F391652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 293 | 194 | 292 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0152832|Ga0466967_0152832_1043_1972 |
| Length | 309 |
| Sequence | MADTPRVDGRAAVIGGGLMGHGIAQVLALAGMDVAVHDPVPAALESVPERIAANLRALRIDREAPVALEPELEHAVEGAEWVFEAAPENLELKQEIFARLDAAAGERTILATNTSVMKVGDIGARAQRRGRIVGTHWWNPPYLVRLVEVVQGPETEPATVQRTLELLEALGKTAVHVRRDVAGFVGNRLQHALWREAFDLVDKGVCDPETIDTVIKAGFGSRLPVLGPIENADLVGLDLTLAIHEYVLPELDPPSQPSPGLRRRVEQGQLGMKTGSGFRSWSSEDAAAVRERLLAHLIAVTSHQGGGGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 19 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 20 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 21 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 22 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 23 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 24 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 25 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 27 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 28 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 29 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 30 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 31 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 32 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 43 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 44 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 68 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 70 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 73 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 74 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 75 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 76 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 77 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 78 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 79 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 80 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 81 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 82 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 83 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 84 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 85 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 86 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 87 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 88 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 89 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 90 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 91 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 92 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 93 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 95 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 96 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 97 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 98 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 101 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 102 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 103 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 106 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 107 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 108 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 109 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 110 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 111 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 162 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 176 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 178 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 192 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 193 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.63 |
| Metatranscriptomes | 1.02 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.83 |
| Nodule | 0 |
| Rhizoplane | 9.56 |
| Rhizosphere | 83.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10004936 | 3300003215 | Bacteria | 7088 |
| 2 | Ga0070676_10046801 | 3300005328 | Bacteria | 2524 |
| 3 | Ga0070680_100004467 | 3300005336 | Bacteria | 10538 |
| 4 | Ga0070680_100378555 | 3300005336 | Bacteria | 1205 |
| 5 | Ga0068868_100332455 | 3300005338 | Bacteria | 1297 |
| 6 | Ga0070689_100027771 | 3300005340 | Bacteria | 4269 |
| 7 | Ga0070675_100107762 | 3300005354 | Bacteria | 2353 |
| 8 | Ga0070674_100006024 | 3300005356 | Bacteria | 7046 |
| 9 | Ga0070659_100228716 | 3300005366 | Bacteria | 1537 |
| 10 | Ga0070709_10247853 | 3300005434 | Bacteria | 1282 |
| 11 | Ga0070714_100172494 | 3300005435 | Bacteria | 1964 |
| 12 | Ga0070713_100147357 | 3300005436 | Bacteria | 2091 |
| 13 | Ga0070700_100399340 | 3300005441 | Bacteria | 1033 |
| 14 | Ga0070678_100159820 | 3300005456 | Bacteria | 1824 |
| 15 | Ga0070681_10060642 | 3300005458 | Bacteria | 3758 |
| 16 | Ga0070681_10071718 | 3300005458 | Bacteria | 3428 |
| 17 | Ga0070681_10118389 | 3300005458 | Bacteria | 2585 |
| 18 | Ga0070681_10204223 | 3300005458 | Bacteria | 1893 |
| 19 | Ga0070681_10458549 | 3300005458 | Bacteria | 1187 |
| 20 | Ga0070679_100015110 | 3300005530 | Bacteria | 7420 |
| 21 | Ga0070679_100198327 | 3300005530 | Bacteria | 1974 |
| 22 | Ga0068857_100253695 | 3300005577 | Bacteria | 1613 |
| 23 | Ga0068864_100058574 | 3300005618 | Bacteria | 3330 |
| 24 | Ga0068861_100263622 | 3300005719 | Bacteria | 1476 |
| 25 | Ga0068861_100446412 | 3300005719 | Bacteria | 1158 |
| 26 | Ga0081538_10005276 | 3300005981 | Bacteria | 11663 |
| 27 | Ga0081540_1000783 | 3300005983 | Bacteria | 29165 |
| 28 | Ga0081540_1012091 | 3300005983 | Bacteria | 5711 |
| 29 | Ga0075365_10166792 | 3300006038 | Bacteria | 1536 |
| 30 | Ga0075363_100071132 | 3300006048 | Bacteria | 1890 |
| 31 | Ga0075364_10099513 | 3300006051 | Bacteria | 1935 |
| 32 | Ga0070712_100166469 | 3300006175 | Bacteria | 1707 |
| 33 | Ga0075367_10104956 | 3300006178 | Bacteria | 1730 |
| 34 | Ga0075367_10248845 | 3300006178 | Bacteria | 1115 |
| 35 | Ga0075370_10168395 | 3300006353 | Bacteria | 1287 |
| 36 | Ga0075428_100031003 | 3300006844 | Bacteria | 5913 |
| 37 | Ga0075433_10060250 | 3300006852 | Bacteria | 3323 |
| 38 | Ga0075434_100023265 | 3300006871 | Bacteria | 6035 |
| 39 | Ga0075434_100046995 | 3300006871 | Bacteria | 4283 |
| 40 | Ga0075434_100200424 | 3300006871 | Bacteria | 2016 |
| 41 | Ga0075429_100102549 | 3300006880 | Bacteria | 2498 |
| 42 | Ga0075429_100176150 | 3300006880 | Bacteria | 1874 |
| 43 | Ga0075435_100071993 | 3300007076 | Bacteria | 2823 |
| 44 | Ga0105240_10022753 | 3300009093 | Bacteria | 8303 |
| 45 | Ga0111539_10025601 | 3300009094 | Bacteria | 7231 |
| 46 | Ga0111539_10238126 | 3300009094 | Bacteria | 2118 |
| 47 | Ga0111539_10248379 | 3300009094 | Bacteria | 2072 |
| 48 | Ga0105242_10106809 | 3300009176 | Bacteria | 2380 |
| 49 | Ga0157370_10007782 | 3300013104 | Bacteria | 11617 |
| 50 | Ga0157370_10284034 | 3300013104 | Bacteria | 1529 |
| 51 | Ga0157378_10425506 | 3300013297 | Bacteria | 1313 |
| 52 | Ga0163162_10386020 | 3300013306 | Bacteria | 1534 |
| 53 | Ga0157372_10382709 | 3300013307 | Bacteria | 1639 |
| 54 | Ga0157375_10309606 | 3300013308 | Bacteria | 1744 |
| 55 | Ga0163163_10096952 | 3300014325 | Bacteria | 2969 |
| 56 | Ga0182008_10014409 | 3300014497 | Bacteria | 4140 |
| 57 | Ga0224572_1000501 | 3300024225 | Bacteria | 4705 |
| 58 | Ga0209758_1000669 | 3300025297 | Bacteria | 51286 |
| 59 | Ga0207426_1021815 | 3300025302 | Bacteria | 2208 |
| 60 | Ga0207697_10069955 | 3300025315 | Bacteria | 1470 |
| 61 | Ga0207688_10141639 | 3300025901 | Bacteria | 1415 |
| 62 | Ga0207645_10064680 | 3300025907 | Bacteria | 2337 |
| 63 | Ga0207707_10003185 | 3300025912 | Bacteria | 14568 |
| 64 | Ga0207707_10043578 | 3300025912 | Bacteria | 3913 |
| 65 | Ga0207695_10143915 | 3300025913 | Bacteria | 2330 |
| 66 | Ga0207693_10242119 | 3300025915 | Bacteria | 1416 |
| 67 | Ga0207663_10053042 | 3300025916 | Bacteria | 2532 |
| 68 | Ga0207660_10152777 | 3300025917 | Bacteria | 1775 |
| 69 | Ga0207662_10046392 | 3300025918 | Bacteria | 2570 |
| 70 | Ga0207652_10015640 | 3300025921 | Bacteria | 6176 |
| 71 | Ga0207652_10236468 | 3300025921 | Bacteria | 1647 |
| 72 | Ga0207659_10069857 | 3300025926 | Bacteria | 2560 |
| 73 | Ga0207700_10058667 | 3300025928 | Bacteria | 2908 |
| 74 | Ga0207700_10360552 | 3300025928 | Bacteria | 1267 |
| 75 | Ga0207690_10155530 | 3300025932 | Bacteria | 1699 |
| 76 | Ga0207686_10016294 | 3300025934 | Bacteria | 4170 |
| 77 | Ga0207670_10006490 | 3300025936 | Bacteria | 6489 |
| 78 | Ga0207670_10212352 | 3300025936 | Bacteria | 1477 |
| 79 | Ga0207669_10048303 | 3300025937 | Bacteria | 2527 |
| 80 | Ga0207665_10095407 | 3300025939 | Bacteria | 2067 |
| 81 | Ga0207711_10023965 | 3300025941 | Bacteria | 5108 |
| 82 | Ga0207676_10043073 | 3300026095 | Bacteria | 3473 |
| 83 | Ga0207674_10256637 | 3300026116 | Bacteria | 1695 |
| 84 | Ga0207683_10031874 | 3300026121 | Bacteria | 4577 |
| 85 | Ga0265357_1002281 | 3300028023 | Bacteria | 1549 |
| 86 | Ga0265338_10058319 | 3300028800 | Bacteria | 3408 |
| 87 | Ga0265762_1009187 | 3300030760 | Bacteria | 1762 |
| 88 | Ga0265763_1000229 | 3300030763 | Bacteria | 3091 |
| 89 | Ga0265760_10015578 | 3300031090 | Bacteria | 2179 |
| 90 | Ga0265332_10084441 | 3300031238 | Bacteria | 1346 |
| 91 | Ga0265325_10027289 | 3300031241 | Bacteria | 3086 |
| 92 | Ga0265340_10001253 | 3300031247 | Bacteria | 14589 |
| 93 | Ga0265340_10005455 | 3300031247 | Bacteria | 7064 |
| 94 | Ga0265339_10000091 | 3300031249 | Bacteria | 75937 |
| 95 | Ga0265331_10031897 | 3300031250 | Bacteria | 2616 |
| 96 | Ga0265316_10016679 | 3300031344 | Bacteria | 6366 |
| 97 | Ga0265313_10000868 | 3300031595 | Bacteria | 30518 |
| 98 | Ga0265313_10033536 | 3300031595 | Bacteria | 2608 |
| 99 | Ga0265342_10009354 | 3300031712 | Bacteria | 6916 |
| 100 | Ga0373940_0039067 | 3300035088 | Bacteria | 1298 |
| 101 | Ga0373944_0002019 | 3300035089 | Bacteria | 5143 |
| 102 | Ga0373923_0018492 | 3300035111 | Bacteria | 2683 |
| 103 | Ga0373945_0016277 | 3300035116 | Bacteria | 2506 |
| 104 | Ga0373953_0027328 | 3300035117 | Bacteria | 2192 |
| 105 | Ga0373954_0037305 | 3300035118 | Bacteria | 2259 |
| 106 | Ga0373954_0050962 | 3300035118 | Bacteria | 1943 |
| 107 | Ga0373956_0005177 | 3300035119 | Bacteria | 5223 |
| 108 | Ga0373957_0005882 | 3300035120 | Bacteria | 3832 |
| 109 | Ga0373943_0000567 | 3300035170 | Bacteria | 16034 |
| 110 | Ga0373946_0002942 | 3300035171 | Bacteria | 6038 |
| 111 | Ga0373946_0012445 | 3300035171 | Bacteria | 3185 |
| 112 | Ga0373955_0010170 | 3300035172 | Bacteria | 4434 |
| 113 | Ga0373955_0064363 | 3300035172 | Bacteria | 2033 |
| 114 | Ga0373961_0011682 | 3300035241 | Bacteria | 2183 |
| 115 | Ga0373924_0015912 | 3300035410 | Bacteria | 2866 |
| 116 | Ga0373924_0025131 | 3300035410 | Bacteria | 2353 |
| 117 | Ga0373931_0009280 | 3300035691 | Bacteria | 4699 |
| 118 | Ga0373935_0213678 | 3300035692 | Unclassified | 1337 |
| 119 | Ga0373935_0217518 | 3300035692 | Bacteria | 1326 |
| 120 | Ga0373927_0002426 | 3300035695 | Bacteria | 13595 |
| 121 | Ga0373927_0029863 | 3300035695 | Bacteria | 3555 |
| 122 | Ga0373933_0015446 | 3300035724 | Bacteria | 4255 |
| 123 | Ga0373933_0247463 | 3300035724 | Bacteria | 1148 |
| 124 | Ga0373947_0017391 | 3300035725 | Bacteria | 4135 |
| 125 | Ga0373947_0024987 | 3300035725 | Bacteria | 3483 |
| 126 | Ga0373947_0031818 | 3300035725 | Bacteria | 3107 |
| 127 | Ga0373947_0091937 | 3300035725 | Bacteria | 1894 |
| 128 | Ga0373937_0000414 | 3300036401 | Bacteria | 39843 |
| 129 | Ga0373937_0001751 | 3300036401 | Bacteria | 18265 |
| 130 | Ga0373925_0003922 | 3300037068 | Bacteria | 11355 |
| 131 | Ga0373925_0177995 | 3300037068 | Bacteria | 1682 |
| 132 | Ga0395899_0091663 | 3300037312 | Bacteria | 2202 |
| 133 | Ga0395899_0164251 | 3300037312 | Bacteria | 1567 |
| 134 | Ga0395900_0148935 | 3300037418 | Bacteria | 2392 |
| 135 | Ga0395898_0008395 | 3300037466 | Bacteria | 10923 |
| 136 | Ga0395898_0009499 | 3300037466 | Bacteria | 10212 |
| 137 | Ga0395898_0089239 | 3300037466 | Bacteria | 2967 |
| 138 | Ga0395905_0127913 | 3300037471 | Bacteria | 2389 |
| 139 | Ga0395901_0008870 | 3300038443 | Bacteria | 10181 |
| 140 | Ga0436363_1682763 | 3300039450 | Bacteria | 4267 |
| 141 | Ga0439435_0070895 | 3300042436 | Bacteria | 1031 |
| 142 | Ga0466963_0007058 | 3300044694 | Bacteria | 6687 |
| 143 | Ga0466964_0023109 | 3300044706 | Bacteria | 2416 |
| 144 | Ga0466957_0097508 | 3300044842 | Bacteria | 1849 |
| 145 | Ga0466967_0058984 | 3300045976 | Bacteria | 3394 |
| 146 | Ga0466967_0100758 | 3300045976 | Bacteria | 2639 |
| 147 | Ga0466967_0152832 | 3300045976 | Bacteria | 2159 |
| 148 | Ga0495592_0001026 | 3300046454 | Bacteria | 19392 |
| 149 | Ga0495629_0001949 | 3300046459 | Bacteria | 16087 |
| 150 | Ga0495651_0000540 | 3300046462 | Bacteria | 29195 |
| 151 | Ga0495653_0001530 | 3300046463 | Bacteria | 18079 |
| 152 | Ga0495653_0016270 | 3300046463 | Bacteria | 6060 |
| 153 | Ga0495653_0020295 | 3300046463 | Bacteria | 5388 |
| 154 | Ga0495580_0024260 | 3300046472 | Bacteria | 4444 |
| 155 | Ga0495582_0125872 | 3300046473 | Bacteria | 1446 |
| 156 | Ga0495639_0039390 | 3300046475 | Bacteria | 2125 |
| 157 | Ga0495662_0000280 | 3300046476 | Bacteria | 21964 |
| 158 | Ga0495664_0000112 | 3300046477 | Bacteria | 40522 |
| 159 | Ga0495664_0016402 | 3300046477 | Bacteria | 4218 |
| 160 | Ga0495608_0000556 | 3300046511 | Bacteria | 25760 |
| 161 | Ga0495618_0001016 | 3300046514 | Bacteria | 19217 |
| 162 | Ga0495618_0001092 | 3300046514 | Bacteria | 18392 |
| 163 | Ga0495628_0021168 | 3300046516 | Bacteria | 5354 |
| 164 | Ga0495630_0050726 | 3300046517 | Bacteria | 3105 |
| 165 | Ga0495666_0067186 | 3300046526 | Bacteria | 1708 |
| 166 | Ga0495652_0021356 | 3300046529 | Bacteria | 5757 |
| 167 | Ga0495665_0027740 | 3300046531 | Bacteria | 3038 |
| 168 | Ga0495665_0058179 | 3300046531 | Bacteria | 2041 |
| 169 | Ga0495640_0000871 | 3300046533 | Bacteria | 23106 |
| 170 | Ga0495640_0020037 | 3300046533 | Bacteria | 4930 |
| 171 | Ga0495587_0001728 | 3300046536 | Bacteria | 14579 |
| 172 | Ga0495645_0004586 | 3300046543 | Bacteria | 9430 |
| 173 | Ga0495645_0025896 | 3300046543 | Bacteria | 4258 |
| 174 | Ga0495667_0001507 | 3300046559 | Bacteria | 15361 |
| 175 | Ga0495667_0012454 | 3300046559 | Bacteria | 5767 |
| 176 | Ga0495634_0002257 | 3300046642 | Bacteria | 16158 |
| 177 | Ga0495634_0003493 | 3300046642 | Bacteria | 12595 |
| 178 | Ga0495634_0033846 | 3300046642 | Bacteria | 3509 |
| 179 | Ga0495635_0002093 | 3300046663 | Bacteria | 13548 |
| 180 | Ga0495635_0002738 | 3300046663 | Bacteria | 12081 |
| 181 | Ga0495599_0009199 | 3300046678 | Bacteria | 6030 |
| 182 | Ga0495646_0048871 | 3300046680 | Bacteria | 2569 |
| 183 | Ga0495646_0054316 | 3300046680 | Bacteria | 2410 |
| 184 | Ga0495647_0065317 | 3300046681 | Unclassified | 1445 |
| 185 | Ga0495658_0157092 | 3300046683 | Bacteria | 1400 |
| 186 | Ga0495658_0209250 | 3300046683 | Bacteria | 1218 |
| 187 | Ga0495613_0015480 | 3300046689 | Bacteria | 5672 |
| 188 | Ga0495613_0087956 | 3300046689 | Bacteria | 2252 |
| 189 | Ga0495624_0001093 | 3300046690 | Bacteria | 21434 |
| 190 | Ga0495600_0000186 | 3300046809 | Bacteria | 36306 |
| 191 | Ga0495604_0000150 | 3300047317 | Bacteria | 60582 |
| 192 | Ga0495604_0156468 | 3300047317 | Bacteria | 1614 |
| 193 | Ga0495674_0001513 | 3300047319 | Bacteria | 22779 |
| 194 | Ga0495674_0023667 | 3300047319 | Bacteria | 5657 |
| 195 | Ga0495672_0005202 | 3300047320 | Bacteria | 10370 |
| 196 | Ga0495676_0183295 | 3300047321 | Bacteria | 1466 |
| 197 | Ga0495676_0261109 | 3300047321 | Unclassified | 1178 |
| 198 | Ga0495680_0000429 | 3300047322 | Bacteria | 47078 |
| 199 | Ga0495680_0011972 | 3300047322 | Bacteria | 7656 |
| 200 | Ga0495675_0001022 | 3300047444 | Bacteria | 17001 |
| 201 | Ga0495684_0000264 | 3300047471 | Bacteria | 41677 |
| 202 | Ga0495684_0001309 | 3300047471 | Bacteria | 20014 |
| 203 | Ga0495684_0016295 | 3300047471 | Bacteria | 5722 |
| 204 | Ga0495602_0005255 | 3300048088 | Bacteria | 13574 |
| 205 | Ga0496100_0305313 | 3300048903 | Bacteria | 1192 |
| 206 | Ga0496101_0011289 | 3300048904 | Bacteria | 5921 |
| 207 | Ga0496101_0075986 | 3300048904 | Bacteria | 2474 |
| 208 | Ga0496101_0492752 | 3300048904 | Bacteria | 968 |
| 209 | Ga0496103_0114581 | 3300048906 | Bacteria | 1714 |
| 210 | Ga0496104_0012511 | 3300048907 | Bacteria | 7630 |
| 211 | Ga0496104_0019416 | 3300048907 | Bacteria | 6218 |
| 212 | Ga0496104_0088980 | 3300048907 | Bacteria | 2950 |
| 213 | Ga0496105_0017953 | 3300048908 | Bacteria | 5678 |
| 214 | Ga0496105_0074364 | 3300048908 | Bacteria | 2807 |
| 215 | Ga0496106_0077604 | 3300048909 | Bacteria | 2547 |
| 216 | Ga0496106_0306101 | 3300048909 | Bacteria | 1275 |
| 217 | Ga0496107_0037926 | 3300048910 | Bacteria | 3459 |
| 218 | Ga0496107_0080801 | 3300048910 | Bacteria | 2371 |
| 219 | Ga0496108_0039215 | 3300048911 | Bacteria | 3949 |
| 220 | Ga0496108_0137027 | 3300048911 | Bacteria | 2107 |
| 221 | Ga0496110_0011677 | 3300048913 | Bacteria | 7203 |
| 222 | Ga0496110_0332906 | 3300048913 | Bacteria | 1383 |
| 223 | Ga0496111_0072032 | 3300048914 | Bacteria | 2515 |
| 224 | Ga0496112_0148862 | 3300048915 | Bacteria | 2309 |
| 225 | Ga0496112_0260506 | 3300048915 | Bacteria | 1683 |
| 226 | Ga0496113_0035443 | 3300048916 | Bacteria | 3649 |
| 227 | Ga0496113_0056054 | 3300048916 | Bacteria | 2957 |
| 228 | Ga0496114_0026104 | 3300048917 | Bacteria | 4780 |
| 229 | Ga0496114_0212455 | 3300048917 | Bacteria | 1697 |
| 230 | Ga0496114_0395526 | 3300048917 | Bacteria | 1224 |
| 231 | Ga0496115_0003484 | 3300048918 | Bacteria | 11313 |
| 232 | Ga0496115_0088277 | 3300048918 | Bacteria | 2531 |
| 233 | Ga0501034_0050791 | 3300049571 | Bacteria | 4182 |
| 234 | Ga0501034_0381301 | 3300049571 | Bacteria | 1335 |
| 235 | Ga0501037_0096870 | 3300049573 | Bacteria | 2132 |
| 236 | Ga0501043_0060814 | 3300049579 | Bacteria | 2966 |
| 237 | Ga0501043_0085744 | 3300049579 | Bacteria | 2475 |
| 238 | Ga0501047_0012274 | 3300049581 | Bacteria | 8107 |
| 239 | Ga0501047_0047710 | 3300049581 | Bacteria | 4137 |
| 240 | Ga0501047_0083951 | 3300049581 | Bacteria | 3061 |
| 241 | Ga0501070_0110133 | 3300049586 | Bacteria | 2276 |
| 242 | Ga0501071_0131713 | 3300049587 | Bacteria | 1858 |
| 243 | Ga0501071_0152071 | 3300049587 | Bacteria | 1727 |
| 244 | Ga0501072_0023939 | 3300049588 | Bacteria | 4746 |
| 245 | Ga0501073_0023856 | 3300049589 | Bacteria | 4393 |
| 246 | Ga0501073_0302643 | 3300049589 | Bacteria | 1103 |
| 247 | Ga0501075_0130065 | 3300049591 | Bacteria | 1918 |
| 248 | Ga0501075_0145790 | 3300049591 | Bacteria | 1804 |
| 249 | Ga0501080_0150089 | 3300049742 | Bacteria | 2155 |
| 250 | Ga0501081_0181457 | 3300049743 | Bacteria | 1523 |
| 251 | Ga0501035_0192892 | 3300049822 | Bacteria | 1751 |
| 252 | Ga0501035_0407403 | 3300049822 | Bacteria | 1130 |
| 253 | Ga0501044_0255410 | 3300049823 | Bacteria | 1692 |
| 254 | Ga0501044_0271481 | 3300049823 | Bacteria | 1631 |
| 255 | Ga0501044_0293838 | 3300049823 | Bacteria | 1556 |
| 256 | nmdc:mga03n38_101146_c1 | 3300050490 | Bacteria | 1390 |
| 257 | nmdc:mga0yw44_122061_c1 | 3300050492 | Bacteria | 1679 |
| 258 | nmdc:mga0yw44_251839_c1 | 3300050492 | Bacteria | 1175 |
| 259 | nmdc:mga0k408_21453_c1 | 3300050493 | Bacteria | 3628 |
| 260 | nmdc:mga06z11_119004_c1 | 3300050494 | Bacteria | 1471 |
| 261 | nmdc:mga06z11_246766_c1 | 3300050494 | Bacteria | 1050 |
| 262 | nmdc:mga06z11_55384_c1 | 3300050494 | Bacteria | 2047 |
| 263 | nmdc:mga07m45_19679_c1 | 3300050496 | Bacteria | 2439 |
| 264 | nmdc:mga07m45_57753_c1 | 3300050496 | Bacteria | 2195 |
| 265 | nmdc:mga05p37_414594_c1 | 3300050507 | Bacteria | 1569 |
| 266 | nmdc:mga05p37_53728_c1 | 3300050507 | Bacteria | 4955 |
| 267 | nmdc:mga09592_112903_c1 | 3300050508 | Bacteria | 2331 |
| 268 | nmdc:mga0qj67_130268_c1 | 3300050509 | Bacteria | 2037 |
| 269 | nmdc:mga0qj67_182_c1 | 3300050509 | Bacteria | 42807 |
| 270 | nmdc:mga08y16_213525_c1 | 3300050511 | Bacteria | 1998 |
| 271 | nmdc:mga08y16_362545_c1 | 3300050511 | Bacteria | 1488 |
| 272 | nmdc:mga08y16_39834_c1 | 3300050511 | Bacteria | 4928 |
| 273 | nmdc:mga0n895_151818_c1 | 3300050512 | Bacteria | 2347 |
| 274 | nmdc:mga0n895_286576_c1 | 3300050512 | Bacteria | 1670 |
| 275 | nmdc:mga0n895_8778_c1 | 3300050512 | Bacteria | 8789 |
| 276 | nmdc:mga0rr50_111317_c1 | 3300050513 | Bacteria | 2167 |
| 277 | nmdc:mga0a205_128308_c1 | 3300050515 | Bacteria | 2436 |
| 278 | nmdc:mga0a205_5777_c2 | 3300050515 | Bacteria | 10585 |
| 279 | Ga0495601_0001951 | 3300053077 | Bacteria | 11535 |
| 280 | Ga0495601_0044469 | 3300053077 | Bacteria | 2791 |
| 281 | Ga0495601_0059964 | 3300053077 | Bacteria | 2413 |
| 282 | Ga0495601_0275840 | 3300053077 | Bacteria | 1096 |
| 283 | Ga0495612_0023891 | 3300053078 | Bacteria | 2454 |
| 284 | Ga0495612_0059822 | 3300053078 | Bacteria | 1576 |
| 285 | Ga0495595_0008639 | 3300053084 | Bacteria | 4191 |
| 286 | Ga0495595_0053765 | 3300053084 | Bacteria | 1871 |
| 287 | Ga0495619_0001598 | 3300053085 | Bacteria | 14888 |
| 288 | Ga0495619_0055011 | 3300053085 | Bacteria | 2635 |
| 289 | Ga0500595_060601 | 3300053119 | Bacteria | 1144 |
| 290 | Ga0500608_012444 | 3300053122 | Bacteria | 3732 |
| 291 | Ga0501084_0223581 | 3300054114 | Bacteria | 1588 |
| 292 | Ga0501082_0129028 | 3300060353 | Bacteria | 2194 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0213678 | Ga0373935_0213678_289_1122 | 265 |
| 2 | 3300049587 | Ga0501071_0152071 | Ga0501071_0152071_145_1002 | 265 |
| 3 | 3300049591 | Ga0501075_0145790 | Ga0501075_0145790_348_1205 | 265 |
| 4 | 3300049822 | Ga0501035_0192892 | Ga0501035_0192892_378_1235 | 265 |
| 5 | 3300031247 | Ga0265340_10001253 | Ga0265340_100012536 | 268 |
| 6 | 3300031250 | Ga0265331_10031897 | Ga0265331_100318974 | 268 |
| 7 | 3300031344 | Ga0265316_10016679 | Ga0265316_100166795 | 268 |
| 8 | 3300031595 | Ga0265313_10000868 | Ga0265313_1000086814 | 268 |
| 9 | 3300031712 | Ga0265342_10009354 | Ga0265342_100093543 | 268 |
| 10 | 3300049571 | Ga0501034_0050791 | Ga0501034_0050791_1196_2110 | 273 |
| 11 | 3300044694 | Ga0466963_0007058 | Ga0466963_0007058_5768_6631 | 287 |
| 12 | 3300053122 | Ga0500608_012444 | Ga0500608_012444_1213_2130 | 288 |
| 13 | 3300009094 | Ga0111539_10238126 | Ga0111539_102381261 | 289 |
| 14 | 3300031595 | Ga0265313_10033536 | Ga0265313_100335363 | 289 |
| 15 | 3300035116 | Ga0373945_0016277 | Ga0373945_0016277_21_926 | 289 |
| 16 | 3300035117 | Ga0373953_0027328 | Ga0373953_0027328_1312_2181 | 289 |
| 17 | 3300035724 | Ga0373933_0247463 | Ga0373933_0247463_239_1111 | 289 |
| 18 | 3300048913 | Ga0496110_0332906 | Ga0496110_0332906_494_1366 | 289 |
| 19 | 3300049579 | Ga0501043_0085744 | Ga0501043_0085744_971_1852 | 289 |
| 20 | 3300050511 | nmdc:mga08y16_362545_c1 | nmdc:mga08y16_362545_c1_163_1038 | 289 |
| 21 | 3300050512 | nmdc:mga0n895_286576_c1 | nmdc:mga0n895_286576_c1_250_1125 | 289 |
| 22 | 3300050513 | nmdc:mga0rr50_111317_c1 | nmdc:mga0rr50_111317_c1_537_1412 | 289 |
| 23 | 3300050515 | nmdc:mga0a205_128308_c1 | nmdc:mga0a205_128308_c1_87_962 | 289 |
| 24 | 3300053085 | Ga0495619_0055011 | Ga0495619_0055011_17_886 | 289 |
| 25 | 3300048909 | Ga0496106_0306101 | Ga0496106_0306101_176_1099 | 292 |
| 26 | 3300037312 | Ga0395899_0091663 | Ga0395899_0091663_672_1577 | 298 |
| 27 | 3300037312 | Ga0395899_0164251 | Ga0395899_0164251_619_1524 | 298 |
| 28 | 3300037418 | Ga0395900_0148935 | Ga0395900_0148935_1052_1957 | 298 |
| 29 | 3300037466 | Ga0395898_0008395 | Ga0395898_0008395_7550_8455 | 298 |
| 30 | 3300037466 | Ga0395898_0009499 | Ga0395898_0009499_1311_2216 | 298 |
| 31 | 3300037471 | Ga0395905_0127913 | Ga0395905_0127913_1365_2270 | 298 |
| 32 | 3300038443 | Ga0395901_0008870 | Ga0395901_0008870_1319_2224 | 298 |
| 33 | 3300005458 | Ga0070681_10458549 | Ga0070681_104585491 | 299 |
| 34 | 3300025921 | Ga0207652_10236468 | Ga0207652_102364682 | 299 |
| 35 | 3300035118 | Ga0373954_0037305 | Ga0373954_0037305_540_1448 | 299 |
| 36 | 3300035119 | Ga0373956_0005177 | Ga0373956_0005177_4287_5195 | 299 |
| 37 | 3300035120 | Ga0373957_0005882 | Ga0373957_0005882_1605_2513 | 299 |
| 38 | 3300036401 | Ga0373937_0001751 | Ga0373937_0001751_960_1868 | 299 |
| 39 | 3300046463 | Ga0495653_0016270 | Ga0495653_0016270_4340_5248 | 299 |
| 40 | 3300046559 | Ga0495667_0012454 | Ga0495667_0012454_869_1777 | 299 |
| 41 | 3300047322 | Ga0495680_0011972 | Ga0495680_0011972_5574_6482 | 299 |
| 42 | 3300048904 | Ga0496101_0075986 | Ga0496101_0075986_1057_1965 | 299 |
| 43 | 3300048907 | Ga0496104_0088980 | Ga0496104_0088980_1141_2049 | 299 |
| 44 | 3300048917 | Ga0496114_0212455 | Ga0496114_0212455_160_1068 | 299 |
| 45 | 3300049571 | Ga0501034_0381301 | Ga0501034_0381301_198_1115 | 299 |
| 46 | 3300049581 | Ga0501047_0083951 | Ga0501047_0083951_173_1096 | 299 |
| 47 | 3300049586 | Ga0501070_0110133 | Ga0501070_0110133_599_1522 | 299 |
| 48 | 3300049587 | Ga0501071_0131713 | Ga0501071_0131713_139_1050 | 299 |
| 49 | 3300049588 | Ga0501072_0023939 | Ga0501072_0023939_2663_3574 | 299 |
| 50 | 3300049591 | Ga0501075_0130065 | Ga0501075_0130065_322_1233 | 299 |
| 51 | 3300049823 | Ga0501044_0255410 | Ga0501044_0255410_417_1340 | 299 |
| 52 | 3300049823 | Ga0501044_0293838 | Ga0501044_0293838_504_1427 | 299 |
| 53 | 3300053077 | Ga0495601_0044469 | Ga0495601_0044469_1022_1930 | 299 |
| 54 | 3300053084 | Ga0495595_0053765 | Ga0495595_0053765_796_1704 | 299 |
| 55 | 3300054114 | Ga0501084_0223581 | Ga0501084_0223581_495_1406 | 299 |
| 56 | 3300060353 | Ga0501082_0129028 | Ga0501082_0129028_1089_1994 | 299 |
| 57 | 3300005983 | Ga0081540_1000783 | Ga0081540_100078315 | 300 |
| 58 | 3300044706 | Ga0466964_0023109 | Ga0466964_0023109_975_1913 | 300 |
| 59 | 3300045976 | Ga0466967_0058984 | Ga0466967_0058984_660_1598 | 300 |
| 60 | 3300045976 | Ga0466967_0152832 | Ga0466967_0152832_1043_1972 | 300 |
| 61 | 3300046689 | Ga0495613_0087956 | Ga0495613_0087956_531_1445 | 300 |
| 62 | 3300005336 | Ga0070680_100378555 | Ga0070680_1003785552 | 301 |
| 63 | 3300005366 | Ga0070659_100228716 | Ga0070659_1002287162 | 301 |
| 64 | 3300005458 | Ga0070681_10060642 | Ga0070681_100606422 | 301 |
| 65 | 3300005458 | Ga0070681_10204223 | Ga0070681_102042232 | 301 |
| 66 | 3300005577 | Ga0068857_100253695 | Ga0068857_1002536952 | 301 |
| 67 | 3300013104 | Ga0157370_10284034 | Ga0157370_102840342 | 301 |
| 68 | 3300025912 | Ga0207707_10003185 | Ga0207707_1000318510 | 301 |
| 69 | 3300025912 | Ga0207707_10043578 | Ga0207707_100435782 | 301 |
| 70 | 3300025913 | Ga0207695_10143915 | Ga0207695_101439152 | 301 |
| 71 | 3300025917 | Ga0207660_10152777 | Ga0207660_101527772 | 301 |
| 72 | 3300025921 | Ga0207652_10015640 | Ga0207652_100156402 | 301 |
| 73 | 3300025932 | Ga0207690_10155530 | Ga0207690_101555302 | 301 |
| 74 | 3300026116 | Ga0207674_10256637 | Ga0207674_102566372 | 301 |
| 75 | 3300030760 | Ga0265762_1009187 | Ga0265762_10091872 | 301 |
| 76 | iso_pu_bacteria | 2751185782 | 2753267116 | 301 |
| 77 | 3300003215 | JGI25153J46596_10004936 | JGI25153J46596_100049366 | 302 |
| 78 | 3300005328 | Ga0070676_10046801 | Ga0070676_100468012 | 302 |
| 79 | 3300005336 | Ga0070680_100004467 | Ga0070680_1000044679 | 302 |
| 80 | 3300005338 | Ga0068868_100332455 | Ga0068868_1003324552 | 302 |
| 81 | 3300005340 | Ga0070689_100027771 | Ga0070689_1000277711 | 302 |
| 82 | 3300005354 | Ga0070675_100107762 | Ga0070675_1001077621 | 302 |
| 83 | 3300005356 | Ga0070674_100006024 | Ga0070674_1000060243 | 302 |
| 84 | 3300005434 | Ga0070709_10247853 | Ga0070709_102478531 | 302 |
| 85 | 3300005435 | Ga0070714_100172494 | Ga0070714_1001724941 | 302 |
| 86 | 3300005436 | Ga0070713_100147357 | Ga0070713_1001473573 | 302 |
| 87 | 3300005441 | Ga0070700_100399340 | Ga0070700_1003993401 | 302 |
| 88 | 3300005456 | Ga0070678_100159820 | Ga0070678_1001598202 | 302 |
| 89 | 3300005458 | Ga0070681_10071718 | Ga0070681_100717182 | 302 |
| 90 | 3300005458 | Ga0070681_10118389 | Ga0070681_101183892 | 302 |
| 91 | 3300005530 | Ga0070679_100015110 | Ga0070679_1000151104 | 302 |
| 92 | 3300005530 | Ga0070679_100198327 | Ga0070679_1001983272 | 302 |
| 93 | 3300005618 | Ga0068864_100058574 | Ga0068864_1000585743 | 302 |
| 94 | 3300005719 | Ga0068861_100263622 | Ga0068861_1002636222 | 302 |
| 95 | 3300005719 | Ga0068861_100446412 | Ga0068861_1004464121 | 302 |
| 96 | 3300005981 | Ga0081538_10005276 | Ga0081538_100052768 | 302 |
| 97 | 3300005983 | Ga0081540_1012091 | Ga0081540_10120915 | 302 |
| 98 | 3300006038 | Ga0075365_10166792 | Ga0075365_101667922 | 302 |
| 99 | 3300006048 | Ga0075363_100071132 | Ga0075363_1000711322 | 302 |
| 100 | 3300006051 | Ga0075364_10099513 | Ga0075364_100995132 | 302 |
| 101 | 3300006175 | Ga0070712_100166469 | Ga0070712_1001664693 | 302 |
| 102 | 3300006178 | Ga0075367_10104956 | Ga0075367_101049562 | 302 |
| 103 | 3300006178 | Ga0075367_10248845 | Ga0075367_102488452 | 302 |
| 104 | 3300006353 | Ga0075370_10168395 | Ga0075370_101683952 | 302 |
| 105 | 3300006844 | Ga0075428_100031003 | Ga0075428_1000310033 | 302 |
| 106 | 3300006852 | Ga0075433_10060250 | Ga0075433_100602502 | 302 |
| 107 | 3300006871 | Ga0075434_100023265 | Ga0075434_1000232652 | 302 |
| 108 | 3300006871 | Ga0075434_100046995 | Ga0075434_1000469954 | 302 |
| 109 | 3300006871 | Ga0075434_100200424 | Ga0075434_1002004242 | 302 |
| 110 | 3300006880 | Ga0075429_100102549 | Ga0075429_1001025493 | 302 |
| 111 | 3300006880 | Ga0075429_100176150 | Ga0075429_1001761502 | 302 |
| 112 | 3300007076 | Ga0075435_100071993 | Ga0075435_1000719932 | 302 |
| 113 | 3300009093 | Ga0105240_10022753 | Ga0105240_100227535 | 302 |
| 114 | 3300009094 | Ga0111539_10025601 | Ga0111539_100256012 | 302 |
| 115 | 3300009094 | Ga0111539_10248379 | Ga0111539_102483792 | 302 |
| 116 | 3300009176 | Ga0105242_10106809 | Ga0105242_101068091 | 302 |
| 117 | 3300013104 | Ga0157370_10007782 | Ga0157370_100077829 | 302 |
| 118 | 3300013297 | Ga0157378_10425506 | Ga0157378_104255061 | 302 |
| 119 | 3300013306 | Ga0163162_10386020 | Ga0163162_103860201 | 302 |
| 120 | 3300013307 | Ga0157372_10382709 | Ga0157372_103827092 | 302 |
| 121 | 3300013308 | Ga0157375_10309606 | Ga0157375_103096062 | 302 |
| 122 | 3300014325 | Ga0163163_10096952 | Ga0163163_100969522 | 302 |
| 123 | 3300014497 | Ga0182008_10014409 | Ga0182008_100144093 | 302 |
| 124 | 3300024225 | Ga0224572_1000501 | Ga0224572_10005015 | 302 |
| 125 | 3300025297 | Ga0209758_1000669 | Ga0209758_100066943 | 302 |
| 126 | 3300025302 | Ga0207426_1021815 | Ga0207426_10218151 | 302 |
| 127 | 3300025315 | Ga0207697_10069955 | Ga0207697_100699552 | 302 |
| 128 | 3300025901 | Ga0207688_10141639 | Ga0207688_101416392 | 302 |
| 129 | 3300025907 | Ga0207645_10064680 | Ga0207645_100646802 | 302 |
| 130 | 3300025915 | Ga0207693_10242119 | Ga0207693_102421192 | 302 |
| 131 | 3300025916 | Ga0207663_10053042 | Ga0207663_100530422 | 302 |
| 132 | 3300025918 | Ga0207662_10046392 | Ga0207662_100463922 | 302 |
| 133 | 3300025926 | Ga0207659_10069857 | Ga0207659_100698571 | 302 |
| 134 | 3300025928 | Ga0207700_10058667 | Ga0207700_100586671 | 302 |
| 135 | 3300025928 | Ga0207700_10360552 | Ga0207700_103605521 | 302 |
| 136 | 3300025934 | Ga0207686_10016294 | Ga0207686_100162944 | 302 |
| 137 | 3300025936 | Ga0207670_10006490 | Ga0207670_100064902 | 302 |
| 138 | 3300025936 | Ga0207670_10212352 | Ga0207670_102123521 | 302 |
| 139 | 3300025937 | Ga0207669_10048303 | Ga0207669_100483032 | 302 |
| 140 | 3300025939 | Ga0207665_10095407 | Ga0207665_100954072 | 302 |
| 141 | 3300025941 | Ga0207711_10023965 | Ga0207711_100239653 | 302 |
| 142 | 3300026095 | Ga0207676_10043073 | Ga0207676_100430732 | 302 |
| 143 | 3300026121 | Ga0207683_10031874 | Ga0207683_100318743 | 302 |
| 144 | 3300028023 | Ga0265357_1002281 | Ga0265357_10022811 | 302 |
| 145 | 3300028800 | Ga0265338_10058319 | Ga0265338_100583193 | 302 |
| 146 | 3300030763 | Ga0265763_1000229 | Ga0265763_10002293 | 302 |
| 147 | 3300031090 | Ga0265760_10015578 | Ga0265760_100155783 | 302 |
| 148 | 3300031238 | Ga0265332_10084441 | Ga0265332_100844411 | 302 |
| 149 | 3300031241 | Ga0265325_10027289 | Ga0265325_100272892 | 302 |
| 150 | 3300031247 | Ga0265340_10005455 | Ga0265340_100054555 | 302 |
| 151 | 3300031249 | Ga0265339_10000091 | Ga0265339_1000009126 | 302 |
| 152 | 3300035088 | Ga0373940_0039067 | Ga0373940_0039067_19_927 | 302 |
| 153 | 3300035089 | Ga0373944_0002019 | Ga0373944_0002019_494_1447 | 302 |
| 154 | 3300035111 | Ga0373923_0018492 | Ga0373923_0018492_383_1303 | 302 |
| 155 | 3300035118 | Ga0373954_0050962 | Ga0373954_0050962_251_1171 | 302 |
| 156 | 3300035170 | Ga0373943_0000567 | Ga0373943_0000567_8833_9786 | 302 |
| 157 | 3300035171 | Ga0373946_0002942 | Ga0373946_0002942_1760_2713 | 302 |
| 158 | 3300035171 | Ga0373946_0012445 | Ga0373946_0012445_746_1699 | 302 |
| 159 | 3300035172 | Ga0373955_0010170 | Ga0373955_0010170_3060_3980 | 302 |
| 160 | 3300035172 | Ga0373955_0064363 | Ga0373955_0064363_832_1740 | 302 |
| 161 | 3300035241 | Ga0373961_0011682 | Ga0373961_0011682_519_1427 | 302 |
| 162 | 3300035410 | Ga0373924_0015912 | Ga0373924_0015912_490_1443 | 302 |
| 163 | 3300035410 | Ga0373924_0025131 | Ga0373924_0025131_1284_2204 | 302 |
| 164 | 3300035691 | Ga0373931_0009280 | Ga0373931_0009280_2505_3413 | 302 |
| 165 | 3300035692 | Ga0373935_0217518 | Ga0373935_0217518_184_1092 | 302 |
| 166 | 3300035695 | Ga0373927_0002426 | Ga0373927_0002426_12000_12953 | 302 |
| 167 | 3300035695 | Ga0373927_0029863 | Ga0373927_0029863_1275_2228 | 302 |
| 168 | 3300035724 | Ga0373933_0015446 | Ga0373933_0015446_2552_3472 | 302 |
| 169 | 3300035725 | Ga0373947_0017391 | Ga0373947_0017391_1855_2808 | 302 |
| 170 | 3300035725 | Ga0373947_0024987 | Ga0373947_0024987_1184_2137 | 302 |
| 171 | 3300035725 | Ga0373947_0031818 | Ga0373947_0031818_1169_2089 | 302 |
| 172 | 3300035725 | Ga0373947_0091937 | Ga0373947_0091937_749_1672 | 302 |
| 173 | 3300036401 | Ga0373937_0000414 | Ga0373937_0000414_27321_28241 | 302 |
| 174 | 3300037068 | Ga0373925_0003922 | Ga0373925_0003922_7700_8653 | 302 |
| 175 | 3300037068 | Ga0373925_0177995 | Ga0373925_0177995_237_1187 | 302 |
| 176 | 3300037466 | Ga0395898_0089239 | Ga0395898_0089239_1469_2389 | 302 |
| 177 | 3300039450 | Ga0436363_1682763 | Ga0436363_1682763_451_1383 | 302 |
| 178 | 3300042436 | Ga0439435_0070895 | Ga0439435_0070895_109_1020 | 302 |
| 179 | 3300044842 | Ga0466957_0097508 | Ga0466957_0097508_541_1518 | 302 |
| 180 | 3300045976 | Ga0466967_0100758 | Ga0466967_0100758_230_1159 | 302 |
| 181 | 3300046454 | Ga0495592_0001026 | Ga0495592_0001026_7763_8683 | 302 |
| 182 | 3300046459 | Ga0495629_0001949 | Ga0495629_0001949_4315_5235 | 302 |
| 183 | 3300046462 | Ga0495651_0000540 | Ga0495651_0000540_4422_5342 | 302 |
| 184 | 3300046463 | Ga0495653_0001530 | Ga0495653_0001530_14361_15281 | 302 |
| 185 | 3300046463 | Ga0495653_0020295 | Ga0495653_0020295_3003_3956 | 302 |
| 186 | 3300046472 | Ga0495580_0024260 | Ga0495580_0024260_3445_4398 | 302 |
| 187 | 3300046473 | Ga0495582_0125872 | Ga0495582_0125872_320_1243 | 302 |
| 188 | 3300046475 | Ga0495639_0039390 | Ga0495639_0039390_680_1633 | 302 |
| 189 | 3300046476 | Ga0495662_0000280 | Ga0495662_0000280_9461_10414 | 302 |
| 190 | 3300046477 | Ga0495664_0000112 | Ga0495664_0000112_21537_22490 | 302 |
| 191 | 3300046477 | Ga0495664_0016402 | Ga0495664_0016402_349_1269 | 302 |
| 192 | 3300046511 | Ga0495608_0000556 | Ga0495608_0000556_873_1793 | 302 |
| 193 | 3300046514 | Ga0495618_0001016 | Ga0495618_0001016_15834_16787 | 302 |
| 194 | 3300046514 | Ga0495618_0001092 | Ga0495618_0001092_15845_16765 | 302 |
| 195 | 3300046516 | Ga0495628_0021168 | Ga0495628_0021168_4309_5229 | 302 |
| 196 | 3300046517 | Ga0495630_0050726 | Ga0495630_0050726_349_1302 | 302 |
| 197 | 3300046526 | Ga0495666_0067186 | Ga0495666_0067186_716_1669 | 302 |
| 198 | 3300046529 | Ga0495652_0021356 | Ga0495652_0021356_571_1491 | 302 |
| 199 | 3300046531 | Ga0495665_0027740 | Ga0495665_0027740_1532_2485 | 302 |
| 200 | 3300046531 | Ga0495665_0058179 | Ga0495665_0058179_457_1410 | 302 |
| 201 | 3300046533 | Ga0495640_0000871 | Ga0495640_0000871_13855_14808 | 302 |
| 202 | 3300046533 | Ga0495640_0020037 | Ga0495640_0020037_3909_4829 | 302 |
| 203 | 3300046536 | Ga0495587_0001728 | Ga0495587_0001728_9124_10044 | 302 |
| 204 | 3300046543 | Ga0495645_0004586 | Ga0495645_0004586_1911_2864 | 302 |
| 205 | 3300046543 | Ga0495645_0025896 | Ga0495645_0025896_3279_4199 | 302 |
| 206 | 3300046559 | Ga0495667_0001507 | Ga0495667_0001507_6132_7052 | 302 |
| 207 | 3300046642 | Ga0495634_0002257 | Ga0495634_0002257_9793_10713 | 302 |
| 208 | 3300046642 | Ga0495634_0003493 | Ga0495634_0003493_9860_10813 | 302 |
| 209 | 3300046642 | Ga0495634_0033846 | Ga0495634_0033846_2081_3034 | 302 |
| 210 | 3300046663 | Ga0495635_0002093 | Ga0495635_0002093_10685_11638 | 302 |
| 211 | 3300046663 | Ga0495635_0002738 | Ga0495635_0002738_7439_8359 | 302 |
| 212 | 3300046678 | Ga0495599_0009199 | Ga0495599_0009199_2720_3640 | 302 |
| 213 | 3300046680 | Ga0495646_0048871 | Ga0495646_0048871_1405_2358 | 302 |
| 214 | 3300046680 | Ga0495646_0054316 | Ga0495646_0054316_870_1790 | 302 |
| 215 | 3300046681 | Ga0495647_0065317 | Ga0495647_0065317_326_1279 | 302 |
| 216 | 3300046683 | Ga0495658_0157092 | Ga0495658_0157092_262_1185 | 302 |
| 217 | 3300046683 | Ga0495658_0209250 | Ga0495658_0209250_106_1026 | 302 |
| 218 | 3300046689 | Ga0495613_0015480 | Ga0495613_0015480_149_1069 | 302 |
| 219 | 3300046690 | Ga0495624_0001093 | Ga0495624_0001093_18737_19690 | 302 |
| 220 | 3300046809 | Ga0495600_0000186 | Ga0495600_0000186_21319_22239 | 302 |
| 221 | 3300047317 | Ga0495604_0000150 | Ga0495604_0000150_4138_5058 | 302 |
| 222 | 3300047317 | Ga0495604_0156468 | Ga0495604_0156468_40_993 | 302 |
| 223 | 3300047319 | Ga0495674_0001513 | Ga0495674_0001513_2063_3016 | 302 |
| 224 | 3300047319 | Ga0495674_0023667 | Ga0495674_0023667_1817_2737 | 302 |
| 225 | 3300047320 | Ga0495672_0005202 | Ga0495672_0005202_2491_3474 | 302 |
| 226 | 3300047321 | Ga0495676_0183295 | Ga0495676_0183295_496_1419 | 302 |
| 227 | 3300047321 | Ga0495676_0261109 | Ga0495676_0261109_55_1008 | 302 |
| 228 | 3300047322 | Ga0495680_0000429 | Ga0495680_0000429_29021_29941 | 302 |
| 229 | 3300047444 | Ga0495675_0001022 | Ga0495675_0001022_15371_16291 | 302 |
| 230 | 3300047471 | Ga0495684_0000264 | Ga0495684_0000264_38627_39580 | 302 |
| 231 | 3300047471 | Ga0495684_0001309 | Ga0495684_0001309_2122_3075 | 302 |
| 232 | 3300047471 | Ga0495684_0016295 | Ga0495684_0016295_1305_2258 | 302 |
| 233 | 3300048088 | Ga0495602_0005255 | Ga0495602_0005255_11728_12648 | 302 |
| 234 | 3300048903 | Ga0496100_0305313 | Ga0496100_0305313_41_952 | 302 |
| 235 | 3300048904 | Ga0496101_0011289 | Ga0496101_0011289_2915_3823 | 302 |
| 236 | 3300048904 | Ga0496101_0492752 | Ga0496101_0492752_31_951 | 302 |
| 237 | 3300048906 | Ga0496103_0114581 | Ga0496103_0114581_642_1550 | 302 |
| 238 | 3300048907 | Ga0496104_0012511 | Ga0496104_0012511_772_1680 | 302 |
| 239 | 3300048907 | Ga0496104_0019416 | Ga0496104_0019416_3072_3983 | 302 |
| 240 | 3300048908 | Ga0496105_0017953 | Ga0496105_0017953_55_966 | 302 |
| 241 | 3300048908 | Ga0496105_0074364 | Ga0496105_0074364_882_1802 | 302 |
| 242 | 3300048909 | Ga0496106_0077604 | Ga0496106_0077604_64_972 | 302 |
| 243 | 3300048910 | Ga0496107_0037926 | Ga0496107_0037926_1551_2459 | 302 |
| 244 | 3300048910 | Ga0496107_0080801 | Ga0496107_0080801_1041_1952 | 302 |
| 245 | 3300048911 | Ga0496108_0039215 | Ga0496108_0039215_1663_2571 | 302 |
| 246 | 3300048911 | Ga0496108_0137027 | Ga0496108_0137027_1180_2088 | 302 |
| 247 | 3300048913 | Ga0496110_0011677 | Ga0496110_0011677_3293_4201 | 302 |
| 248 | 3300048914 | Ga0496111_0072032 | Ga0496111_0072032_560_1468 | 302 |
| 249 | 3300048915 | Ga0496112_0148862 | Ga0496112_0148862_425_1345 | 302 |
| 250 | 3300048915 | Ga0496112_0260506 | Ga0496112_0260506_310_1218 | 302 |
| 251 | 3300048916 | Ga0496113_0035443 | Ga0496113_0035443_25_933 | 302 |
| 252 | 3300048916 | Ga0496113_0056054 | Ga0496113_0056054_1580_2488 | 302 |
| 253 | 3300048917 | Ga0496114_0026104 | Ga0496114_0026104_715_1626 | 302 |
| 254 | 3300048917 | Ga0496114_0395526 | Ga0496114_0395526_171_1082 | 302 |
| 255 | 3300048918 | Ga0496115_0003484 | Ga0496115_0003484_2069_2980 | 302 |
| 256 | 3300048918 | Ga0496115_0088277 | Ga0496115_0088277_450_1358 | 302 |
| 257 | 3300049573 | Ga0501037_0096870 | Ga0501037_0096870_292_1203 | 302 |
| 258 | 3300049579 | Ga0501043_0060814 | Ga0501043_0060814_912_1841 | 302 |
| 259 | 3300049581 | Ga0501047_0012274 | Ga0501047_0012274_3103_4014 | 302 |
| 260 | 3300049581 | Ga0501047_0047710 | Ga0501047_0047710_1246_2175 | 302 |
| 261 | 3300049589 | Ga0501073_0023856 | Ga0501073_0023856_2282_3193 | 302 |
| 262 | 3300049589 | Ga0501073_0302643 | Ga0501073_0302643_27_953 | 302 |
| 263 | 3300049742 | Ga0501080_0150089 | Ga0501080_0150089_246_1172 | 302 |
| 264 | 3300049743 | Ga0501081_0181457 | Ga0501081_0181457_131_1048 | 302 |
| 265 | 3300049822 | Ga0501035_0407403 | Ga0501035_0407403_102_1031 | 302 |
| 266 | 3300049823 | Ga0501044_0271481 | Ga0501044_0271481_195_1106 | 302 |
| 267 | 3300050490 | nmdc:mga03n38_101146_c1 | nmdc:mga03n38_101146_c1_352_1272 | 302 |
| 268 | 3300050492 | nmdc:mga0yw44_122061_c1 | nmdc:mga0yw44_122061_c1_740_1660 | 302 |
| 269 | 3300050492 | nmdc:mga0yw44_251839_c1 | nmdc:mga0yw44_251839_c1_225_1145 | 302 |
| 270 | 3300050493 | nmdc:mga0k408_21453_c1 | nmdc:mga0k408_21453_c1_763_1671 | 302 |
| 271 | 3300050494 | nmdc:mga06z11_119004_c1 | nmdc:mga06z11_119004_c1_201_1109 | 302 |
| 272 | 3300050494 | nmdc:mga06z11_246766_c1 | nmdc:mga06z11_246766_c1_17_937 | 302 |
| 273 | 3300050494 | nmdc:mga06z11_55384_c1 | nmdc:mga06z11_55384_c1_162_1070 | 302 |
| 274 | 3300050496 | nmdc:mga07m45_19679_c1 | nmdc:mga07m45_19679_c1_1479_2399 | 302 |
| 275 | 3300050496 | nmdc:mga07m45_57753_c1 | nmdc:mga07m45_57753_c1_1245_2165 | 302 |
| 276 | 3300050507 | nmdc:mga05p37_414594_c1 | nmdc:mga05p37_414594_c1_78_1001 | 302 |
| 277 | 3300050507 | nmdc:mga05p37_53728_c1 | nmdc:mga05p37_53728_c1_3665_4663 | 302 |
| 278 | 3300050508 | nmdc:mga09592_112903_c1 | nmdc:mga09592_112903_c1_230_1153 | 302 |
| 279 | 3300050509 | nmdc:mga0qj67_130268_c1 | nmdc:mga0qj67_130268_c1_666_1589 | 302 |
| 280 | 3300050509 | nmdc:mga0qj67_182_c1 | nmdc:mga0qj67_182_c1_27396_28313 | 302 |
| 281 | 3300050511 | nmdc:mga08y16_213525_c1 | nmdc:mga08y16_213525_c1_434_1354 | 302 |
| 282 | 3300050511 | nmdc:mga08y16_39834_c1 | nmdc:mga08y16_39834_c1_3805_4734 | 302 |
| 283 | 3300050512 | nmdc:mga0n895_151818_c1 | nmdc:mga0n895_151818_c1_464_1384 | 302 |
| 284 | 3300050512 | nmdc:mga0n895_8778_c1 | nmdc:mga0n895_8778_c1_4206_5132 | 302 |
| 285 | 3300050515 | nmdc:mga0a205_5777_c2 | nmdc:mga0a205_5777_c2_8400_9320 | 302 |
| 286 | 3300053077 | Ga0495601_0001951 | Ga0495601_0001951_1875_2828 | 302 |
| 287 | 3300053077 | Ga0495601_0059964 | Ga0495601_0059964_642_1562 | 302 |
| 288 | 3300053077 | Ga0495601_0275840 | Ga0495601_0275840_73_981 | 302 |
| 289 | 3300053078 | Ga0495612_0023891 | Ga0495612_0023891_1391_2344 | 302 |
| 290 | 3300053078 | Ga0495612_0059822 | Ga0495612_0059822_74_994 | 302 |
| 291 | 3300053084 | Ga0495595_0008639 | Ga0495595_0008639_602_1522 | 302 |
| 292 | 3300053085 | Ga0495619_0001598 | Ga0495619_0001598_1207_2160 | 302 |
| 293 | 3300053119 | Ga0500595_060601 | Ga0500595_060601_110_1036 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nmw-assembly1.cif.gz_A-2 | crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad | 0.9876 | 4 | 36 |
| 5nmw-assembly2.cif.gz_D | crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad | 0.9842 | 4 | 33 |
| 4rep-assembly1.cif.gz_A | crystal structure of gamma-carotenoid desaturase | 0.9807 | 4 | 36 |
| 6j0z-assembly1.cif.gz_C-2 | crystal structure of alpk | 0.9802 | 6 | 36 |
| 3fmw-assembly1.cif.gz_A | the crystal structure of mtmoiv, a baeyer-villiger monooxygenase from the mithramycin biosynthetic pathway in streptomyces argillaceus. | 0.9787 | 6 | 33 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6j0zC01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9802 | 6 | 36 | 3.50.50.60 |
| af_C0VXV5_2_190_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9714 | 4 | 180 | 3.40.50.720 |
| af_I1MHA5_112_472_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9615 | 5 | 32 | 3.50.50.60 |
| af_Q811X6_1_192_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9588 | 4 | 180 | 3.40.50.720 |
| af_O06538_2_320_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9577 | 4 | 35 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520ZUW8-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase family protein | 0.9851 | 58 | 300 |
GO:0006635
GO:0008691 GO:0070403 |
| AF-A0A327KL20-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase | 0.9818 | 61 | 300 |
GO:0006635
GO:0008691 GO:0070403 |
| AF-A0A2S6TA22-F1-model_v4 | Putative 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) | 0.977 | 1 | 252 |
GO:0006635
GO:0008691 GO:0070403 |
| AF-A0A654ZEY4-F1-model_v4 | deleted | 0.974 | 80 | 301 |
|
| AF-A0A2S6TA22-F1-model_v4 | Putative 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) | 0.9732 | 1 | 252 |
GO:0006635
GO:0008691 GO:0070403 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar