F392196

General Info

Members Datasets Scaffolds Average Seq Length
294 150 588 154

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000128|Ga0395900_0000128_5918_6424
Length 168
Sequence LPVNIIKNKYNMEQRINAYEKGAAAFKALFSLGAYLAKSSIEKALLDLIDFRVSQINRCAYCLDMHSKDLRAAGETEQRLYMLEAWRETLLYSDRERAALAWAEAVTVVTDGFVPDAVYEQAREQFSEQELVDLTIGIITINCYNRINVAFRTPAGDYKVRQHAVQQN

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
145 2739367651 Pedobacter sp. OK291 Isolate Unclassified
146 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
147 2884411467 Dyella sp. AD56 Isolate Rhizosphere
148 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
149 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
150 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0.34
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 0
Rhizoplane 0
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 6.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0000128 3300037418 Bacteria 127446
2 JGI25152J39213_1002813 3300002773 Bacteria 6283
3 JGI25150J39212_1000001 3300002774 Bacteria 1318726
4 JGI25151J46595_10000005 3300003187 Bacteria 431598
5 JGI25406J46586_10002563 3300003203 Bacteria 8582
6 JGI25153J46596_10000040 3300003215 Bacteria 165523
7 rootH1_10150998 3300003316 Unclassified 1402
8 rootH2_10075519 3300003320 Bacteria 5356
9 rootL2_10017333 3300003322 Bacteria 5289
10 Ga0055536_1000008 3300003781 Bacteria 335729
11 Ga0055530_10001133 3300003791 Bacteria 20756
12 Ga0058862_12040140 3300004803 Bacteria 1460
13 Ga0070658_10001030 3300005327 Bacteria 23838
14 Ga0070658_10016216 3300005327 Bacteria 5961
15 Ga0070658_10262296 3300005327 Bacteria 1467
16 Ga0070658_10295247 3300005327 Bacteria 1381
17 Ga0070658_10324316 3300005327 Bacteria 1315
18 Ga0070683_100343651 3300005329 Bacteria 1421
19 Ga0070683_100548494 3300005329 Bacteria 1105
20 Ga0070683_101674884 3300005329 Bacteria 612
21 Ga0068869_100021884 3300005334 Bacteria 4400
22 Ga0070666_10000128 3300005335 Bacteria 53252
23 Ga0070680_100000645 3300005336 Bacteria 24317
24 Ga0070680_100003607 3300005336 Bacteria 11556
25 Ga0070680_100245905 3300005336 Bacteria 1512
26 Ga0070680_100250179 3300005336 Bacteria 1498
27 Ga0070680_100373938 3300005336 Bacteria 1213
28 Ga0070680_100891123 3300005336 Bacteria 767
29 Ga0070682_100003068 3300005337 Bacteria 9255
30 Ga0070682_100290073 3300005337 Bacteria 1196
31 Ga0070660_100008530 3300005339 Bacteria 7175
32 Ga0070660_100040261 3300005339 Bacteria 3556
33 Ga0070660_100180514 3300005339 Bacteria 1708
34 Ga0070660_100349120 3300005339 Bacteria 1218
35 Ga0070660_100624416 3300005339 Bacteria 902
36 Ga0070660_100721127 3300005339 Unclassified 836
37 Ga0070689_100144947 3300005340 Bacteria 1912
38 Ga0070691_10007303 3300005341 Bacteria 5058
39 Ga0070691_10098988 3300005341 Bacteria 1446
40 Ga0070668_100326611 3300005347 Bacteria 1293
41 Ga0070671_100197240 3300005355 Bacteria 1707
42 Ga0070659_100116266 3300005366 Unclassified 2162
43 Ga0070659_100445415 3300005366 Bacteria 1098
44 Ga0070663_100137326 3300005455 Bacteria 1863
45 Ga0070681_10007755 3300005458 Bacteria 10494
46 Ga0070681_10200457 3300005458 Bacteria 1914
47 Ga0070681_10463266 3300005458 Bacteria 1180
48 Ga0070679_100000242 3300005530 Bacteria 45444
49 Ga0070679_100009738 3300005530 Bacteria 9089
50 Ga0070679_100027498 3300005530 Bacteria 5599
51 Ga0070679_100211468 3300005530 Bacteria 1903
52 Ga0070679_100570745 3300005530 Bacteria 1075
53 Ga0070679_100575940 3300005530 Bacteria 1069
54 Ga0070679_100828462 3300005530 Bacteria 868
55 Ga0068853_100068354 3300005539 Bacteria 3088
56 Ga0068853_100202277 3300005539 Bacteria 1808
57 Ga0068853_100264544 3300005539 Bacteria 1582
58 Ga0068853_100469455 3300005539 Bacteria 1185
59 Ga0070695_100062000 3300005545 Bacteria 2427
60 Ga0070693_100060736 3300005547 Bacteria 2195
61 Ga0068855_100021828 3300005563 Bacteria 7679
62 Ga0068855_100102587 3300005563 Bacteria 3292
63 Ga0068855_100142517 3300005563 Bacteria 2730
64 Ga0068855_100302960 3300005563 Bacteria 1769
65 Ga0068855_100544508 3300005563 Bacteria 1257
66 Ga0068855_100696965 3300005563 Bacteria 1087
67 Ga0068855_100852129 3300005563 Bacteria 966
68 Ga0070664_101112018 3300005564 Bacteria 744
69 Ga0068857_100001923 3300005577 Bacteria 16746
70 Ga0068857_100096648 3300005577 Unclassified 2647
71 Ga0068857_100408159 3300005577 Bacteria 1265
72 Ga0068854_100915378 3300005578 Bacteria 771
73 Ga0068854_101697334 3300005578 Bacteria 577
74 Ga0068856_100066043 3300005614 Bacteria 3575
75 Ga0068852_100001612 3300005616 Bacteria 15375
76 Ga0068852_100013719 3300005616 Bacteria 6210
77 Ga0068852_100019380 3300005616 Bacteria 5382
78 Ga0068852_100135578 3300005616 Unclassified 2272
79 Ga0068859_100000018 3300005617 Bacteria 248813
80 Ga0068859_100008935 3300005617 Bacteria 10122
81 Ga0068864_100241259 3300005618 Bacteria 1675
82 Ga0068861_100084324 3300005719 Bacteria 2494
83 Ga0068861_101472659 3300005719 Bacteria 667
84 Ga0068863_100092371 3300005841 Bacteria 2871
85 Ga0068863_100676001 3300005841 Unclassified 1025
86 Ga0068858_100016208 3300005842 Bacteria 7001
87 Ga0068860_100003974 3300005843 Bacteria 15174
88 Ga0068862_101410514 3300005844 Bacteria 700
89 Ga0081539_10000816 3300005985 Bacteria 60353
90 Ga0097621_100061625 3300006237 Bacteria 3077
91 Ga0075428_100075105 3300006844 Bacteria 3692
92 Ga0097620_100000018 3300006931 Bacteria 248813
93 Ga0097620_100008935 3300006931 Bacteria 10122
94 Ga0075435_100459663 3300007076 Bacteria 1098
95 Ga0105240_10008738 3300009093 Bacteria 14441
96 Ga0105240_10008805 3300009093 Bacteria 14374
97 Ga0105245_10672297 3300009098 Bacteria 1067
98 Ga0105247_10001120 3300009101 Bacteria 19973
99 Ga0105247_10300695 3300009101 Bacteria 1113
100 Ga0105241_10000510 3300009174 Bacteria 29254
101 Ga0105241_10001334 3300009174 Bacteria 18742
102 Ga0105241_10173406 3300009174 Bacteria 1783
103 Ga0105241_10273120 3300009174 Bacteria 1441
104 Ga0105241_10375799 3300009174 Bacteria 1240
105 Ga0105241_11749456 3300009174 Bacteria 605
106 Ga0105242_11115031 3300009176 Bacteria 804
107 Ga0105237_10001030 3300009545 Bacteria 37560
108 Ga0105237_10056638 3300009545 Bacteria 3923
109 Ga0105238_10050457 3300009551 Bacteria 4189
110 Ga0105238_11119698 3300009551 Bacteria 810
111 Ga0105249_10026873 3300009553 Bacteria 5189
112 Ga0105239_10007958 3300010375 Bacteria 12111
113 Ga0105239_10097318 3300010375 Unclassified 3252
114 Ga0105246_10140916 3300011119 Bacteria 1813
115 Ga0157373_10070859 3300013100 Bacteria 2463
116 Ga0157373_10073183 3300013100 Bacteria 2419
117 Ga0157373_10186171 3300013100 Bacteria 1462
118 Ga0157373_10516203 3300013100 Bacteria 864
119 Ga0157371_10016929 3300013102 Bacteria 5429
120 Ga0157371_10060484 3300013102 Bacteria 2686
121 Ga0157371_10076917 3300013102 Bacteria 2363
122 Ga0157371_10086517 3300013102 Bacteria 2220
123 Ga0157371_10199459 3300013102 Bacteria 1434
124 Ga0157371_10241803 3300013102 Bacteria 1299
125 Ga0157371_10518834 3300013102 Bacteria 881
126 Ga0157370_10001924 3300013104 Bacteria 25541
127 Ga0157370_10003947 3300013104 Bacteria 17264
128 Ga0157370_10016327 3300013104 Bacteria 7520
129 Ga0157370_10196933 3300013104 Bacteria 1870
130 Ga0157370_10743273 3300013104 Bacteria 894
131 Ga0157370_11078407 3300013104 Unclassified 726
132 Ga0157369_10018848 3300013105 Bacteria 7733
133 Ga0157369_10079672 3300013105 Bacteria 3508
134 Ga0157369_10200999 3300013105 Bacteria 2092
135 Ga0157369_10407376 3300013105 Bacteria 1410
136 Ga0157369_12154485 3300013105 Bacteria 565
137 Ga0157374_10146143 3300013296 Bacteria 2296
138 Ga0157374_11008859 3300013296 Bacteria 852
139 Ga0157378_10181462 3300013297 Bacteria 1980
140 Ga0163162_10000599 3300013306 Bacteria 33336
141 Ga0157372_10000495 3300013307 Bacteria 43372
142 Ga0157372_10003151 3300013307 Bacteria 17789
143 Ga0157372_10042223 3300013307 Bacteria 5043
144 Ga0157372_10066801 3300013307 Bacteria 4041
145 Ga0157372_10120920 3300013307 Bacteria 3007
146 Ga0157372_10589147 3300013307 Bacteria 1296
147 Ga0157372_12590008 3300013307 Bacteria 582
148 Ga0157375_10050309 3300013308 Bacteria 4087
149 Ga0157379_10024344 3300014968 Bacteria 5374
150 Ga0157376_10114390 3300014969 Bacteria 2380
151 Ga0207425_1000002 3300025245 Bacteria 1362590
152 Ga0209129_1000002 3300025258 Bacteria 1359086
153 Ga0209233_1006148 3300025261 Bacteria 3897
154 Ga0209676_1000042 3300025292 Bacteria 424130
155 Ga0209025_1000004 3300025294 Bacteria 1361782
156 Ga0209758_1000006 3300025297 Bacteria 1359562
157 Ga0209050_1000035 3300025298 Bacteria 424005
158 Ga0209051_1125067 3300025303 Bacteria 645
159 Ga0207710_10000063 3300025900 Bacteria 163065
160 Ga0207710_10199705 3300025900 Bacteria 987
161 Ga0207680_10000193 3300025903 Bacteria 29312
162 Ga0207647_10394903 3300025904 Unclassified 780
163 Ga0207705_10000831 3300025909 Bacteria 25212
164 Ga0207705_10007369 3300025909 Bacteria 8088
165 Ga0207705_10034277 3300025909 Bacteria 3629
166 Ga0207705_10202243 3300025909 Unclassified 1505
167 Ga0207705_10220153 3300025909 Unclassified 1441
168 Ga0207705_10221875 3300025909 Bacteria 1436
169 Ga0207705_10638343 3300025909 Bacteria 828
170 Ga0207654_10002836 3300025911 Bacteria 8788
171 Ga0207654_10062655 3300025911 Bacteria 2180
172 Ga0207654_10402300 3300025911 Bacteria 952
173 Ga0207654_10638005 3300025911 Bacteria 762
174 Ga0207707_10001326 3300025912 Bacteria 23010
175 Ga0207707_10002694 3300025912 Bacteria 15868
176 Ga0207707_10826002 3300025912 Bacteria 770
177 Ga0207695_10015086 3300025913 Bacteria 9114
178 Ga0207695_10150706 3300025913 Bacteria 2265
179 Ga0207671_10001806 3300025914 Bacteria 23915
180 Ga0207671_10803380 3300025914 Bacteria 746
181 Ga0207660_10003453 3300025917 Bacteria 10308
182 Ga0207660_10027848 3300025917 Unclassified 3861
183 Ga0207660_10290015 3300025917 Bacteria 1301
184 Ga0207657_10034468 3300025919 Bacteria 4551
185 Ga0207657_10044096 3300025919 Bacteria 3923
186 Ga0207657_10225497 3300025919 Unclassified 1500
187 Ga0207657_10401967 3300025919 Bacteria 1077
188 Ga0207652_10001967 3300025921 Bacteria 17765
189 Ga0207652_10002079 3300025921 Bacteria 17245
190 Ga0207652_10002817 3300025921 Bacteria 14595
191 Ga0207652_10003605 3300025921 Bacteria 12753
192 Ga0207652_10026996 3300025921 Bacteria 4784
193 Ga0207652_10357908 3300025921 Bacteria 1317
194 Ga0207652_10835193 3300025921 Bacteria 816
195 Ga0207652_11002480 3300025921 Bacteria 734
196 Ga0207644_11258922 3300025931 Bacteria 622
197 Ga0207690_10034241 3300025932 Bacteria 3271
198 Ga0207686_10842089 3300025934 Bacteria 737
199 Ga0207691_10056683 3300025940 Unclassified 3569
200 Ga0207689_10000602 3300025942 Bacteria 34433
201 Ga0207661_10126336 3300025944 Bacteria 2185
202 Ga0207661_10334721 3300025944 Bacteria 1363
203 Ga0207661_10472184 3300025944 Bacteria 1144
204 Ga0207667_10002332 3300025949 Bacteria 23768
205 Ga0207667_10016869 3300025949 Bacteria 8238
206 Ga0207667_10086157 3300025949 Bacteria 3251
207 Ga0207667_10322606 3300025949 Bacteria 1577
208 Ga0207667_11387135 3300025949 Bacteria 677
209 Ga0207651_10147304 3300025960 Bacteria 1828
210 Ga0207712_10033246 3300025961 Bacteria 3485
211 Ga0207658_10067423 3300025986 Bacteria 2695
212 Ga0207677_10241073 3300026023 Unclassified 1463
213 Ga0207703_10006445 3300026035 Bacteria 9375
214 Ga0207639_10032198 3300026041 Bacteria 3858
215 Ga0207639_10208972 3300026041 Bacteria 1679
216 Ga0207639_10445699 3300026041 Bacteria 1174
217 Ga0207639_10478473 3300026041 Bacteria 1135
218 Ga0207678_10102929 3300026067 Bacteria 2437
219 Ga0207702_10047151 3300026078 Bacteria 3629
220 Ga0207641_10000015 3300026088 Bacteria 321332
221 Ga0207641_10162605 3300026088 Bacteria 2031
222 Ga0207676_10011487 3300026095 Bacteria 6332
223 Ga0207674_10018272 3300026116 Bacteria 7624
224 Ga0207674_10387355 3300026116 Bacteria 1351
225 Ga0207675_101115740 3300026118 Bacteria 809
226 Ga0207698_10000452 3300026142 Bacteria 23731
227 Ga0207698_10012186 3300026142 Bacteria 5614
228 Ga0207698_10017920 3300026142 Bacteria 4813
229 Ga0207698_10052832 3300026142 Bacteria 3115
230 Ga0268264_10000844 3300028381 Bacteria 32786
231 Ga0307515_10044471 3300028794 Bacteria 6859
232 Ga0307414_10000375 3300032004 Bacteria 24537
233 Ga0373946_0397034 3300035171 Bacteria 696
234 Ga0373925_0087312 3300037068 Bacteria 2381
235 Ga0395899_0000017 3300037312 Bacteria 440179
236 Ga0395899_0035345 3300037312 Unclassified 3751
237 Ga0395899_0158124 3300037312 Bacteria 1602
238 Ga0395899_0209685 3300037312 Bacteria 1354
239 Ga0395899_0588142 3300037312 Bacteria 710
240 Ga0395899_0762370 3300037312 Bacteria 601
241 Ga0395900_0024749 3300037418 Bacteria 6144
242 Ga0395900_0095445 3300037418 Bacteria 3055
243 Ga0395900_0185699 3300037418 Bacteria 2110
244 Ga0395900_0218832 3300037418 Bacteria 1920
245 Ga0395898_0003807 3300037466 Bacteria 16705
246 Ga0395898_0033364 3300037466 Bacteria 5138
247 Ga0395898_0186258 3300037466 Bacteria 1983
248 Ga0395898_1014122 3300037466 Bacteria 765
249 Ga0395898_1592670 3300037466 Bacteria 577
250 Ga0395905_0281349 3300037471 Bacteria 1549
251 Ga0395905_0640290 3300037471 Bacteria 965
252 Ga0395901_0062425 3300038443 Bacteria 3877
253 Ga0395901_0067807 3300038443 Bacteria 3716
254 Ga0395901_0073611 3300038443 Bacteria 3563
255 Ga0395901_0095088 3300038443 Bacteria 3122
256 Ga0395901_0554586 3300038443 Bacteria 1164
257 Ga0395901_1063694 3300038443 Unclassified 781
258 Ga0466966_0183844 3300044684 Bacteria 1268
259 Ga0453684_0165940 3300044712 Bacteria 2607
260 Ga0451576_0249276 3300045051 Bacteria 1856
261 Ga0495650_0038428 3300046471 Bacteria 2074
262 Ga0495580_0162973 3300046472 Bacteria 1543
263 Ga0495584_0344253 3300046491 Bacteria 757
264 Ga0495606_0000213 3300046507 Bacteria 103305
265 Ga0495610_0000768 3300046512 Bacteria 30249
266 Ga0495637_0010944 3300046520 Bacteria 4372
267 Ga0495637_0011096 3300046520 Bacteria 4338
268 Ga0495668_0022449 3300046616 Bacteria 3607
269 Ga0495625_0191596 3300046660 Unclassified 1354
270 Ga0495687_000249 3300047443 Bacteria 72846
271 Ga0501032_0233549 3300049569 Bacteria 1196
272 Ga0501033_0156198 3300049570 Bacteria 1644
273 Ga0501034_0082568 3300049571 Bacteria 3215
274 Ga0501034_0188035 3300049571 Bacteria 2028
275 Ga0501037_1049739 3300049573 Bacteria 529
276 Ga0501043_0861207 3300049579 Bacteria 652
277 Ga0501072_0689606 3300049588 Bacteria 803
278 Ga0501074_0164927 3300049590 Bacteria 1582
279 Ga0501035_0195181 3300049822 Bacteria 1739
280 Ga0501035_0341802 3300049822 Unclassified 1254
281 Ga0501044_0234523 3300049823 Bacteria 1781
282 Ga0501044_0262710 3300049823 Bacteria 1664
283 nmdc:mga0k408_241_c1 3300050493 Bacteria 22414
284 nmdc:mga0rr50_444868_c1 3300050513 Bacteria 1098
285 Ga0500568_0017750 3300053139 Bacteria 3133
286 Ga0500577_0001299 3300053142 Bacteria 6383
287 Ga0500588_0424977 3300053146 Bacteria 506
288 Ga0500604_0018491 3300053151 Bacteria 1942
289 2739591586 2739367651 Bacteria 6359826
290 2852629987 2852627209 Bacteria 5896285
291 2884413321 2884411467 Bacteria 5246714
292 2896115042 2896109856 Bacteria 7140722
293 2929153359 2929150217 Bacteria 5462483
294 2929923820 2929921140 Bacteria 8649150
295 Ga0395900_0000128
296 JGI25152J39213_1002813
297 JGI25150J39212_1000001
298 JGI25151J46595_10000005
299 JGI25406J46586_10002563
300 JGI25153J46596_10000040
301 rootH1_10150998
302 rootH2_10075519
303 rootL2_10017333
304 Ga0055536_1000008
305 Ga0055530_10001133
306 Ga0058862_12040140
307 Ga0070658_10001030
308 Ga0070658_10016216
309 Ga0070658_10262296
310 Ga0070658_10295247
311 Ga0070658_10324316
312 Ga0070683_100343651
313 Ga0070683_100548494
314 Ga0070683_101674884
315 Ga0068869_100021884
316 Ga0070666_10000128
317 Ga0070680_100000645
318 Ga0070680_100003607
319 Ga0070680_100245905
320 Ga0070680_100250179
321 Ga0070680_100373938
322 Ga0070680_100891123
323 Ga0070682_100003068
324 Ga0070682_100290073
325 Ga0070660_100008530
326 Ga0070660_100040261
327 Ga0070660_100180514
328 Ga0070660_100349120
329 Ga0070660_100624416
330 Ga0070660_100721127
331 Ga0070689_100144947
332 Ga0070691_10007303
333 Ga0070691_10098988
334 Ga0070668_100326611
335 Ga0070671_100197240
336 Ga0070659_100116266
337 Ga0070659_100445415
338 Ga0070663_100137326
339 Ga0070681_10007755
340 Ga0070681_10200457
341 Ga0070681_10463266
342 Ga0070679_100000242
343 Ga0070679_100009738
344 Ga0070679_100027498
345 Ga0070679_100211468
346 Ga0070679_100570745
347 Ga0070679_100575940
348 Ga0070679_100828462
349 Ga0068853_100068354
350 Ga0068853_100202277
351 Ga0068853_100264544
352 Ga0068853_100469455
353 Ga0070695_100062000
354 Ga0070693_100060736
355 Ga0068855_100021828
356 Ga0068855_100102587
357 Ga0068855_100142517
358 Ga0068855_100302960
359 Ga0068855_100544508
360 Ga0068855_100696965
361 Ga0068855_100852129
362 Ga0070664_101112018
363 Ga0068857_100001923
364 Ga0068857_100096648
365 Ga0068857_100408159
366 Ga0068854_100915378
367 Ga0068854_101697334
368 Ga0068856_100066043
369 Ga0068852_100001612
370 Ga0068852_100013719
371 Ga0068852_100019380
372 Ga0068852_100135578
373 Ga0068859_100000018
374 Ga0068859_100008935
375 Ga0068864_100241259
376 Ga0068861_100084324
377 Ga0068861_101472659
378 Ga0068863_100092371
379 Ga0068863_100676001
380 Ga0068858_100016208
381 Ga0068860_100003974
382 Ga0068862_101410514
383 Ga0081539_10000816
384 Ga0097621_100061625
385 Ga0075428_100075105
386 Ga0097620_100000018
387 Ga0097620_100008935
388 Ga0075435_100459663
389 Ga0105240_10008738
390 Ga0105240_10008805
391 Ga0105245_10672297
392 Ga0105247_10001120
393 Ga0105247_10300695
394 Ga0105241_10000510
395 Ga0105241_10001334
396 Ga0105241_10173406
397 Ga0105241_10273120
398 Ga0105241_10375799
399 Ga0105241_11749456
400 Ga0105242_11115031
401 Ga0105237_10001030
402 Ga0105237_10056638
403 Ga0105238_10050457
404 Ga0105238_11119698
405 Ga0105249_10026873
406 Ga0105239_10007958
407 Ga0105239_10097318
408 Ga0105246_10140916
409 Ga0157373_10070859
410 Ga0157373_10073183
411 Ga0157373_10186171
412 Ga0157373_10516203
413 Ga0157371_10016929
414 Ga0157371_10060484
415 Ga0157371_10076917
416 Ga0157371_10086517
417 Ga0157371_10199459
418 Ga0157371_10241803
419 Ga0157371_10518834
420 Ga0157370_10001924
421 Ga0157370_10003947
422 Ga0157370_10016327
423 Ga0157370_10196933
424 Ga0157370_10743273
425 Ga0157370_11078407
426 Ga0157369_10018848
427 Ga0157369_10079672
428 Ga0157369_10200999
429 Ga0157369_10407376
430 Ga0157369_12154485
431 Ga0157374_10146143
432 Ga0157374_11008859
433 Ga0157378_10181462
434 Ga0163162_10000599
435 Ga0157372_10000495
436 Ga0157372_10003151
437 Ga0157372_10042223
438 Ga0157372_10066801
439 Ga0157372_10120920
440 Ga0157372_10589147
441 Ga0157372_12590008
442 Ga0157375_10050309
443 Ga0157379_10024344
444 Ga0157376_10114390
445 Ga0207425_1000002
446 Ga0209129_1000002
447 Ga0209233_1006148
448 Ga0209676_1000042
449 Ga0209025_1000004
450 Ga0209758_1000006
451 Ga0209050_1000035
452 Ga0209051_1125067
453 Ga0207710_10000063
454 Ga0207710_10199705
455 Ga0207680_10000193
456 Ga0207647_10394903
457 Ga0207705_10000831
458 Ga0207705_10007369
459 Ga0207705_10034277
460 Ga0207705_10202243
461 Ga0207705_10220153
462 Ga0207705_10221875
463 Ga0207705_10638343
464 Ga0207654_10002836
465 Ga0207654_10062655
466 Ga0207654_10402300
467 Ga0207654_10638005
468 Ga0207707_10001326
469 Ga0207707_10002694
470 Ga0207707_10826002
471 Ga0207695_10015086
472 Ga0207695_10150706
473 Ga0207671_10001806
474 Ga0207671_10803380
475 Ga0207660_10003453
476 Ga0207660_10027848
477 Ga0207660_10290015
478 Ga0207657_10034468
479 Ga0207657_10044096
480 Ga0207657_10225497
481 Ga0207657_10401967
482 Ga0207652_10001967
483 Ga0207652_10002079
484 Ga0207652_10002817
485 Ga0207652_10003605
486 Ga0207652_10026996
487 Ga0207652_10357908
488 Ga0207652_10835193
489 Ga0207652_11002480
490 Ga0207644_11258922
491 Ga0207690_10034241
492 Ga0207686_10842089
493 Ga0207691_10056683
494 Ga0207689_10000602
495 Ga0207661_10126336
496 Ga0207661_10334721
497 Ga0207661_10472184
498 Ga0207667_10002332
499 Ga0207667_10016869
500 Ga0207667_10086157
501 Ga0207667_10322606
502 Ga0207667_11387135
503 Ga0207651_10147304
504 Ga0207712_10033246
505 Ga0207658_10067423
506 Ga0207677_10241073
507 Ga0207703_10006445
508 Ga0207639_10032198
509 Ga0207639_10208972
510 Ga0207639_10445699
511 Ga0207639_10478473
512 Ga0207678_10102929
513 Ga0207702_10047151
514 Ga0207641_10000015
515 Ga0207641_10162605
516 Ga0207676_10011487
517 Ga0207674_10018272
518 Ga0207674_10387355
519 Ga0207675_101115740
520 Ga0207698_10000452
521 Ga0207698_10012186
522 Ga0207698_10017920
523 Ga0207698_10052832
524 Ga0268264_10000844
525 Ga0307515_10044471
526 Ga0307414_10000375
527 Ga0373946_0397034
528 Ga0373925_0087312
529 Ga0395899_0000017
530 Ga0395899_0035345
531 Ga0395899_0158124
532 Ga0395899_0209685
533 Ga0395899_0588142
534 Ga0395899_0762370
535 Ga0395900_0024749
536 Ga0395900_0095445
537 Ga0395900_0185699
538 Ga0395900_0218832
539 Ga0395898_0003807
540 Ga0395898_0033364
541 Ga0395898_0186258
542 Ga0395898_1014122
543 Ga0395898_1592670
544 Ga0395905_0281349
545 Ga0395905_0640290
546 Ga0395901_0062425
547 Ga0395901_0067807
548 Ga0395901_0073611
549 Ga0395901_0095088
550 Ga0395901_0554586
551 Ga0395901_1063694
552 Ga0466966_0183844
553 Ga0453684_0165940
554 Ga0451576_0249276
555 Ga0495650_0038428
556 Ga0495580_0162973
557 Ga0495584_0344253
558 Ga0495606_0000213
559 Ga0495610_0000768
560 Ga0495637_0010944
561 Ga0495637_0011096
562 Ga0495668_0022449
563 Ga0495625_0191596
564 Ga0495687_000249
565 Ga0501032_0233549
566 Ga0501033_0156198
567 Ga0501034_0082568
568 Ga0501034_0188035
569 Ga0501037_1049739
570 Ga0501043_0861207
571 Ga0501072_0689606
572 Ga0501074_0164927
573 Ga0501035_0195181
574 Ga0501035_0341802
575 Ga0501044_0234523
576 Ga0501044_0262710
577 nmdc:mga0k408_241_c1
578 nmdc:mga0rr50_444868_c1
579 Ga0500568_0017750
580 Ga0500577_0001299
581 Ga0500588_0424977
582 Ga0500604_0018491
583 2739591586
584 2852629987
585 2884413321
586 2896115042
587 2929153359
588 2929923820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

23

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9729 11 135
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9531 1 141
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9382 2 144
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9212 1 141
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9137 2 144
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9663 6 135 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9466 4 139 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.942 4 140 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9382 17 136 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9336 2 145 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7X6P6M7-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9928 28 135 GO:0051920
AF-A0A2V9JIF7-F1-model_v4 Carboxymuconolactone decarboxylase 0.9894 19 147 GO:0051920
AF-D5BGB8-F1-model_v4 Carboxymuconolactone decarboxylase 0.9883 19 136 GO:0051920
AF-A0A3D9P0U7-F1-model_v4 deleted 0.9851 1 150
AF-A0A220S825-F1-model_v4 Carboxymuconolactone decarboxylase 0.9821 1 150 GO:0051920

Map