F391652

General Info

Members Datasets Scaffolds Average Seq Length
293 194 292 305

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0152832|Ga0466967_0152832_1043_1972
Length 309
Sequence MADTPRVDGRAAVIGGGLMGHGIAQVLALAGMDVAVHDPVPAALESVPERIAANLRALRIDREAPVALEPELEHAVEGAEWVFEAAPENLELKQEIFARLDAAAGERTILATNTSVMKVGDIGARAQRRGRIVGTHWWNPPYLVRLVEVVQGPETEPATVQRTLELLEALGKTAVHVRRDVAGFVGNRLQHALWREAFDLVDKGVCDPETIDTVIKAGFGSRLPVLGPIENADLVGLDLTLAIHEYVLPELDPPSQPSPGLRRRVEQGQLGMKTGSGFRSWSSEDAAAVRERLLAHLIAVTSHQGGGGS

Samples

Sample ID Description Type Environment
1 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 1.02
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.83
Nodule 0
Rhizoplane 9.56
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10004936 3300003215 Bacteria 7088
2 Ga0070676_10046801 3300005328 Bacteria 2524
3 Ga0070680_100004467 3300005336 Bacteria 10538
4 Ga0070680_100378555 3300005336 Bacteria 1205
5 Ga0068868_100332455 3300005338 Bacteria 1297
6 Ga0070689_100027771 3300005340 Bacteria 4269
7 Ga0070675_100107762 3300005354 Bacteria 2353
8 Ga0070674_100006024 3300005356 Bacteria 7046
9 Ga0070659_100228716 3300005366 Bacteria 1537
10 Ga0070709_10247853 3300005434 Bacteria 1282
11 Ga0070714_100172494 3300005435 Bacteria 1964
12 Ga0070713_100147357 3300005436 Bacteria 2091
13 Ga0070700_100399340 3300005441 Bacteria 1033
14 Ga0070678_100159820 3300005456 Bacteria 1824
15 Ga0070681_10060642 3300005458 Bacteria 3758
16 Ga0070681_10071718 3300005458 Bacteria 3428
17 Ga0070681_10118389 3300005458 Bacteria 2585
18 Ga0070681_10204223 3300005458 Bacteria 1893
19 Ga0070681_10458549 3300005458 Bacteria 1187
20 Ga0070679_100015110 3300005530 Bacteria 7420
21 Ga0070679_100198327 3300005530 Bacteria 1974
22 Ga0068857_100253695 3300005577 Bacteria 1613
23 Ga0068864_100058574 3300005618 Bacteria 3330
24 Ga0068861_100263622 3300005719 Bacteria 1476
25 Ga0068861_100446412 3300005719 Bacteria 1158
26 Ga0081538_10005276 3300005981 Bacteria 11663
27 Ga0081540_1000783 3300005983 Bacteria 29165
28 Ga0081540_1012091 3300005983 Bacteria 5711
29 Ga0075365_10166792 3300006038 Bacteria 1536
30 Ga0075363_100071132 3300006048 Bacteria 1890
31 Ga0075364_10099513 3300006051 Bacteria 1935
32 Ga0070712_100166469 3300006175 Bacteria 1707
33 Ga0075367_10104956 3300006178 Bacteria 1730
34 Ga0075367_10248845 3300006178 Bacteria 1115
35 Ga0075370_10168395 3300006353 Bacteria 1287
36 Ga0075428_100031003 3300006844 Bacteria 5913
37 Ga0075433_10060250 3300006852 Bacteria 3323
38 Ga0075434_100023265 3300006871 Bacteria 6035
39 Ga0075434_100046995 3300006871 Bacteria 4283
40 Ga0075434_100200424 3300006871 Bacteria 2016
41 Ga0075429_100102549 3300006880 Bacteria 2498
42 Ga0075429_100176150 3300006880 Bacteria 1874
43 Ga0075435_100071993 3300007076 Bacteria 2823
44 Ga0105240_10022753 3300009093 Bacteria 8303
45 Ga0111539_10025601 3300009094 Bacteria 7231
46 Ga0111539_10238126 3300009094 Bacteria 2118
47 Ga0111539_10248379 3300009094 Bacteria 2072
48 Ga0105242_10106809 3300009176 Bacteria 2380
49 Ga0157370_10007782 3300013104 Bacteria 11617
50 Ga0157370_10284034 3300013104 Bacteria 1529
51 Ga0157378_10425506 3300013297 Bacteria 1313
52 Ga0163162_10386020 3300013306 Bacteria 1534
53 Ga0157372_10382709 3300013307 Bacteria 1639
54 Ga0157375_10309606 3300013308 Bacteria 1744
55 Ga0163163_10096952 3300014325 Bacteria 2969
56 Ga0182008_10014409 3300014497 Bacteria 4140
57 Ga0224572_1000501 3300024225 Bacteria 4705
58 Ga0209758_1000669 3300025297 Bacteria 51286
59 Ga0207426_1021815 3300025302 Bacteria 2208
60 Ga0207697_10069955 3300025315 Bacteria 1470
61 Ga0207688_10141639 3300025901 Bacteria 1415
62 Ga0207645_10064680 3300025907 Bacteria 2337
63 Ga0207707_10003185 3300025912 Bacteria 14568
64 Ga0207707_10043578 3300025912 Bacteria 3913
65 Ga0207695_10143915 3300025913 Bacteria 2330
66 Ga0207693_10242119 3300025915 Bacteria 1416
67 Ga0207663_10053042 3300025916 Bacteria 2532
68 Ga0207660_10152777 3300025917 Bacteria 1775
69 Ga0207662_10046392 3300025918 Bacteria 2570
70 Ga0207652_10015640 3300025921 Bacteria 6176
71 Ga0207652_10236468 3300025921 Bacteria 1647
72 Ga0207659_10069857 3300025926 Bacteria 2560
73 Ga0207700_10058667 3300025928 Bacteria 2908
74 Ga0207700_10360552 3300025928 Bacteria 1267
75 Ga0207690_10155530 3300025932 Bacteria 1699
76 Ga0207686_10016294 3300025934 Bacteria 4170
77 Ga0207670_10006490 3300025936 Bacteria 6489
78 Ga0207670_10212352 3300025936 Bacteria 1477
79 Ga0207669_10048303 3300025937 Bacteria 2527
80 Ga0207665_10095407 3300025939 Bacteria 2067
81 Ga0207711_10023965 3300025941 Bacteria 5108
82 Ga0207676_10043073 3300026095 Bacteria 3473
83 Ga0207674_10256637 3300026116 Bacteria 1695
84 Ga0207683_10031874 3300026121 Bacteria 4577
85 Ga0265357_1002281 3300028023 Bacteria 1549
86 Ga0265338_10058319 3300028800 Bacteria 3408
87 Ga0265762_1009187 3300030760 Bacteria 1762
88 Ga0265763_1000229 3300030763 Bacteria 3091
89 Ga0265760_10015578 3300031090 Bacteria 2179
90 Ga0265332_10084441 3300031238 Bacteria 1346
91 Ga0265325_10027289 3300031241 Bacteria 3086
92 Ga0265340_10001253 3300031247 Bacteria 14589
93 Ga0265340_10005455 3300031247 Bacteria 7064
94 Ga0265339_10000091 3300031249 Bacteria 75937
95 Ga0265331_10031897 3300031250 Bacteria 2616
96 Ga0265316_10016679 3300031344 Bacteria 6366
97 Ga0265313_10000868 3300031595 Bacteria 30518
98 Ga0265313_10033536 3300031595 Bacteria 2608
99 Ga0265342_10009354 3300031712 Bacteria 6916
100 Ga0373940_0039067 3300035088 Bacteria 1298
101 Ga0373944_0002019 3300035089 Bacteria 5143
102 Ga0373923_0018492 3300035111 Bacteria 2683
103 Ga0373945_0016277 3300035116 Bacteria 2506
104 Ga0373953_0027328 3300035117 Bacteria 2192
105 Ga0373954_0037305 3300035118 Bacteria 2259
106 Ga0373954_0050962 3300035118 Bacteria 1943
107 Ga0373956_0005177 3300035119 Bacteria 5223
108 Ga0373957_0005882 3300035120 Bacteria 3832
109 Ga0373943_0000567 3300035170 Bacteria 16034
110 Ga0373946_0002942 3300035171 Bacteria 6038
111 Ga0373946_0012445 3300035171 Bacteria 3185
112 Ga0373955_0010170 3300035172 Bacteria 4434
113 Ga0373955_0064363 3300035172 Bacteria 2033
114 Ga0373961_0011682 3300035241 Bacteria 2183
115 Ga0373924_0015912 3300035410 Bacteria 2866
116 Ga0373924_0025131 3300035410 Bacteria 2353
117 Ga0373931_0009280 3300035691 Bacteria 4699
118 Ga0373935_0213678 3300035692 Unclassified 1337
119 Ga0373935_0217518 3300035692 Bacteria 1326
120 Ga0373927_0002426 3300035695 Bacteria 13595
121 Ga0373927_0029863 3300035695 Bacteria 3555
122 Ga0373933_0015446 3300035724 Bacteria 4255
123 Ga0373933_0247463 3300035724 Bacteria 1148
124 Ga0373947_0017391 3300035725 Bacteria 4135
125 Ga0373947_0024987 3300035725 Bacteria 3483
126 Ga0373947_0031818 3300035725 Bacteria 3107
127 Ga0373947_0091937 3300035725 Bacteria 1894
128 Ga0373937_0000414 3300036401 Bacteria 39843
129 Ga0373937_0001751 3300036401 Bacteria 18265
130 Ga0373925_0003922 3300037068 Bacteria 11355
131 Ga0373925_0177995 3300037068 Bacteria 1682
132 Ga0395899_0091663 3300037312 Bacteria 2202
133 Ga0395899_0164251 3300037312 Bacteria 1567
134 Ga0395900_0148935 3300037418 Bacteria 2392
135 Ga0395898_0008395 3300037466 Bacteria 10923
136 Ga0395898_0009499 3300037466 Bacteria 10212
137 Ga0395898_0089239 3300037466 Bacteria 2967
138 Ga0395905_0127913 3300037471 Bacteria 2389
139 Ga0395901_0008870 3300038443 Bacteria 10181
140 Ga0436363_1682763 3300039450 Bacteria 4267
141 Ga0439435_0070895 3300042436 Bacteria 1031
142 Ga0466963_0007058 3300044694 Bacteria 6687
143 Ga0466964_0023109 3300044706 Bacteria 2416
144 Ga0466957_0097508 3300044842 Bacteria 1849
145 Ga0466967_0058984 3300045976 Bacteria 3394
146 Ga0466967_0100758 3300045976 Bacteria 2639
147 Ga0466967_0152832 3300045976 Bacteria 2159
148 Ga0495592_0001026 3300046454 Bacteria 19392
149 Ga0495629_0001949 3300046459 Bacteria 16087
150 Ga0495651_0000540 3300046462 Bacteria 29195
151 Ga0495653_0001530 3300046463 Bacteria 18079
152 Ga0495653_0016270 3300046463 Bacteria 6060
153 Ga0495653_0020295 3300046463 Bacteria 5388
154 Ga0495580_0024260 3300046472 Bacteria 4444
155 Ga0495582_0125872 3300046473 Bacteria 1446
156 Ga0495639_0039390 3300046475 Bacteria 2125
157 Ga0495662_0000280 3300046476 Bacteria 21964
158 Ga0495664_0000112 3300046477 Bacteria 40522
159 Ga0495664_0016402 3300046477 Bacteria 4218
160 Ga0495608_0000556 3300046511 Bacteria 25760
161 Ga0495618_0001016 3300046514 Bacteria 19217
162 Ga0495618_0001092 3300046514 Bacteria 18392
163 Ga0495628_0021168 3300046516 Bacteria 5354
164 Ga0495630_0050726 3300046517 Bacteria 3105
165 Ga0495666_0067186 3300046526 Bacteria 1708
166 Ga0495652_0021356 3300046529 Bacteria 5757
167 Ga0495665_0027740 3300046531 Bacteria 3038
168 Ga0495665_0058179 3300046531 Bacteria 2041
169 Ga0495640_0000871 3300046533 Bacteria 23106
170 Ga0495640_0020037 3300046533 Bacteria 4930
171 Ga0495587_0001728 3300046536 Bacteria 14579
172 Ga0495645_0004586 3300046543 Bacteria 9430
173 Ga0495645_0025896 3300046543 Bacteria 4258
174 Ga0495667_0001507 3300046559 Bacteria 15361
175 Ga0495667_0012454 3300046559 Bacteria 5767
176 Ga0495634_0002257 3300046642 Bacteria 16158
177 Ga0495634_0003493 3300046642 Bacteria 12595
178 Ga0495634_0033846 3300046642 Bacteria 3509
179 Ga0495635_0002093 3300046663 Bacteria 13548
180 Ga0495635_0002738 3300046663 Bacteria 12081
181 Ga0495599_0009199 3300046678 Bacteria 6030
182 Ga0495646_0048871 3300046680 Bacteria 2569
183 Ga0495646_0054316 3300046680 Bacteria 2410
184 Ga0495647_0065317 3300046681 Unclassified 1445
185 Ga0495658_0157092 3300046683 Bacteria 1400
186 Ga0495658_0209250 3300046683 Bacteria 1218
187 Ga0495613_0015480 3300046689 Bacteria 5672
188 Ga0495613_0087956 3300046689 Bacteria 2252
189 Ga0495624_0001093 3300046690 Bacteria 21434
190 Ga0495600_0000186 3300046809 Bacteria 36306
191 Ga0495604_0000150 3300047317 Bacteria 60582
192 Ga0495604_0156468 3300047317 Bacteria 1614
193 Ga0495674_0001513 3300047319 Bacteria 22779
194 Ga0495674_0023667 3300047319 Bacteria 5657
195 Ga0495672_0005202 3300047320 Bacteria 10370
196 Ga0495676_0183295 3300047321 Bacteria 1466
197 Ga0495676_0261109 3300047321 Unclassified 1178
198 Ga0495680_0000429 3300047322 Bacteria 47078
199 Ga0495680_0011972 3300047322 Bacteria 7656
200 Ga0495675_0001022 3300047444 Bacteria 17001
201 Ga0495684_0000264 3300047471 Bacteria 41677
202 Ga0495684_0001309 3300047471 Bacteria 20014
203 Ga0495684_0016295 3300047471 Bacteria 5722
204 Ga0495602_0005255 3300048088 Bacteria 13574
205 Ga0496100_0305313 3300048903 Bacteria 1192
206 Ga0496101_0011289 3300048904 Bacteria 5921
207 Ga0496101_0075986 3300048904 Bacteria 2474
208 Ga0496101_0492752 3300048904 Bacteria 968
209 Ga0496103_0114581 3300048906 Bacteria 1714
210 Ga0496104_0012511 3300048907 Bacteria 7630
211 Ga0496104_0019416 3300048907 Bacteria 6218
212 Ga0496104_0088980 3300048907 Bacteria 2950
213 Ga0496105_0017953 3300048908 Bacteria 5678
214 Ga0496105_0074364 3300048908 Bacteria 2807
215 Ga0496106_0077604 3300048909 Bacteria 2547
216 Ga0496106_0306101 3300048909 Bacteria 1275
217 Ga0496107_0037926 3300048910 Bacteria 3459
218 Ga0496107_0080801 3300048910 Bacteria 2371
219 Ga0496108_0039215 3300048911 Bacteria 3949
220 Ga0496108_0137027 3300048911 Bacteria 2107
221 Ga0496110_0011677 3300048913 Bacteria 7203
222 Ga0496110_0332906 3300048913 Bacteria 1383
223 Ga0496111_0072032 3300048914 Bacteria 2515
224 Ga0496112_0148862 3300048915 Bacteria 2309
225 Ga0496112_0260506 3300048915 Bacteria 1683
226 Ga0496113_0035443 3300048916 Bacteria 3649
227 Ga0496113_0056054 3300048916 Bacteria 2957
228 Ga0496114_0026104 3300048917 Bacteria 4780
229 Ga0496114_0212455 3300048917 Bacteria 1697
230 Ga0496114_0395526 3300048917 Bacteria 1224
231 Ga0496115_0003484 3300048918 Bacteria 11313
232 Ga0496115_0088277 3300048918 Bacteria 2531
233 Ga0501034_0050791 3300049571 Bacteria 4182
234 Ga0501034_0381301 3300049571 Bacteria 1335
235 Ga0501037_0096870 3300049573 Bacteria 2132
236 Ga0501043_0060814 3300049579 Bacteria 2966
237 Ga0501043_0085744 3300049579 Bacteria 2475
238 Ga0501047_0012274 3300049581 Bacteria 8107
239 Ga0501047_0047710 3300049581 Bacteria 4137
240 Ga0501047_0083951 3300049581 Bacteria 3061
241 Ga0501070_0110133 3300049586 Bacteria 2276
242 Ga0501071_0131713 3300049587 Bacteria 1858
243 Ga0501071_0152071 3300049587 Bacteria 1727
244 Ga0501072_0023939 3300049588 Bacteria 4746
245 Ga0501073_0023856 3300049589 Bacteria 4393
246 Ga0501073_0302643 3300049589 Bacteria 1103
247 Ga0501075_0130065 3300049591 Bacteria 1918
248 Ga0501075_0145790 3300049591 Bacteria 1804
249 Ga0501080_0150089 3300049742 Bacteria 2155
250 Ga0501081_0181457 3300049743 Bacteria 1523
251 Ga0501035_0192892 3300049822 Bacteria 1751
252 Ga0501035_0407403 3300049822 Bacteria 1130
253 Ga0501044_0255410 3300049823 Bacteria 1692
254 Ga0501044_0271481 3300049823 Bacteria 1631
255 Ga0501044_0293838 3300049823 Bacteria 1556
256 nmdc:mga03n38_101146_c1 3300050490 Bacteria 1390
257 nmdc:mga0yw44_122061_c1 3300050492 Bacteria 1679
258 nmdc:mga0yw44_251839_c1 3300050492 Bacteria 1175
259 nmdc:mga0k408_21453_c1 3300050493 Bacteria 3628
260 nmdc:mga06z11_119004_c1 3300050494 Bacteria 1471
261 nmdc:mga06z11_246766_c1 3300050494 Bacteria 1050
262 nmdc:mga06z11_55384_c1 3300050494 Bacteria 2047
263 nmdc:mga07m45_19679_c1 3300050496 Bacteria 2439
264 nmdc:mga07m45_57753_c1 3300050496 Bacteria 2195
265 nmdc:mga05p37_414594_c1 3300050507 Bacteria 1569
266 nmdc:mga05p37_53728_c1 3300050507 Bacteria 4955
267 nmdc:mga09592_112903_c1 3300050508 Bacteria 2331
268 nmdc:mga0qj67_130268_c1 3300050509 Bacteria 2037
269 nmdc:mga0qj67_182_c1 3300050509 Bacteria 42807
270 nmdc:mga08y16_213525_c1 3300050511 Bacteria 1998
271 nmdc:mga08y16_362545_c1 3300050511 Bacteria 1488
272 nmdc:mga08y16_39834_c1 3300050511 Bacteria 4928
273 nmdc:mga0n895_151818_c1 3300050512 Bacteria 2347
274 nmdc:mga0n895_286576_c1 3300050512 Bacteria 1670
275 nmdc:mga0n895_8778_c1 3300050512 Bacteria 8789
276 nmdc:mga0rr50_111317_c1 3300050513 Bacteria 2167
277 nmdc:mga0a205_128308_c1 3300050515 Bacteria 2436
278 nmdc:mga0a205_5777_c2 3300050515 Bacteria 10585
279 Ga0495601_0001951 3300053077 Bacteria 11535
280 Ga0495601_0044469 3300053077 Bacteria 2791
281 Ga0495601_0059964 3300053077 Bacteria 2413
282 Ga0495601_0275840 3300053077 Bacteria 1096
283 Ga0495612_0023891 3300053078 Bacteria 2454
284 Ga0495612_0059822 3300053078 Bacteria 1576
285 Ga0495595_0008639 3300053084 Bacteria 4191
286 Ga0495595_0053765 3300053084 Bacteria 1871
287 Ga0495619_0001598 3300053085 Bacteria 14888
288 Ga0495619_0055011 3300053085 Bacteria 2635
289 Ga0500595_060601 3300053119 Bacteria 1144
290 Ga0500608_012444 3300053122 Bacteria 3732
291 Ga0501084_0223581 3300054114 Bacteria 1588
292 Ga0501082_0129028 3300060353 Bacteria 2194

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0213678 Ga0373935_0213678_289_1122 265
2 3300049587 Ga0501071_0152071 Ga0501071_0152071_145_1002 265
3 3300049591 Ga0501075_0145790 Ga0501075_0145790_348_1205 265
4 3300049822 Ga0501035_0192892 Ga0501035_0192892_378_1235 265
5 3300031247 Ga0265340_10001253 Ga0265340_100012536 268
6 3300031250 Ga0265331_10031897 Ga0265331_100318974 268
7 3300031344 Ga0265316_10016679 Ga0265316_100166795 268
8 3300031595 Ga0265313_10000868 Ga0265313_1000086814 268
9 3300031712 Ga0265342_10009354 Ga0265342_100093543 268
10 3300049571 Ga0501034_0050791 Ga0501034_0050791_1196_2110 273
11 3300044694 Ga0466963_0007058 Ga0466963_0007058_5768_6631 287
12 3300053122 Ga0500608_012444 Ga0500608_012444_1213_2130 288
13 3300009094 Ga0111539_10238126 Ga0111539_102381261 289
14 3300031595 Ga0265313_10033536 Ga0265313_100335363 289
15 3300035116 Ga0373945_0016277 Ga0373945_0016277_21_926 289
16 3300035117 Ga0373953_0027328 Ga0373953_0027328_1312_2181 289
17 3300035724 Ga0373933_0247463 Ga0373933_0247463_239_1111 289
18 3300048913 Ga0496110_0332906 Ga0496110_0332906_494_1366 289
19 3300049579 Ga0501043_0085744 Ga0501043_0085744_971_1852 289
20 3300050511 nmdc:mga08y16_362545_c1 nmdc:mga08y16_362545_c1_163_1038 289
21 3300050512 nmdc:mga0n895_286576_c1 nmdc:mga0n895_286576_c1_250_1125 289
22 3300050513 nmdc:mga0rr50_111317_c1 nmdc:mga0rr50_111317_c1_537_1412 289
23 3300050515 nmdc:mga0a205_128308_c1 nmdc:mga0a205_128308_c1_87_962 289
24 3300053085 Ga0495619_0055011 Ga0495619_0055011_17_886 289
25 3300048909 Ga0496106_0306101 Ga0496106_0306101_176_1099 292
26 3300037312 Ga0395899_0091663 Ga0395899_0091663_672_1577 298
27 3300037312 Ga0395899_0164251 Ga0395899_0164251_619_1524 298
28 3300037418 Ga0395900_0148935 Ga0395900_0148935_1052_1957 298
29 3300037466 Ga0395898_0008395 Ga0395898_0008395_7550_8455 298
30 3300037466 Ga0395898_0009499 Ga0395898_0009499_1311_2216 298
31 3300037471 Ga0395905_0127913 Ga0395905_0127913_1365_2270 298
32 3300038443 Ga0395901_0008870 Ga0395901_0008870_1319_2224 298
33 3300005458 Ga0070681_10458549 Ga0070681_104585491 299
34 3300025921 Ga0207652_10236468 Ga0207652_102364682 299
35 3300035118 Ga0373954_0037305 Ga0373954_0037305_540_1448 299
36 3300035119 Ga0373956_0005177 Ga0373956_0005177_4287_5195 299
37 3300035120 Ga0373957_0005882 Ga0373957_0005882_1605_2513 299
38 3300036401 Ga0373937_0001751 Ga0373937_0001751_960_1868 299
39 3300046463 Ga0495653_0016270 Ga0495653_0016270_4340_5248 299
40 3300046559 Ga0495667_0012454 Ga0495667_0012454_869_1777 299
41 3300047322 Ga0495680_0011972 Ga0495680_0011972_5574_6482 299
42 3300048904 Ga0496101_0075986 Ga0496101_0075986_1057_1965 299
43 3300048907 Ga0496104_0088980 Ga0496104_0088980_1141_2049 299
44 3300048917 Ga0496114_0212455 Ga0496114_0212455_160_1068 299
45 3300049571 Ga0501034_0381301 Ga0501034_0381301_198_1115 299
46 3300049581 Ga0501047_0083951 Ga0501047_0083951_173_1096 299
47 3300049586 Ga0501070_0110133 Ga0501070_0110133_599_1522 299
48 3300049587 Ga0501071_0131713 Ga0501071_0131713_139_1050 299
49 3300049588 Ga0501072_0023939 Ga0501072_0023939_2663_3574 299
50 3300049591 Ga0501075_0130065 Ga0501075_0130065_322_1233 299
51 3300049823 Ga0501044_0255410 Ga0501044_0255410_417_1340 299
52 3300049823 Ga0501044_0293838 Ga0501044_0293838_504_1427 299
53 3300053077 Ga0495601_0044469 Ga0495601_0044469_1022_1930 299
54 3300053084 Ga0495595_0053765 Ga0495595_0053765_796_1704 299
55 3300054114 Ga0501084_0223581 Ga0501084_0223581_495_1406 299
56 3300060353 Ga0501082_0129028 Ga0501082_0129028_1089_1994 299
57 3300005983 Ga0081540_1000783 Ga0081540_100078315 300
58 3300044706 Ga0466964_0023109 Ga0466964_0023109_975_1913 300
59 3300045976 Ga0466967_0058984 Ga0466967_0058984_660_1598 300
60 3300045976 Ga0466967_0152832 Ga0466967_0152832_1043_1972 300
61 3300046689 Ga0495613_0087956 Ga0495613_0087956_531_1445 300
62 3300005336 Ga0070680_100378555 Ga0070680_1003785552 301
63 3300005366 Ga0070659_100228716 Ga0070659_1002287162 301
64 3300005458 Ga0070681_10060642 Ga0070681_100606422 301
65 3300005458 Ga0070681_10204223 Ga0070681_102042232 301
66 3300005577 Ga0068857_100253695 Ga0068857_1002536952 301
67 3300013104 Ga0157370_10284034 Ga0157370_102840342 301
68 3300025912 Ga0207707_10003185 Ga0207707_1000318510 301
69 3300025912 Ga0207707_10043578 Ga0207707_100435782 301
70 3300025913 Ga0207695_10143915 Ga0207695_101439152 301
71 3300025917 Ga0207660_10152777 Ga0207660_101527772 301
72 3300025921 Ga0207652_10015640 Ga0207652_100156402 301
73 3300025932 Ga0207690_10155530 Ga0207690_101555302 301
74 3300026116 Ga0207674_10256637 Ga0207674_102566372 301
75 3300030760 Ga0265762_1009187 Ga0265762_10091872 301
76 iso_pu_bacteria 2751185782 2753267116 301
77 3300003215 JGI25153J46596_10004936 JGI25153J46596_100049366 302
78 3300005328 Ga0070676_10046801 Ga0070676_100468012 302
79 3300005336 Ga0070680_100004467 Ga0070680_1000044679 302
80 3300005338 Ga0068868_100332455 Ga0068868_1003324552 302
81 3300005340 Ga0070689_100027771 Ga0070689_1000277711 302
82 3300005354 Ga0070675_100107762 Ga0070675_1001077621 302
83 3300005356 Ga0070674_100006024 Ga0070674_1000060243 302
84 3300005434 Ga0070709_10247853 Ga0070709_102478531 302
85 3300005435 Ga0070714_100172494 Ga0070714_1001724941 302
86 3300005436 Ga0070713_100147357 Ga0070713_1001473573 302
87 3300005441 Ga0070700_100399340 Ga0070700_1003993401 302
88 3300005456 Ga0070678_100159820 Ga0070678_1001598202 302
89 3300005458 Ga0070681_10071718 Ga0070681_100717182 302
90 3300005458 Ga0070681_10118389 Ga0070681_101183892 302
91 3300005530 Ga0070679_100015110 Ga0070679_1000151104 302
92 3300005530 Ga0070679_100198327 Ga0070679_1001983272 302
93 3300005618 Ga0068864_100058574 Ga0068864_1000585743 302
94 3300005719 Ga0068861_100263622 Ga0068861_1002636222 302
95 3300005719 Ga0068861_100446412 Ga0068861_1004464121 302
96 3300005981 Ga0081538_10005276 Ga0081538_100052768 302
97 3300005983 Ga0081540_1012091 Ga0081540_10120915 302
98 3300006038 Ga0075365_10166792 Ga0075365_101667922 302
99 3300006048 Ga0075363_100071132 Ga0075363_1000711322 302
100 3300006051 Ga0075364_10099513 Ga0075364_100995132 302
101 3300006175 Ga0070712_100166469 Ga0070712_1001664693 302
102 3300006178 Ga0075367_10104956 Ga0075367_101049562 302
103 3300006178 Ga0075367_10248845 Ga0075367_102488452 302
104 3300006353 Ga0075370_10168395 Ga0075370_101683952 302
105 3300006844 Ga0075428_100031003 Ga0075428_1000310033 302
106 3300006852 Ga0075433_10060250 Ga0075433_100602502 302
107 3300006871 Ga0075434_100023265 Ga0075434_1000232652 302
108 3300006871 Ga0075434_100046995 Ga0075434_1000469954 302
109 3300006871 Ga0075434_100200424 Ga0075434_1002004242 302
110 3300006880 Ga0075429_100102549 Ga0075429_1001025493 302
111 3300006880 Ga0075429_100176150 Ga0075429_1001761502 302
112 3300007076 Ga0075435_100071993 Ga0075435_1000719932 302
113 3300009093 Ga0105240_10022753 Ga0105240_100227535 302
114 3300009094 Ga0111539_10025601 Ga0111539_100256012 302
115 3300009094 Ga0111539_10248379 Ga0111539_102483792 302
116 3300009176 Ga0105242_10106809 Ga0105242_101068091 302
117 3300013104 Ga0157370_10007782 Ga0157370_100077829 302
118 3300013297 Ga0157378_10425506 Ga0157378_104255061 302
119 3300013306 Ga0163162_10386020 Ga0163162_103860201 302
120 3300013307 Ga0157372_10382709 Ga0157372_103827092 302
121 3300013308 Ga0157375_10309606 Ga0157375_103096062 302
122 3300014325 Ga0163163_10096952 Ga0163163_100969522 302
123 3300014497 Ga0182008_10014409 Ga0182008_100144093 302
124 3300024225 Ga0224572_1000501 Ga0224572_10005015 302
125 3300025297 Ga0209758_1000669 Ga0209758_100066943 302
126 3300025302 Ga0207426_1021815 Ga0207426_10218151 302
127 3300025315 Ga0207697_10069955 Ga0207697_100699552 302
128 3300025901 Ga0207688_10141639 Ga0207688_101416392 302
129 3300025907 Ga0207645_10064680 Ga0207645_100646802 302
130 3300025915 Ga0207693_10242119 Ga0207693_102421192 302
131 3300025916 Ga0207663_10053042 Ga0207663_100530422 302
132 3300025918 Ga0207662_10046392 Ga0207662_100463922 302
133 3300025926 Ga0207659_10069857 Ga0207659_100698571 302
134 3300025928 Ga0207700_10058667 Ga0207700_100586671 302
135 3300025928 Ga0207700_10360552 Ga0207700_103605521 302
136 3300025934 Ga0207686_10016294 Ga0207686_100162944 302
137 3300025936 Ga0207670_10006490 Ga0207670_100064902 302
138 3300025936 Ga0207670_10212352 Ga0207670_102123521 302
139 3300025937 Ga0207669_10048303 Ga0207669_100483032 302
140 3300025939 Ga0207665_10095407 Ga0207665_100954072 302
141 3300025941 Ga0207711_10023965 Ga0207711_100239653 302
142 3300026095 Ga0207676_10043073 Ga0207676_100430732 302
143 3300026121 Ga0207683_10031874 Ga0207683_100318743 302
144 3300028023 Ga0265357_1002281 Ga0265357_10022811 302
145 3300028800 Ga0265338_10058319 Ga0265338_100583193 302
146 3300030763 Ga0265763_1000229 Ga0265763_10002293 302
147 3300031090 Ga0265760_10015578 Ga0265760_100155783 302
148 3300031238 Ga0265332_10084441 Ga0265332_100844411 302
149 3300031241 Ga0265325_10027289 Ga0265325_100272892 302
150 3300031247 Ga0265340_10005455 Ga0265340_100054555 302
151 3300031249 Ga0265339_10000091 Ga0265339_1000009126 302
152 3300035088 Ga0373940_0039067 Ga0373940_0039067_19_927 302
153 3300035089 Ga0373944_0002019 Ga0373944_0002019_494_1447 302
154 3300035111 Ga0373923_0018492 Ga0373923_0018492_383_1303 302
155 3300035118 Ga0373954_0050962 Ga0373954_0050962_251_1171 302
156 3300035170 Ga0373943_0000567 Ga0373943_0000567_8833_9786 302
157 3300035171 Ga0373946_0002942 Ga0373946_0002942_1760_2713 302
158 3300035171 Ga0373946_0012445 Ga0373946_0012445_746_1699 302
159 3300035172 Ga0373955_0010170 Ga0373955_0010170_3060_3980 302
160 3300035172 Ga0373955_0064363 Ga0373955_0064363_832_1740 302
161 3300035241 Ga0373961_0011682 Ga0373961_0011682_519_1427 302
162 3300035410 Ga0373924_0015912 Ga0373924_0015912_490_1443 302
163 3300035410 Ga0373924_0025131 Ga0373924_0025131_1284_2204 302
164 3300035691 Ga0373931_0009280 Ga0373931_0009280_2505_3413 302
165 3300035692 Ga0373935_0217518 Ga0373935_0217518_184_1092 302
166 3300035695 Ga0373927_0002426 Ga0373927_0002426_12000_12953 302
167 3300035695 Ga0373927_0029863 Ga0373927_0029863_1275_2228 302
168 3300035724 Ga0373933_0015446 Ga0373933_0015446_2552_3472 302
169 3300035725 Ga0373947_0017391 Ga0373947_0017391_1855_2808 302
170 3300035725 Ga0373947_0024987 Ga0373947_0024987_1184_2137 302
171 3300035725 Ga0373947_0031818 Ga0373947_0031818_1169_2089 302
172 3300035725 Ga0373947_0091937 Ga0373947_0091937_749_1672 302
173 3300036401 Ga0373937_0000414 Ga0373937_0000414_27321_28241 302
174 3300037068 Ga0373925_0003922 Ga0373925_0003922_7700_8653 302
175 3300037068 Ga0373925_0177995 Ga0373925_0177995_237_1187 302
176 3300037466 Ga0395898_0089239 Ga0395898_0089239_1469_2389 302
177 3300039450 Ga0436363_1682763 Ga0436363_1682763_451_1383 302
178 3300042436 Ga0439435_0070895 Ga0439435_0070895_109_1020 302
179 3300044842 Ga0466957_0097508 Ga0466957_0097508_541_1518 302
180 3300045976 Ga0466967_0100758 Ga0466967_0100758_230_1159 302
181 3300046454 Ga0495592_0001026 Ga0495592_0001026_7763_8683 302
182 3300046459 Ga0495629_0001949 Ga0495629_0001949_4315_5235 302
183 3300046462 Ga0495651_0000540 Ga0495651_0000540_4422_5342 302
184 3300046463 Ga0495653_0001530 Ga0495653_0001530_14361_15281 302
185 3300046463 Ga0495653_0020295 Ga0495653_0020295_3003_3956 302
186 3300046472 Ga0495580_0024260 Ga0495580_0024260_3445_4398 302
187 3300046473 Ga0495582_0125872 Ga0495582_0125872_320_1243 302
188 3300046475 Ga0495639_0039390 Ga0495639_0039390_680_1633 302
189 3300046476 Ga0495662_0000280 Ga0495662_0000280_9461_10414 302
190 3300046477 Ga0495664_0000112 Ga0495664_0000112_21537_22490 302
191 3300046477 Ga0495664_0016402 Ga0495664_0016402_349_1269 302
192 3300046511 Ga0495608_0000556 Ga0495608_0000556_873_1793 302
193 3300046514 Ga0495618_0001016 Ga0495618_0001016_15834_16787 302
194 3300046514 Ga0495618_0001092 Ga0495618_0001092_15845_16765 302
195 3300046516 Ga0495628_0021168 Ga0495628_0021168_4309_5229 302
196 3300046517 Ga0495630_0050726 Ga0495630_0050726_349_1302 302
197 3300046526 Ga0495666_0067186 Ga0495666_0067186_716_1669 302
198 3300046529 Ga0495652_0021356 Ga0495652_0021356_571_1491 302
199 3300046531 Ga0495665_0027740 Ga0495665_0027740_1532_2485 302
200 3300046531 Ga0495665_0058179 Ga0495665_0058179_457_1410 302
201 3300046533 Ga0495640_0000871 Ga0495640_0000871_13855_14808 302
202 3300046533 Ga0495640_0020037 Ga0495640_0020037_3909_4829 302
203 3300046536 Ga0495587_0001728 Ga0495587_0001728_9124_10044 302
204 3300046543 Ga0495645_0004586 Ga0495645_0004586_1911_2864 302
205 3300046543 Ga0495645_0025896 Ga0495645_0025896_3279_4199 302
206 3300046559 Ga0495667_0001507 Ga0495667_0001507_6132_7052 302
207 3300046642 Ga0495634_0002257 Ga0495634_0002257_9793_10713 302
208 3300046642 Ga0495634_0003493 Ga0495634_0003493_9860_10813 302
209 3300046642 Ga0495634_0033846 Ga0495634_0033846_2081_3034 302
210 3300046663 Ga0495635_0002093 Ga0495635_0002093_10685_11638 302
211 3300046663 Ga0495635_0002738 Ga0495635_0002738_7439_8359 302
212 3300046678 Ga0495599_0009199 Ga0495599_0009199_2720_3640 302
213 3300046680 Ga0495646_0048871 Ga0495646_0048871_1405_2358 302
214 3300046680 Ga0495646_0054316 Ga0495646_0054316_870_1790 302
215 3300046681 Ga0495647_0065317 Ga0495647_0065317_326_1279 302
216 3300046683 Ga0495658_0157092 Ga0495658_0157092_262_1185 302
217 3300046683 Ga0495658_0209250 Ga0495658_0209250_106_1026 302
218 3300046689 Ga0495613_0015480 Ga0495613_0015480_149_1069 302
219 3300046690 Ga0495624_0001093 Ga0495624_0001093_18737_19690 302
220 3300046809 Ga0495600_0000186 Ga0495600_0000186_21319_22239 302
221 3300047317 Ga0495604_0000150 Ga0495604_0000150_4138_5058 302
222 3300047317 Ga0495604_0156468 Ga0495604_0156468_40_993 302
223 3300047319 Ga0495674_0001513 Ga0495674_0001513_2063_3016 302
224 3300047319 Ga0495674_0023667 Ga0495674_0023667_1817_2737 302
225 3300047320 Ga0495672_0005202 Ga0495672_0005202_2491_3474 302
226 3300047321 Ga0495676_0183295 Ga0495676_0183295_496_1419 302
227 3300047321 Ga0495676_0261109 Ga0495676_0261109_55_1008 302
228 3300047322 Ga0495680_0000429 Ga0495680_0000429_29021_29941 302
229 3300047444 Ga0495675_0001022 Ga0495675_0001022_15371_16291 302
230 3300047471 Ga0495684_0000264 Ga0495684_0000264_38627_39580 302
231 3300047471 Ga0495684_0001309 Ga0495684_0001309_2122_3075 302
232 3300047471 Ga0495684_0016295 Ga0495684_0016295_1305_2258 302
233 3300048088 Ga0495602_0005255 Ga0495602_0005255_11728_12648 302
234 3300048903 Ga0496100_0305313 Ga0496100_0305313_41_952 302
235 3300048904 Ga0496101_0011289 Ga0496101_0011289_2915_3823 302
236 3300048904 Ga0496101_0492752 Ga0496101_0492752_31_951 302
237 3300048906 Ga0496103_0114581 Ga0496103_0114581_642_1550 302
238 3300048907 Ga0496104_0012511 Ga0496104_0012511_772_1680 302
239 3300048907 Ga0496104_0019416 Ga0496104_0019416_3072_3983 302
240 3300048908 Ga0496105_0017953 Ga0496105_0017953_55_966 302
241 3300048908 Ga0496105_0074364 Ga0496105_0074364_882_1802 302
242 3300048909 Ga0496106_0077604 Ga0496106_0077604_64_972 302
243 3300048910 Ga0496107_0037926 Ga0496107_0037926_1551_2459 302
244 3300048910 Ga0496107_0080801 Ga0496107_0080801_1041_1952 302
245 3300048911 Ga0496108_0039215 Ga0496108_0039215_1663_2571 302
246 3300048911 Ga0496108_0137027 Ga0496108_0137027_1180_2088 302
247 3300048913 Ga0496110_0011677 Ga0496110_0011677_3293_4201 302
248 3300048914 Ga0496111_0072032 Ga0496111_0072032_560_1468 302
249 3300048915 Ga0496112_0148862 Ga0496112_0148862_425_1345 302
250 3300048915 Ga0496112_0260506 Ga0496112_0260506_310_1218 302
251 3300048916 Ga0496113_0035443 Ga0496113_0035443_25_933 302
252 3300048916 Ga0496113_0056054 Ga0496113_0056054_1580_2488 302
253 3300048917 Ga0496114_0026104 Ga0496114_0026104_715_1626 302
254 3300048917 Ga0496114_0395526 Ga0496114_0395526_171_1082 302
255 3300048918 Ga0496115_0003484 Ga0496115_0003484_2069_2980 302
256 3300048918 Ga0496115_0088277 Ga0496115_0088277_450_1358 302
257 3300049573 Ga0501037_0096870 Ga0501037_0096870_292_1203 302
258 3300049579 Ga0501043_0060814 Ga0501043_0060814_912_1841 302
259 3300049581 Ga0501047_0012274 Ga0501047_0012274_3103_4014 302
260 3300049581 Ga0501047_0047710 Ga0501047_0047710_1246_2175 302
261 3300049589 Ga0501073_0023856 Ga0501073_0023856_2282_3193 302
262 3300049589 Ga0501073_0302643 Ga0501073_0302643_27_953 302
263 3300049742 Ga0501080_0150089 Ga0501080_0150089_246_1172 302
264 3300049743 Ga0501081_0181457 Ga0501081_0181457_131_1048 302
265 3300049822 Ga0501035_0407403 Ga0501035_0407403_102_1031 302
266 3300049823 Ga0501044_0271481 Ga0501044_0271481_195_1106 302
267 3300050490 nmdc:mga03n38_101146_c1 nmdc:mga03n38_101146_c1_352_1272 302
268 3300050492 nmdc:mga0yw44_122061_c1 nmdc:mga0yw44_122061_c1_740_1660 302
269 3300050492 nmdc:mga0yw44_251839_c1 nmdc:mga0yw44_251839_c1_225_1145 302
270 3300050493 nmdc:mga0k408_21453_c1 nmdc:mga0k408_21453_c1_763_1671 302
271 3300050494 nmdc:mga06z11_119004_c1 nmdc:mga06z11_119004_c1_201_1109 302
272 3300050494 nmdc:mga06z11_246766_c1 nmdc:mga06z11_246766_c1_17_937 302
273 3300050494 nmdc:mga06z11_55384_c1 nmdc:mga06z11_55384_c1_162_1070 302
274 3300050496 nmdc:mga07m45_19679_c1 nmdc:mga07m45_19679_c1_1479_2399 302
275 3300050496 nmdc:mga07m45_57753_c1 nmdc:mga07m45_57753_c1_1245_2165 302
276 3300050507 nmdc:mga05p37_414594_c1 nmdc:mga05p37_414594_c1_78_1001 302
277 3300050507 nmdc:mga05p37_53728_c1 nmdc:mga05p37_53728_c1_3665_4663 302
278 3300050508 nmdc:mga09592_112903_c1 nmdc:mga09592_112903_c1_230_1153 302
279 3300050509 nmdc:mga0qj67_130268_c1 nmdc:mga0qj67_130268_c1_666_1589 302
280 3300050509 nmdc:mga0qj67_182_c1 nmdc:mga0qj67_182_c1_27396_28313 302
281 3300050511 nmdc:mga08y16_213525_c1 nmdc:mga08y16_213525_c1_434_1354 302
282 3300050511 nmdc:mga08y16_39834_c1 nmdc:mga08y16_39834_c1_3805_4734 302
283 3300050512 nmdc:mga0n895_151818_c1 nmdc:mga0n895_151818_c1_464_1384 302
284 3300050512 nmdc:mga0n895_8778_c1 nmdc:mga0n895_8778_c1_4206_5132 302
285 3300050515 nmdc:mga0a205_5777_c2 nmdc:mga0a205_5777_c2_8400_9320 302
286 3300053077 Ga0495601_0001951 Ga0495601_0001951_1875_2828 302
287 3300053077 Ga0495601_0059964 Ga0495601_0059964_642_1562 302
288 3300053077 Ga0495601_0275840 Ga0495601_0275840_73_981 302
289 3300053078 Ga0495612_0023891 Ga0495612_0023891_1391_2344 302
290 3300053078 Ga0495612_0059822 Ga0495612_0059822_74_994 302
291 3300053084 Ga0495595_0008639 Ga0495595_0008639_602_1522 302
292 3300053085 Ga0495619_0001598 Ga0495619_0001598_1207_2160 302
293 3300053119 Ga0500595_060601 Ga0500595_060601_110_1036 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

10

181

0.95

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

183

281

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9876 4 36
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9842 4 33
4rep-assembly1.cif.gz_A crystal structure of gamma-carotenoid desaturase 0.9807 4 36
6j0z-assembly1.cif.gz_C-2 crystal structure of alpk 0.9802 6 36
3fmw-assembly1.cif.gz_A the crystal structure of mtmoiv, a baeyer-villiger monooxygenase from the mithramycin biosynthetic pathway in streptomyces argillaceus. 0.9787 6 33
ID Description Score Start End Superfamily
6j0zC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9802 6 36 3.50.50.60
af_C0VXV5_2_190_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9714 4 180 3.40.50.720
af_I1MHA5_112_472_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9615 5 32 3.50.50.60
af_Q811X6_1_192_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9588 4 180 3.40.50.720
af_O06538_2_320_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9577 4 35 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A520ZUW8-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase family protein 0.9851 58 300 GO:0006635
GO:0008691
GO:0070403
AF-A0A327KL20-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9818 61 300 GO:0006635
GO:0008691
GO:0070403
AF-A0A2S6TA22-F1-model_v4 Putative 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.977 1 252 GO:0006635
GO:0008691
GO:0070403
AF-A0A654ZEY4-F1-model_v4 deleted 0.974 80 301
AF-A0A2S6TA22-F1-model_v4 Putative 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9732 1 252 GO:0006635
GO:0008691
GO:0070403

Feature Viewer

pLDDT pTM Quality
95.28 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map