F392192

General Info

Members Datasets Scaffolds Average Seq Length
294 202 588 287

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0001661|Ga0316584_0001661_3126_4040
Length 304
Sequence MNGWWAKGESMEKWEDNRAWYLVLPVFVVVAFSAIIPLMTVVNYSVQDIFGPGNAVFVGTEWFKQMLTDYRLHDALWRQFLFSGLVLLIEIPLGILIALAMPKKGWGVSASLVTLAIPLLIPWNVIGTIWIIFTRPDIGLFGVGINSLHLLDVPFDHTARPSFAWVTLMAMEVWHWTPLVALLCYAGLRAIPEAYYQAAKIDGASSWAVFLYIQLPKMRGVLTIAVLLRWMDSFLIYAEPFSLTGGGPGNSTTFLSIYLVKLATGQFDLGPAAAFSLIYFLIVLLFSFIFYQALLNVGKGDKVS

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
103 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
128 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
129 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
138 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
139 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
140 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
141 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
142 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
143 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
144 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
145 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
146 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
149 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
181 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
184 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
185 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
186 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
193 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 2511231024 Pseudomonas sp. GM84 Isolate Nodule
199 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
200 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
201 8052494512 Pseudomonas putida LD6 Isolate Unclassified
202 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0.68
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.08
Nodule 1.36
Rhizoplane 1.02
Rhizosphere 80.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0001661 3300036712 Bacteria 13575
2 SwRhRL2b_contig_1491127 2162886007 Bacteria 1023
3 SwRhRL2b_contig_1565371 2162886007 Bacteria 1043
4 SwRhRL2b_contig_3365820 2162886007 Bacteria 1044
5 JGI25159J45721_1015503 3300002987 Bacteria 1665
6 Ga0055538_1000202 3300003751 Bacteria 35448
7 Ga0065704_10073318 3300005289 Bacteria 7317
8 Ga0065704_10079152 3300005289 Bacteria 4245
9 Ga0070676_10035825 3300005328 Bacteria 2856
10 Ga0070690_100002352 3300005330 Bacteria 10167
11 Ga0070690_100062643 3300005330 Bacteria 2399
12 Ga0070670_100072507 3300005331 Bacteria 2957
13 Ga0070677_10007244 3300005333 Bacteria 3697
14 Ga0068869_100149222 3300005334 Bacteria 1812
15 Ga0068869_100158976 3300005334 Bacteria 1758
16 Ga0070666_10077606 3300005335 Bacteria 2267
17 Ga0070689_100566369 3300005340 Bacteria 980
18 Ga0070687_100007590 3300005343 Bacteria 4534
19 Ga0070661_100012342 3300005344 Bacteria 5977
20 Ga0070668_100012169 3300005347 Bacteria 6407
21 Ga0070668_100384741 3300005347 Bacteria 1195
22 Ga0070669_100010482 3300005353 Bacteria 6584
23 Ga0070675_100000334 3300005354 Bacteria 31880
24 Ga0070674_100214269 3300005356 Bacteria 1495
25 Ga0070673_100001684 3300005364 Bacteria 13111
26 Ga0070688_100011844 3300005365 Bacteria 4864
27 Ga0070701_10154846 3300005438 Bacteria 1323
28 Ga0070700_100068847 3300005441 Bacteria 2252
29 Ga0070662_100001151 3300005457 Bacteria 16218
30 Ga0070681_10275378 3300005458 Bacteria 1594
31 Ga0068867_100166687 3300005459 Bacteria 1741
32 Ga0070684_100007027 3300005535 Bacteria 8748
33 Ga0068853_100297554 3300005539 Bacteria 1491
34 Ga0070672_100070932 3300005543 Bacteria 2770
35 Ga0070686_100008958 3300005544 Bacteria 5605
36 Ga0070665_100004992 3300005548 Bacteria 13760
37 Ga0070665_100171958 3300005548 Bacteria 2167
38 Ga0070664_100000660 3300005564 Bacteria 26358
39 Ga0068857_100161716 3300005577 Bacteria 2032
40 Ga0070702_100003816 3300005615 Bacteria 6811
41 Ga0068859_100004987 3300005617 Bacteria 13484
42 Ga0068864_100006665 3300005618 Bacteria 9456
43 Ga0068861_100005105 3300005719 Bacteria 8851
44 Ga0068851_10001221 3300005834 Bacteria 11166
45 Ga0068870_10001113 3300005840 Bacteria 10708
46 Ga0068863_100000669 3300005841 Bacteria 34544
47 Ga0068858_100031485 3300005842 Bacteria 4927
48 Ga0068860_100154021 3300005843 Bacteria 2215
49 Ga0068862_100001687 3300005844 Bacteria 20016
50 Ga0068862_100087709 3300005844 Bacteria 2706
51 Ga0081455_10007618 3300005937 Bacteria 11377
52 Ga0081455_10043108 3300005937 Bacteria 3952
53 Ga0081539_10000155 3300005985 Bacteria 159271
54 Ga0075370_10019330 3300006353 Bacteria 3709
55 Ga0075428_100002284 3300006844 Bacteria 20741
56 Ga0075428_100009658 3300006844 Bacteria 10713
57 Ga0075428_100313265 3300006844 Bacteria 1687
58 Ga0075428_100512737 3300006844 Bacteria 1283
59 Ga0075430_100008080 3300006846 Bacteria 8892
60 Ga0075430_100028183 3300006846 Bacteria 4771
61 Ga0075431_100000523 3300006847 Bacteria 32218
62 Ga0075431_100001340 3300006847 Bacteria 22525
63 Ga0075431_100093712 3300006847 Bacteria 3099
64 Ga0075429_100002538 3300006880 Bacteria 15378
65 Ga0068865_100133589 3300006881 Bacteria 1862
66 Ga0097620_100004987 3300006931 Bacteria 13484
67 Ga0099823_1000091 3300006944 Bacteria 43725
68 Ga0105244_10003632 3300009036 Bacteria 10930
69 Ga0105244_10012038 3300009036 Bacteria 5143
70 Ga0105250_10017893 3300009092 Bacteria 2876
71 Ga0105250_10019226 3300009092 Bacteria 2762
72 Ga0105250_10022367 3300009092 Bacteria 2550
73 Ga0111539_10001838 3300009094 Bacteria 28225
74 Ga0111539_10164501 3300009094 Bacteria 2595
75 Ga0111539_10234015 3300009094 Bacteria 2139
76 Ga0105247_10001774 3300009101 Bacteria 15181
77 Ga0114129_10001665 3300009147 Bacteria 30256
78 Ga0114129_10120859 3300009147 Bacteria 3606
79 Ga0105243_10473368 3300009148 Bacteria 1180
80 Ga0105248_10001157 3300009177 Bacteria 29438
81 Ga0105249_10002524 3300009553 Bacteria 15842
82 Ga0105249_10012112 3300009553 Bacteria 7592
83 Ga0105246_10079275 3300011119 Bacteria 2335
84 Ga0105246_10167292 3300011119 Bacteria 1680
85 Ga0157373_10117659 3300013100 Bacteria 1868
86 Ga0163162_10238042 3300013306 Bacteria 1951
87 Ga0157375_10073044 3300013308 Bacteria 3449
88 Ga0163163_10034223 3300014325 Bacteria 4918
89 Ga0163163_10352743 3300014325 Bacteria 1527
90 Ga0157380_10158717 3300014326 Bacteria 1963
91 Ga0182008_10000141 3300014497 Bacteria 55405
92 Ga0163161_10178184 3300017792 Bacteria 1628
93 Ga0209677_102825 3300025253 Bacteria 6140
94 Ga0209676_1002577 3300025292 Bacteria 12514
95 Ga0207697_10045472 3300025315 Bacteria 1807
96 Ga0207696_1000023 3300025711 Bacteria 422195
97 Ga0207696_1009529 3300025711 Bacteria 3617
98 Ga0207655_1000302 3300025728 Bacteria 74492
99 Ga0207655_1000658 3300025728 Bacteria 41061
100 Ga0207655_1012271 3300025728 Bacteria 5023
101 Ga0207713_1001043 3300025735 Bacteria 24019
102 Ga0207713_1011545 3300025735 Bacteria 4790
103 Ga0207710_10005146 3300025900 Bacteria 5652
104 Ga0207680_10060547 3300025903 Bacteria 2305
105 Ga0207645_10048002 3300025907 Bacteria 2726
106 Ga0207643_10013751 3300025908 Bacteria 4390
107 Ga0207705_10438848 3300025909 Bacteria 1012
108 Ga0207662_10002996 3300025918 Bacteria 8603
109 Ga0207681_10021496 3300025923 Bacteria 4102
110 Ga0207694_10385046 3300025924 Bacteria 1164
111 Ga0207650_10049352 3300025925 Bacteria 3107
112 Ga0207706_10007742 3300025933 Bacteria 9916
113 Ga0207706_10062578 3300025933 Bacteria 3277
114 Ga0207670_10047470 3300025936 Bacteria 2860
115 Ga0207670_10128319 3300025936 Bacteria 1854
116 Ga0207704_10039643 3300025938 Bacteria 2745
117 Ga0207691_10034772 3300025940 Bacteria 4683
118 Ga0207711_10003766 3300025941 Bacteria 13058
119 Ga0207689_10113311 3300025942 Bacteria 2229
120 Ga0207661_10244035 3300025944 Bacteria 1595
121 Ga0207679_10049323 3300025945 Bacteria 3071
122 Ga0207651_10023700 3300025960 Bacteria 3782
123 Ga0207712_10006765 3300025961 Bacteria 7229
124 Ga0207712_10019476 3300025961 Bacteria 4432
125 Ga0207712_10323326 3300025961 Bacteria 1273
126 Ga0207668_10009140 3300025972 Bacteria 5925
127 Ga0207703_10050891 3300026035 Bacteria 3354
128 Ga0207708_10081252 3300026075 Bacteria 2491
129 Ga0207641_10002965 3300026088 Bacteria 15354
130 Ga0207648_10002416 3300026089 Bacteria 20107
131 Ga0207676_10006000 3300026095 Bacteria 8567
132 Ga0207674_10056080 3300026116 Bacteria 4003
133 Ga0207674_10094492 3300026116 Bacteria 2976
134 Ga0207675_100001062 3300026118 Bacteria 27254
135 Ga0207675_100028003 3300026118 Bacteria 5247
136 Ga0209389_1000078 3300027296 Bacteria 90574
137 Ga0209371_1000567 3300027312 Bacteria 33537
138 Ga0209995_1024847 3300027471 Bacteria 998
139 Ga0209970_1010109 3300027614 Bacteria 1541
140 Ga0207428_10042947 3300027907 Bacteria 3654
141 Ga0207428_10264317 3300027907 Bacteria 1281
142 Ga0268266_10119862 3300028379 Bacteria 2340
143 Ga0268265_10000559 3300028380 Bacteria 37946
144 Ga0268265_10001397 3300028380 Bacteria 20461
145 Ga0268265_10244104 3300028380 Bacteria 1587
146 Ga0268264_10120410 3300028381 Bacteria 2312
147 Ga0268256_1000495 3300030500 Bacteria 33537
148 Ga0307511_10007232 3300030521 Bacteria 11186
149 Ga0307511_10025254 3300030521 Bacteria 5483
150 Ga0316180_1052175 3300030736 Bacteria 1275
151 Ga0307509_10000293 3300031507 Bacteria 82770
152 Ga0307408_100009114 3300031548 Bacteria 6546
153 Ga0307408_100084907 3300031548 Bacteria 2376
154 Ga0307514_10232060 3300031649 Bacteria 1117
155 Ga0316575_10064507 3300031665 Bacteria 1466
156 Ga0316575_10126120 3300031665 Bacteria 1048
157 Ga0316579_10005024 3300031691 Bacteria 5306
158 Ga0316576_10000605 3300031727 Bacteria 17199
159 Ga0316576_10003841 3300031727 Bacteria 8898
160 Ga0316576_10023883 3300031727 Bacteria 4264
161 Ga0316576_10062599 3300031727 Bacteria 2729
162 Ga0316578_10005349 3300031728 Bacteria 6210
163 Ga0316578_10009243 3300031728 Bacteria 5060
164 Ga0316578_10022515 3300031728 Bacteria 3514
165 Ga0316578_10028070 3300031728 Bacteria 3185
166 Ga0316578_10061019 3300031728 Bacteria 2220
167 Ga0307516_10006586 3300031730 Bacteria 13581
168 Ga0307405_10096399 3300031731 Bacteria 1972
169 Ga0316577_10007394 3300031733 Bacteria 5858
170 Ga0316577_10062766 3300031733 Bacteria 2074
171 Ga0307412_10005632 3300031911 Bacteria 7032
172 Ga0307412_10093698 3300031911 Bacteria 2107
173 Ga0307416_100139111 3300032002 Bacteria 2203
174 Ga0307411_10071459 3300032005 Bacteria 2352
175 Ga0307411_10161484 3300032005 Bacteria 1679
176 Ga0316583_10017335 3300032133 Bacteria 2591
177 Ga0316585_10001086 3300032137 Bacteria 7070
178 Ga0316585_10066751 3300032137 Bacteria 1165
179 Ga0316580_10002258 3300032139 Bacteria 5270
180 Ga0316593_10049762 3300032168 Bacteria 1413
181 Ga0307510_10023608 3300033180 Bacteria 7125
182 Ga0316588_1025054 3300033528 Bacteria 1376
183 Ga0316574_0014584 3300035398 Bacteria 4543
184 Ga0316574_0096019 3300035398 Bacteria 1894
185 Ga0316574_0102758 3300035398 Bacteria 1829
186 Ga0373937_0110412 3300036401 Bacteria 2557
187 Ga0316582_0014635 3300036647 Bacteria 4460
188 Ga0316582_0152926 3300036647 Bacteria 1560
189 Ga0316582_0248154 3300036647 Bacteria 1220
190 Ga0316584_0013190 3300036712 Bacteria 5844
191 Ga0316584_0035542 3300036712 Bacteria 3697
192 Ga0316584_0058136 3300036712 Bacteria 2895
193 Ga0316584_0163013 3300036712 Bacteria 1656
194 Ga0395899_0000586 3300037312 Bacteria 38344
195 Ga0395905_0009992 3300037471 Bacteria 9250
196 Ga0395905_0139261 3300037471 Bacteria 2283
197 Ga0400484_22813 3300038725 Bacteria 7169
198 Ga0400484_30997 3300038725 Bacteria 7087
199 Ga0400490_16881 3300038726 Bacteria 17730
200 Ga0400490_43285 3300038726 Bacteria 2904
201 Ga0400488_00563 3300038741 Bacteria 8966
202 Ga0400488_17989 3300038741 Bacteria 1720
203 Ga0400488_43000 3300038741 Bacteria 11324
204 Ga0400488_48340 3300038741 Bacteria 21376
205 Ga0400488_48785 3300038741 Bacteria 4105
206 Ga0400483_017797 3300039062 Bacteria 2160
207 Ga0400483_054515 3300039062 Bacteria 3667
208 Ga0400483_103873 3300039062 Bacteria 2628
209 Ga0400483_106750 3300039062 Bacteria 1685
210 Ga0400483_109993 3300039062 Bacteria 1180
211 Ga0400483_190972 3300039062 Bacteria 13002
212 Ga0400483_251342 3300039062 Bacteria 1943
213 Ga0400489_60309 3300039093 Bacteria 55883
214 Ga0400487_54439 3300039110 Bacteria 1185
215 Ga0400487_65860 3300039110 Bacteria 7934
216 Ga0439437_005507 3300042000 Bacteria 1392
217 Ga0439445_0020502 3300042004 Bacteria 1655
218 Ga0450911_000048 3300042115 Bacteria 51733
219 Ga0450905_001945 3300042142 Bacteria 2634
220 Ga0450905_005840 3300042142 Bacteria 1654
221 Ga0439458_0006001 3300042157 Bacteria 2718
222 Ga0450916_006256 3300042530 Bacteria 1398
223 Ga0450901_000127 3300042533 Bacteria 8432
224 Ga0451576_0460399 3300045051 Bacteria 1335
225 Ga0495592_0000836 3300046454 Bacteria 21408
226 Ga0495605_0125335 3300046474 Bacteria 1162
227 Ga0495585_0039740 3300046492 Bacteria 2644
228 Ga0495606_0054659 3300046507 Bacteria 2585
229 Ga0495620_0000004 3300046515 Bacteria 344148
230 Ga0495628_0069299 3300046516 Bacteria 2751
231 Ga0495631_0059566 3300046518 Bacteria 1658
232 Ga0495632_0001439 3300046519 Bacteria 19832
233 Ga0495643_0000297 3300046522 Bacteria 69703
234 Ga0495643_0002410 3300046522 Bacteria 14866
235 Ga0495648_0000188 3300046524 Bacteria 71222
236 Ga0495597_0012876 3300046542 Bacteria 4024
237 Ga0495669_0027466 3300046684 Bacteria 2490
238 Ga0495660_0010501 3300046810 Bacteria 5387
239 Ga0495636_0018634 3300047318 Bacteria 2786
240 Ga0495636_0128917 3300047318 Bacteria 1124
241 Ga0495672_0000014 3300047320 Bacteria 505636
242 Ga0495672_0131614 3300047320 Bacteria 1315
243 Ga0495686_0000682 3300047472 Bacteria 45923
244 Ga0495686_0022688 3300047472 Bacteria 4150
245 Ga0495615_0014867 3300048090 Bacteria 1653
246 Ga0496106_0213148 3300048909 Bacteria 1539
247 Ga0496112_0049726 3300048915 Bacteria 4109
248 Ga0496115_0125353 3300048918 Bacteria 2115
249 Ga0496117_0001021 3300048920 Bacteria 42741
250 Ga0496117_0006199 3300048920 Bacteria 12196
251 Ga0496117_0008095 3300048920 Bacteria 10065
252 Ga0496118_0001205 3300048921 Bacteria 39819
253 Ga0496118_0057792 3300048921 Bacteria 2904
254 Ga0496122_0001027 3300048925 Bacteria 49219
255 Ga0496123_0000240 3300048926 Bacteria 110383
256 Ga0496124_0016514 3300048927 Bacteria 7011
257 Ga0496124_0023248 3300048927 Bacteria 5663
258 Ga0496125_0015327 3300048928 Bacteria 7419
259 Ga0501031_0242682 3300049568 Bacteria 1171
260 Ga0501034_0001389 3300049571 Bacteria 32569
261 Ga0501034_0197196 3300049571 Bacteria 1973
262 Ga0501034_0320909 3300049571 Bacteria 1482
263 Ga0501047_0036542 3300049581 Bacteria 4748
264 Ga0501216_028213 3300049660 Bacteria 1022
265 Ga0501249_010168 3300049679 Bacteria 1964
266 Ga0501080_0674952 3300049742 Bacteria 913
267 Ga0501263_001024 3300049760 Bacteria 2470
268 Ga0501268_010180 3300049765 Bacteria 1459
269 Ga0501283_006712 3300049779 Bacteria 1619
270 Ga0501226_000019 3300049853 Bacteria 143773
271 nmdc:mga05p37_484_c1 3300050507 Bacteria 43547
272 nmdc:mga05p37_87338_c2 3300050507 Bacteria 2905
273 nmdc:mga09592_32575_c1 3300050508 Bacteria 4345
274 nmdc:mga09592_567_c1 3300050508 Bacteria 28034
275 nmdc:mga0qj67_10044_c1 3300050509 Bacteria 7061
276 nmdc:mga0qj67_14633_c1 3300050509 Bacteria 5932
277 nmdc:mga06r32_12317_c1 3300050510 Bacteria 7713
278 nmdc:mga06r32_1358_c1 3300050510 Bacteria 22092
279 nmdc:mga06r32_5940_c1 3300050510 Bacteria 10984
280 nmdc:mga08y16_122341_c1 3300050511 Bacteria 2708
281 nmdc:mga08y16_15688_c1 3300050511 Bacteria 7968
282 nmdc:mga08y16_169141_c1 3300050511 Bacteria 2270
283 Ga0500593_000091 3300053117 Bacteria 33320
284 Ga0500659_0002039 3300053135 Bacteria 12404
285 Ga0500568_0000005 3300053139 Bacteria 614296
286 Ga0500568_0035928 3300053139 Bacteria 2019
287 Ga0500588_0000235 3300053146 Bacteria 7924
288 Ga0500616_0000075 3300053153 Bacteria 221455
289 Ga0500622_0042486 3300053156 Bacteria 2361
290 2511372878 2511231024 Bacteria 5835885
291 2842339458 2842333319 Bacteria 8899485
292 3007805572 3007803356 Bacteria 5931491
293 8052496452 8052494512 Bacteria 5765634
294 8056139317 8056137416 Bacteria 6147080
295 Ga0316584_0001661
296 SwRhRL2b_contig_1491127
297 SwRhRL2b_contig_1565371
298 SwRhRL2b_contig_3365820
299 JGI25159J45721_1015503
300 Ga0055538_1000202
301 Ga0065704_10073318
302 Ga0065704_10079152
303 Ga0070676_10035825
304 Ga0070690_100002352
305 Ga0070690_100062643
306 Ga0070670_100072507
307 Ga0070677_10007244
308 Ga0068869_100149222
309 Ga0068869_100158976
310 Ga0070666_10077606
311 Ga0070689_100566369
312 Ga0070687_100007590
313 Ga0070661_100012342
314 Ga0070668_100012169
315 Ga0070668_100384741
316 Ga0070669_100010482
317 Ga0070675_100000334
318 Ga0070674_100214269
319 Ga0070673_100001684
320 Ga0070688_100011844
321 Ga0070701_10154846
322 Ga0070700_100068847
323 Ga0070662_100001151
324 Ga0070681_10275378
325 Ga0068867_100166687
326 Ga0070684_100007027
327 Ga0068853_100297554
328 Ga0070672_100070932
329 Ga0070686_100008958
330 Ga0070665_100004992
331 Ga0070665_100171958
332 Ga0070664_100000660
333 Ga0068857_100161716
334 Ga0070702_100003816
335 Ga0068859_100004987
336 Ga0068864_100006665
337 Ga0068861_100005105
338 Ga0068851_10001221
339 Ga0068870_10001113
340 Ga0068863_100000669
341 Ga0068858_100031485
342 Ga0068860_100154021
343 Ga0068862_100001687
344 Ga0068862_100087709
345 Ga0081455_10007618
346 Ga0081455_10043108
347 Ga0081539_10000155
348 Ga0075370_10019330
349 Ga0075428_100002284
350 Ga0075428_100009658
351 Ga0075428_100313265
352 Ga0075428_100512737
353 Ga0075430_100008080
354 Ga0075430_100028183
355 Ga0075431_100000523
356 Ga0075431_100001340
357 Ga0075431_100093712
358 Ga0075429_100002538
359 Ga0068865_100133589
360 Ga0097620_100004987
361 Ga0099823_1000091
362 Ga0105244_10003632
363 Ga0105244_10012038
364 Ga0105250_10017893
365 Ga0105250_10019226
366 Ga0105250_10022367
367 Ga0111539_10001838
368 Ga0111539_10164501
369 Ga0111539_10234015
370 Ga0105247_10001774
371 Ga0114129_10001665
372 Ga0114129_10120859
373 Ga0105243_10473368
374 Ga0105248_10001157
375 Ga0105249_10002524
376 Ga0105249_10012112
377 Ga0105246_10079275
378 Ga0105246_10167292
379 Ga0157373_10117659
380 Ga0163162_10238042
381 Ga0157375_10073044
382 Ga0163163_10034223
383 Ga0163163_10352743
384 Ga0157380_10158717
385 Ga0182008_10000141
386 Ga0163161_10178184
387 Ga0209677_102825
388 Ga0209676_1002577
389 Ga0207697_10045472
390 Ga0207696_1000023
391 Ga0207696_1009529
392 Ga0207655_1000302
393 Ga0207655_1000658
394 Ga0207655_1012271
395 Ga0207713_1001043
396 Ga0207713_1011545
397 Ga0207710_10005146
398 Ga0207680_10060547
399 Ga0207645_10048002
400 Ga0207643_10013751
401 Ga0207705_10438848
402 Ga0207662_10002996
403 Ga0207681_10021496
404 Ga0207694_10385046
405 Ga0207650_10049352
406 Ga0207706_10007742
407 Ga0207706_10062578
408 Ga0207670_10047470
409 Ga0207670_10128319
410 Ga0207704_10039643
411 Ga0207691_10034772
412 Ga0207711_10003766
413 Ga0207689_10113311
414 Ga0207661_10244035
415 Ga0207679_10049323
416 Ga0207651_10023700
417 Ga0207712_10006765
418 Ga0207712_10019476
419 Ga0207712_10323326
420 Ga0207668_10009140
421 Ga0207703_10050891
422 Ga0207708_10081252
423 Ga0207641_10002965
424 Ga0207648_10002416
425 Ga0207676_10006000
426 Ga0207674_10056080
427 Ga0207674_10094492
428 Ga0207675_100001062
429 Ga0207675_100028003
430 Ga0209389_1000078
431 Ga0209371_1000567
432 Ga0209995_1024847
433 Ga0209970_1010109
434 Ga0207428_10042947
435 Ga0207428_10264317
436 Ga0268266_10119862
437 Ga0268265_10000559
438 Ga0268265_10001397
439 Ga0268265_10244104
440 Ga0268264_10120410
441 Ga0268256_1000495
442 Ga0307511_10007232
443 Ga0307511_10025254
444 Ga0316180_1052175
445 Ga0307509_10000293
446 Ga0307408_100009114
447 Ga0307408_100084907
448 Ga0307514_10232060
449 Ga0316575_10064507
450 Ga0316575_10126120
451 Ga0316579_10005024
452 Ga0316576_10000605
453 Ga0316576_10003841
454 Ga0316576_10023883
455 Ga0316576_10062599
456 Ga0316578_10005349
457 Ga0316578_10009243
458 Ga0316578_10022515
459 Ga0316578_10028070
460 Ga0316578_10061019
461 Ga0307516_10006586
462 Ga0307405_10096399
463 Ga0316577_10007394
464 Ga0316577_10062766
465 Ga0307412_10005632
466 Ga0307412_10093698
467 Ga0307416_100139111
468 Ga0307411_10071459
469 Ga0307411_10161484
470 Ga0316583_10017335
471 Ga0316585_10001086
472 Ga0316585_10066751
473 Ga0316580_10002258
474 Ga0316593_10049762
475 Ga0307510_10023608
476 Ga0316588_1025054
477 Ga0316574_0014584
478 Ga0316574_0096019
479 Ga0316574_0102758
480 Ga0373937_0110412
481 Ga0316582_0014635
482 Ga0316582_0152926
483 Ga0316582_0248154
484 Ga0316584_0013190
485 Ga0316584_0035542
486 Ga0316584_0058136
487 Ga0316584_0163013
488 Ga0395899_0000586
489 Ga0395905_0009992
490 Ga0395905_0139261
491 Ga0400484_22813
492 Ga0400484_30997
493 Ga0400490_16881
494 Ga0400490_43285
495 Ga0400488_00563
496 Ga0400488_17989
497 Ga0400488_43000
498 Ga0400488_48340
499 Ga0400488_48785
500 Ga0400483_017797
501 Ga0400483_054515
502 Ga0400483_103873
503 Ga0400483_106750
504 Ga0400483_109993
505 Ga0400483_190972
506 Ga0400483_251342
507 Ga0400489_60309
508 Ga0400487_54439
509 Ga0400487_65860
510 Ga0439437_005507
511 Ga0439445_0020502
512 Ga0450911_000048
513 Ga0450905_001945
514 Ga0450905_005840
515 Ga0439458_0006001
516 Ga0450916_006256
517 Ga0450901_000127
518 Ga0451576_0460399
519 Ga0495592_0000836
520 Ga0495605_0125335
521 Ga0495585_0039740
522 Ga0495606_0054659
523 Ga0495620_0000004
524 Ga0495628_0069299
525 Ga0495631_0059566
526 Ga0495632_0001439
527 Ga0495643_0000297
528 Ga0495643_0002410
529 Ga0495648_0000188
530 Ga0495597_0012876
531 Ga0495669_0027466
532 Ga0495660_0010501
533 Ga0495636_0018634
534 Ga0495636_0128917
535 Ga0495672_0000014
536 Ga0495672_0131614
537 Ga0495686_0000682
538 Ga0495686_0022688
539 Ga0495615_0014867
540 Ga0496106_0213148
541 Ga0496112_0049726
542 Ga0496115_0125353
543 Ga0496117_0001021
544 Ga0496117_0006199
545 Ga0496117_0008095
546 Ga0496118_0001205
547 Ga0496118_0057792
548 Ga0496122_0001027
549 Ga0496123_0000240
550 Ga0496124_0016514
551 Ga0496124_0023248
552 Ga0496125_0015327
553 Ga0501031_0242682
554 Ga0501034_0001389
555 Ga0501034_0197196
556 Ga0501034_0320909
557 Ga0501047_0036542
558 Ga0501216_028213
559 Ga0501249_010168
560 Ga0501080_0674952
561 Ga0501263_001024
562 Ga0501268_010180
563 Ga0501283_006712
564 Ga0501226_000019
565 nmdc:mga05p37_484_c1
566 nmdc:mga05p37_87338_c2
567 nmdc:mga09592_32575_c1
568 nmdc:mga09592_567_c1
569 nmdc:mga0qj67_10044_c1
570 nmdc:mga0qj67_14633_c1
571 nmdc:mga06r32_12317_c1
572 nmdc:mga06r32_1358_c1
573 nmdc:mga06r32_5940_c1
574 nmdc:mga08y16_122341_c1
575 nmdc:mga08y16_15688_c1
576 nmdc:mga08y16_169141_c1
577 Ga0500593_000091
578 Ga0500659_0002039
579 Ga0500568_0000005
580 Ga0500568_0035928
581 Ga0500588_0000235
582 Ga0500616_0000075
583 Ga0500622_0042486
584 2511372878
585 2842339458
586 3007805572
587 8052496452
588 8056139317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

90

296

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8097 9 280
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7978 9 279
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7666 2 280
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7662 9 280
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.7627 53 276
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8825 47 283 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8692 47 287 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8655 47 283 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8587 47 285 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8499 47 287 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A529SKP8-F1-model_v4 Sugar ABC transporter permease 0.9732 64 224 GO:0005886
GO:0055085
AF-A0A529SKP8-F1-model_v4 Sugar ABC transporter permease 0.95 64 224 GO:0005886
GO:0055085
AF-A0A434FWY4-F1-model_v4 Sugar ABC transporter permease 0.9107 69 286 GO:0005886
GO:0055085
AF-A0A434FWY4-F1-model_v4 Sugar ABC transporter permease 0.8952 69 286 GO:0005886
GO:0055085
AF-A0A4Q6F296-F1-model_v4 deleted 0.8916 88 286

Map