0501038_0065266 Ga0501038_0065266_2132_2572 139
162 3300049575 Ga0501039_0067818 Ga0501039_0067818_1877_2308 139
163 3300049575 Ga0501039_1073014 Ga0501039_1073014_164_583 139
164 3300049579 Ga0501043_0041740 Ga0501043_0041740_2679_3119 139
165 3300049581 Ga0501047_0081043 Ga0501047_0081043_967_1398 139
166 3300049581 Ga0501047_0370006 Ga0501047_0370006_423_863 139
167 3300049585 Ga0501069_0139561 Ga0501069_0139561_833_1273 139
168 3300049586 Ga0501070_0000014 Ga0501070_0000014_62519_62959 139
169 3300049586 Ga0501070_0008355 Ga0501070_0008355_6204_6635 139
170 3300049587 Ga0501071_0111639 Ga0501071_0111639_667_1098 139
171 3300049741 Ga0501079_0098379 Ga0501079_0098379_959_1399 139
172 3300049741 Ga0501079_0325936 Ga0501079_0325936_26_466 139
173 3300049742 Ga0501080_0001353 Ga0501080_0001353_4891_5331 139
174 3300049742 Ga0501080_0146144 Ga0501080_0146144_466_897 139
175 3300049822 Ga0501035_0001780 Ga0501035_0001780_16550_16990 139
176 3300049822 Ga0501035_0059846 Ga0501035_0059846_2019_2450 139
177 3300049822 Ga0501035_0072830 Ga0501035_0072830_1087_1527 139
178 3300049823 Ga0501044_0022525 Ga0501044_0022525_1719_2159 139
179 3300049823 Ga0501044_0084197 Ga0501044_0084197_1353_1793 139
180 3300049823 Ga0501044_0092728 Ga0501044_0092728_1827_2267 139
181 3300049823 Ga0501044_0113781 Ga0501044_0113781_2151_2582 139
182 3300050515 nmdc:mga0a205_567347_c1 nmdc:mga0a205_567347_c1_37_456 139
183 2162886007 SwRhRL2b_contig_2777537 SwRhRL2b_0179.00000580 140
184 3300001904 JGI24736J21556_1006250 JGI24736J21556_10062502 140
185 3300001979 JGI24740J21852_10005548 JGI24740J21852_100055487 140
186 3300003316 rootH1_10078607 rootH1_100786072 140
187 3300003320 rootH2_10018900 rootH2_100189002 140
188 3300003323 rootH1_10098282 rootH1_100982822 140
189 3300003323 rootH1_10164417 rootH1_101644172 140
190 3300003794 Ga0055531_10006914 Ga0055531_100069144 140
191 3300003794 Ga0055531_10010520 Ga0055531_100105205 140
192 3300003856 Ga0058692_1000045 Ga0058692_100004553 140
193 3300005289 Ga0065704_10136630 Ga0065704_101366301 140
194 3300005289 Ga0065704_10154515 Ga0065704_101545152 140
195 3300005329 Ga0070683_100305543 Ga0070683_1003055432 140
196 3300005331 Ga0070670_100019597 Ga0070670_1000195974 140
197 3300005336 Ga0070680_100027328 Ga0070680_1000273285 140
198 3300005337 Ga0070682_100111762 Ga0070682_1001117622 140
199 3300005339 Ga0070660_100084835 Ga0070660_1000848353 140
200 3300005341 Ga0070691_10071844 Ga0070691_100718442 140
201 3300005344 Ga0070661_100037197 Ga0070661_1000371974 140
202 3300005345 Ga0070692_10035130 Ga0070692_100351302 140
203 3300005366 Ga0070659_100090032 Ga0070659_1000900323 140
204 3300005458 Ga0070681_10127721 Ga0070681_101277212 140
205 3300005530 Ga0070679_100373635 Ga0070679_1003736352 140
206 3300005535 Ga0070684_100141862 Ga0070684_1001418622 140
207 3300005539 Ga0068853_100030024 Ga0068853_1000300247 140
208 3300005546 Ga0070696_100069503 Ga0070696_1000695032 140
209 3300005548 Ga0070665_100358388 Ga0070665_1003583882 140
210 3300005577 Ga0068857_100287766 Ga0068857_1002877662 140
211 3300009011 Ga0105251_10004729 Ga0105251_100047297 140
212 3300009093 Ga0105240_10290397 Ga0105240_102903973 140
213 3300009148 Ga0105243_10020458 Ga0105243_100204584 140
214 3300009174 Ga0105241_10314405 Ga0105241_103144051 140
215 3300009993 Ga0105028_110740 Ga0105028_1107401 140
216 3300013100 Ga0157373_10164129 Ga0157373_101641292 140
217 3300013102 Ga0157371_10033231 Ga0157371_100332313 140
218 3300013307 Ga0157372_10280803 Ga0157372_102808033 140
219 3300015265 Ga0182005_1098821 Ga0182005_10988212 140
220 3300020070 Ga0206356_10003094 Ga0206356_100030944 140
221 3300020077 Ga0206351_10171413 Ga0206351_101714133 140
222 3300020078 Ga0206352_10265849 Ga0206352_102658494 140
223 3300020081 Ga0206354_11003205 Ga0206354_110032053 140
224 3300020082 Ga0206353_11008563 Ga0206353_110085636 140
225 3300020610 Ga0154015_1468556 Ga0154015_14685562 140
226 3300022467 Ga0224712_10216576 Ga0224712_102165763 140
227 3300025253 Ga0209677_103724 Ga0209677_1037243 140
228 3300025304 Ga0209257_1000091 Ga0209257_100009126 140
229 3300025735 Ga0207713_1004463 Ga0207713_10044637 140
230 3300025904 Ga0207647_10002143 Ga0207647_1000214312 140
231 3300025909 Ga0207705_10004563 Ga0207705_100045633 140
232 3300025911 Ga0207654_10099313 Ga0207654_100993131 140
233 3300025912 Ga0207707_10068820 Ga0207707_100688203 140
234 3300025913 Ga0207695_10062744 Ga0207695_100627443 140
235 3300025917 Ga0207660_10008193 Ga0207660_100081938 140
236 3300025919 Ga0207657_10148443 Ga0207657_101484433 140
237 3300025920 Ga0207649_10097446 Ga0207649_100974463 140
238 3300025921 Ga0207652_10007939 Ga0207652_100079397 140
239 3300025923 Ga0207681_10185848 Ga0207681_101858482 140
240 3300025925 Ga0207650_10012550 Ga0207650_100125504 140
241 3300025932 Ga0207690_10087538 Ga0207690_100875382 140
242 3300025935 Ga0207709_10010619 Ga0207709_100106194 140
243 3300025944 Ga0207661_10090078 Ga0207661_100900782 140
244 3300025949 Ga0207667_10016754 Ga0207667_100167547 140
245 3300025981 Ga0207640_10001821 Ga0207640_100018217 140
246 3300026041 Ga0207639_10460115 Ga0207639_104601152 140
247 3300026067 Ga0207678_10018276 Ga0207678_100182763 140
248 3300026078 Ga0207702_10003564 Ga0207702_1000356412 140
249 3300026116 Ga0207674_10088602 Ga0207674_100886023 140
250 3300026142 Ga0207698_10007097 Ga0207698_100070978 140
251 3300027312 Ga0209371_1000043 Ga0209371_1000043174 140
252 3300028379 Ga0268266_10226333 Ga0268266_102263333 140
253 3300028379 Ga0268266_11304097 Ga0268266_113040971 140
254 3300030500 Ga0268256_1000044 Ga0268256_1000044174 140
255 3300031731 Ga0307405_10190784 Ga0307405_101907842 140
256 3300031995 Ga0307409_100951009 Ga0307409_1009510092 140
257 3300032004 Ga0307414_10781943 Ga0307414_107819432 140
258 3300041406 Ga0439439_0071840 Ga0439439_0071840_259_735 140
259 3300041453 Ga0451797_0447246 Ga0451797_0447246_423_845 140
260 3300041459 Ga0451800_0204184 Ga0451800_0204184_138_560 140
261 3300041462 Ga0451806_478065 Ga0451806_478065_1152_1574 140
262 3300041486 Ga0451807_0030447 Ga0451807_0030447_1068_1490 140
263 3300041494 Ga0451837_1405388 Ga0451837_1405388_99_521 140
264 3300044656 Ga0466969_0002632 Ga0466969_0002632_812_1276 140
265 3300044693 Ga0466961_0035576 Ga0466961_0035576_2476_2940 140
266 3300044694 Ga0466963_0065014 Ga0466963_0065014_690_1154 140
267 3300044719 Ga0466971_0009978 Ga0466971_0009978_690_1154 140
268 3300044765 Ga0466970_0076424 Ga0466970_0076424_1056_1520 140
269 3300045049 Ga0466959_0000300 Ga0466959_0000300_1593_2057 140
270 3300045836 Ga0466958_0118433 Ga0466958_0118433_10_474 140
271 3300046474 Ga0495605_0045985 Ga0495605_0045985_1256_1741 140
272 3300046507 Ga0495606_0022293 Ga0495606_0022293_229_714 140
273 3300046507 Ga0495606_0089246 Ga0495606_0089246_1134_1619 140
274 3300046558 Ga0495633_0166666 Ga0495633_0166666_25_510 140
275 3300048920 Ga0496117_0006915 Ga0496117_0006915_3279_3701 140
276 3300048921 Ga0496118_0029822 Ga0496118_0029822_1694_2116 140
277 3300048922 Ga0496119_0007697 Ga0496119_0007697_7549_7971 140
278 3300048923 Ga0496120_0000320 Ga0496120_0000320_71545_71967 140
279 3300048925 Ga0496122_0000315 Ga0496122_0000315_71598_72020 140
280 3300048925 Ga0496122_0001858 Ga0496122_0001858_19510_19944 140
281 3300048926 Ga0496123_0000149 Ga0496123_0000149_66063_66485 140
282 3300048926 Ga0496123_0005563 Ga0496123_0005563_6603_7037 140
283 3300048927 Ga0496124_0000006 Ga0496124_0000006_739825_740259 140
284 3300048927 Ga0496124_0000403 Ga0496124_0000403_56157_56579 140
285 3300048929 Ga0496126_0007646 Ga0496126_0007646_5684_6118 140
286 3300049570 Ga0501033_0985482 Ga0501033_0985482_59_481 140
287 3300049571 Ga0501034_0000521 Ga0501034_0000521_60823_61260 140
288 3300049579 Ga0501043_0328027 Ga0501043_0328027_20_442 140
289 3300049822 Ga0501035_0179332 Ga0501035_0179332_972_1394 140
290 3300049823 Ga0501044_0157719 Ga0501044_0157719_609_1031 140
291 3300053093 Ga0500651_0117466 Ga0500651_0117466_545_967 140
292 3300061719 Ga0466962_0001477 Ga0466962_0001477_4164_4628 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

129

0.9

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

19

139

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.9069 1 123
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.9067 1 122
2c21-assembly3.cif.gz_F specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme 0.9034 1 121
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8996 1 123
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8993 1 122
ID Description Score Start End Superfamily
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9067 1 122 3.10.180.10
2c21D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9009 1 121 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8993 1 122 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8591 1 122 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8529 1 58 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 1.005 83 140 GO:0016829
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 0.988 83 140 GO:0016829
AF-A0A3C7W1R9-F1-model_v4 Lactoylglutathione lyase 0.9864 89 140 GO:0016829
AF-A0A3D2GKL9-F1-model_v4 Lactoylglutathione lyase 0.9856 71 140 GO:0016829
AF-T0YML8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9834 23 140 GO:0051213

Feature Viewer

pLDDT pTM Quality
91.55 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map