F392285

General Info

Members Datasets Scaffolds Average Seq Length
294 173 248 196

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_027622|Ga0495687_027622_608_1285
Length 225
Sequence MVEDPALVAGSSHTYADRTLPQRHTMLPMAQDNGELDSLVRKRIRALRVAQGWSLEELAARARVSQSTLSRIENGRRRLALDQLVTLARALDTSLDQLVETAADDVVSHPMIDAAHGLMRWPIKAEPGMTVVRQRMTDPPPDNPSRLRAHPGREWLVVLSGTASLLLGNRRLRIETNQAAEFPTMLPHAIGAEGGPCEILGIFDRDARRGHQRGEDVGKANRPSP

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
3 2643221578 Streptomyces sp. Root63 Isolate Unclassified
4 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
5 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
6 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
7 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
8 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
9 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
10 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
11 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
12 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
13 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
14 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
15 2808606448 Streptomyces sp. 193411 Isolate Unclassified
16 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
17 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
18 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
19 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
20 2862574272 Streptomyces sp. AcE210 Isolate Nodule
21 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
22 2867369537 Streptomyces sp. Z26 Isolate Unclassified
23 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
24 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
25 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
26 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
27 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
28 2891562705 Microbispora tritici MT50 Isolate Unclassified
29 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
30 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
31 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
32 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
33 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
34 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
35 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
36 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
37 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
38 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
39 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
53 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
168 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
169 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
170 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
171 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
172 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
173 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.67
Metatranscriptomes 0.34
Isolates 15.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0.34
Rhizoplane 0
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10050078 3300003322 Bacteria 5245
2 rootH1_10026394 3300003316 Bacteria 2161
3 rootH1_10026394 3300003323 Bacteria 11193
4 Ga0006562J51391_1081766 3300003578 Bacteria 2190
5 Ga0070674_100084094 3300005356 Bacteria 2281
6 Ga0070714_100138984 3300005435 Bacteria 2178
7 Ga0081455_10297314 3300005937 Bacteria 1160
8 Ga0081538_10023710 3300005981 Bacteria 4401
9 Ga0075428_100344928 3300006844 Bacteria 1599
10 Ga0105033_105160 3300009986 Bacteria 1121
11 Ga0182008_10001094 3300014497 Bacteria 18695
12 Ga0207664_10676599 3300025929 Bacteria 928
13 Ga0207669_10019104 3300025937 Bacteria 3560
14 Ga0316176_1028947 3300030732 Bacteria 1154
15 Ga0316181_1062712 3300030744 Bacteria 920
16 Ga0307513_10016190 3300031456 Bacteria 9007
17 Ga0307513_10119116 3300031456 Bacteria 2612
18 Ga0307408_100399523 3300031548 Bacteria 1180
19 Ga0307413_10378333 3300031824 Bacteria 1102
20 Ga0307416_101132582 3300032002 Bacteria 887
21 Ga0307414_10115361 3300032004 Bacteria 2054
22 Ga0307411_10441476 3300032005 Bacteria 1086
23 Ga0373925_0032111 3300037068 Bacteria 3862
24 Ga0451841_0011076 3300041498 Bacteria 1003
25 Ga0466969_0001657 3300044656 Bacteria 11933
26 Ga0466961_0006413 3300044693 Bacteria 7471
27 Ga0466961_0022290 3300044693 Bacteria 4074
28 Ga0466963_0094005 3300044694 Bacteria 2045
29 Ga0466971_0015004 3300044719 Bacteria 3408
30 Ga0466970_0003927 3300044765 Bacteria 7284
31 Ga0466959_0004275 3300045049 Bacteria 9523
32 Ga0466958_0023356 3300045836 Bacteria 3629
33 Ga0466967_0241700 3300045976 Bacteria 1722
34 Ga0495592_0009969 3300046454 Bacteria 7154
35 Ga0495592_0017442 3300046454 Bacteria 5455
36 Ga0495603_0000269 3300046455 Bacteria 27503
37 Ga0495603_0020671 3300046455 Bacteria 3987
38 Ga0495603_0020856 3300046455 Bacteria 3967
39 Ga0495603_0076830 3300046455 Bacteria 1959
40 Ga0495603_0107575 3300046455 Bacteria 1627
41 Ga0495629_0000773 3300046459 Bacteria 25837
42 Ga0495629_0006860 3300046459 Bacteria 8408
43 Ga0495629_0030686 3300046459 Bacteria 3809
44 Ga0495629_0034443 3300046459 Bacteria 3580
45 Ga0495651_0023149 3300046462 Bacteria 4832
46 Ga0495653_0046009 3300046463 Bacteria 3379
47 Ga0495605_0001395 3300046474 Bacteria 15898
48 Ga0495662_0000478 3300046476 Bacteria 18151
49 Ga0495662_0044991 3300046476 Bacteria 2131
50 Ga0495664_0034950 3300046477 Bacteria 2957
51 Ga0495664_0298702 3300046477 Bacteria 972
52 Ga0495594_0017181 3300046499 Bacteria 3819
53 Ga0495594_0232184 3300046499 Bacteria 1051
54 Ga0495594_0357698 3300046499 Bacteria 831
55 Ga0495607_0246478 3300046501 Bacteria 862
56 Ga0495583_0031844 3300046506 Bacteria 2551
57 Ga0495583_0047543 3300046506 Bacteria 1972
58 Ga0495606_0002438 3300046507 Bacteria 21620
59 Ga0495606_0067323 3300046507 Bacteria 2268
60 Ga0495608_0016250 3300046511 Bacteria 5148
61 Ga0495610_0123576 3300046512 Bacteria 1131
62 Ga0495616_0013918 3300046513 Bacteria 4520
63 Ga0495620_0020747 3300046515 Bacteria 3202
64 Ga0495620_0046154 3300046515 Bacteria 1882
65 Ga0495628_0029128 3300046516 Bacteria 4480
66 Ga0495628_0057859 3300046516 Bacteria 3049
67 Ga0495628_0155555 3300046516 Bacteria 1739
68 Ga0495628_0185787 3300046516 Bacteria 1571
69 Ga0495630_0060977 3300046517 Bacteria 2832
70 Ga0495631_0002604 3300046518 Bacteria 10084
71 Ga0495631_0103549 3300046518 Bacteria 1224
72 Ga0495643_0001987 3300046522 Bacteria 17114
73 Ga0495648_0056392 3300046524 Bacteria 2364
74 Ga0495666_0003996 3300046526 Bacteria 7457
75 Ga0495666_0064544 3300046526 Bacteria 1747
76 Ga0495652_0208752 3300046529 Bacteria 1476
77 Ga0495665_0035577 3300046531 Bacteria 2660
78 Ga0495640_0004523 3300046533 Bacteria 11090
79 Ga0495640_0010651 3300046533 Bacteria 7094
80 Ga0495640_0013219 3300046533 Bacteria 6277
81 Ga0495597_0131511 3300046542 Bacteria 1037
82 Ga0495622_0006187 3300046557 Bacteria 5559
83 Ga0495622_0108131 3300046557 Bacteria 1273
84 Ga0495667_0017881 3300046559 Bacteria 4789
85 Ga0495668_0011661 3300046616 Bacteria 5252
86 Ga0495668_0115146 3300046616 Bacteria 1470
87 Ga0495634_0111887 3300046642 Bacteria 1755
88 Ga0495634_0318887 3300046642 Bacteria 936
89 Ga0495625_0027575 3300046660 Bacteria 4273
90 Ga0495635_0010935 3300046663 Bacteria 6364
91 Ga0495661_0081921 3300046665 Bacteria 1859
92 Ga0495661_0086293 3300046665 Bacteria 1797
93 Ga0495657_0005601 3300046675 Bacteria 9910
94 Ga0495657_0006227 3300046675 Bacteria 9354
95 Ga0495599_0051932 3300046678 Bacteria 2568
96 Ga0495599_0171923 3300046678 Bacteria 1337
97 Ga0495623_0014472 3300046679 Bacteria 5106
98 Ga0495623_0031941 3300046679 Bacteria 3385
99 Ga0495646_0000915 3300046680 Bacteria 16761
100 Ga0495613_0004618 3300046689 Bacteria 10339
101 Ga0495613_0017056 3300046689 Bacteria 5406
102 Ga0495613_0031619 3300046689 Bacteria 3931
103 Ga0495613_0041247 3300046689 Bacteria 3418
104 Ga0495624_0010768 3300046690 Bacteria 6304
105 Ga0495670_0170862 3300046691 Bacteria 1145
106 Ga0495649_0118457 3300046694 Bacteria 1401
107 Ga0495589_0024943 3300046794 Bacteria 3036
108 Ga0495589_0063809 3300046794 Bacteria 1806
109 Ga0495600_0040336 3300046809 Bacteria 3040
110 Ga0495660_0041303 3300046810 Bacteria 2554
111 Ga0495660_0045829 3300046810 Bacteria 2399
112 Ga0495581_0089719 3300047315 Bacteria 1783
113 Ga0495604_0000185 3300047317 Bacteria 55651
114 Ga0495604_0005085 3300047317 Bacteria 10412
115 Ga0495604_0005130 3300047317 Bacteria 10367
116 Ga0495604_0054638 3300047317 Bacteria 3081
117 Ga0495604_0075994 3300047317 Bacteria 2527
118 Ga0495636_0192654 3300047318 Bacteria 928
119 Ga0495636_0267644 3300047318 Bacteria 794
120 Ga0495674_0072744 3300047319 Bacteria 2964
121 Ga0495674_0087336 3300047319 Bacteria 2669
122 Ga0495676_0003953 3300047321 Bacteria 13491
123 Ga0495676_0026092 3300047321 Bacteria 5034
124 Ga0495676_0045283 3300047321 Bacteria 3582
125 Ga0495676_0082680 3300047321 Bacteria 2429
126 Ga0495680_0035681 3300047322 Bacteria 4003
127 Ga0495687_027622 3300047443 Bacteria 2653
128 Ga0495687_064839 3300047443 Bacteria 1489
129 Ga0495675_0031389 3300047444 Bacteria 3391
130 Ga0495685_000922 3300047447 Bacteria 8910
131 Ga0495685_003452 3300047447 Bacteria 5050
132 Ga0495685_005537 3300047447 Bacteria 4123
133 Ga0495684_0061595 3300047471 Bacteria 2854
134 Ga0495686_0023541 3300047472 Bacteria 4061
135 Ga0495593_0036172 3300047673 Bacteria 2678
136 Ga0495593_0155792 3300047673 Bacteria 1154
137 Ga0495602_0301333 3300048088 Bacteria 1173
138 Ga0495614_0010104 3300048089 Bacteria 4166
139 Ga0495614_0351138 3300048089 Bacteria 687
140 Ga0496126_0244349 3300048929 Bacteria 1498
141 Ga0495678_018628 3300049459 Bacteria 3117
142 Ga0501031_0006775 3300049568 Bacteria 7475
143 Ga0501031_0014154 3300049568 Bacteria 5190
144 Ga0501031_0014595 3300049568 Bacteria 5108
145 Ga0501031_0195141 3300049568 Bacteria 1322
146 Ga0501032_0001525 3300049569 Bacteria 18459
147 Ga0501032_0006075 3300049569 Bacteria 8897
148 Ga0501032_0019196 3300049569 Bacteria 4783
149 Ga0501032_0031492 3300049569 Bacteria 3636
150 Ga0501032_0096128 3300049569 Bacteria 1964
151 Ga0501032_0228401 3300049569 Bacteria 1210
152 Ga0501033_0004102 3300049570 Bacteria 11740
153 Ga0501033_0005395 3300049570 Bacteria 10132
154 Ga0501033_0058598 3300049570 Bacteria 2844
155 Ga0501033_0077030 3300049570 Bacteria 2447
156 Ga0501033_0132220 3300049570 Bacteria 1807
157 Ga0501034_0004749 3300049571 Bacteria 15041
158 Ga0501034_0012425 3300049571 Bacteria 8794
159 Ga0501034_0028637 3300049571 Bacteria 5669
160 Ga0501034_0191593 3300049571 Bacteria 2006
161 Ga0501034_0236081 3300049571 Bacteria 1776
162 Ga0501036_0007960 3300049572 Bacteria 8674
163 Ga0501036_0014197 3300049572 Bacteria 6626
164 Ga0501036_0025072 3300049572 Bacteria 5029
165 Ga0501036_0025823 3300049572 Bacteria 4957
166 Ga0501036_0098773 3300049572 Bacteria 2468
167 Ga0501036_0363404 3300049572 Bacteria 1208
168 Ga0501036_0445673 3300049572 Bacteria 1079
169 Ga0501037_0003715 3300049573 Bacteria 11080
170 Ga0501037_0004734 3300049573 Bacteria 9890
171 Ga0501037_0020681 3300049573 Bacteria 4859
172 Ga0501037_0044548 3300049573 Bacteria 3258
173 Ga0501037_0086628 3300049573 Bacteria 2267
174 Ga0501038_0000223 3300049574 Bacteria 48354
175 Ga0501038_0034470 3300049574 Bacteria 4450
176 Ga0501038_0057302 3300049574 Bacteria 3345
177 Ga0501038_0136367 3300049574 Bacteria 2010
178 Ga0501038_0155567 3300049574 Bacteria 1862
179 Ga0501038_0232612 3300049574 Bacteria 1466
180 Ga0501038_0599865 3300049574 Bacteria 833
181 Ga0501039_0073987 3300049575 Bacteria 2647
182 Ga0501039_0102517 3300049575 Bacteria 2234
183 Ga0501040_0124452 3300049576 Bacteria 1810
184 Ga0501041_0001283 3300049577 Bacteria 13824
185 Ga0501042_0009601 3300049578 Bacteria 6456
186 Ga0501042_0021573 3300049578 Bacteria 4491
187 Ga0501042_0037129 3300049578 Bacteria 3457
188 Ga0501043_0000513 3300049579 Bacteria 34841
189 Ga0501043_0002672 3300049579 Bacteria 14954
190 Ga0501043_0044167 3300049579 Bacteria 3503
191 Ga0501043_0116340 3300049579 Bacteria 2098
192 Ga0501043_0248005 3300049579 Bacteria 1372
193 Ga0501046_0018357 3300049580 Bacteria 5821
194 Ga0501046_0065526 3300049580 Bacteria 2833
195 Ga0501046_0132665 3300049580 Bacteria 1888
196 Ga0501046_0275077 3300049580 Bacteria 1234
197 Ga0501047_0000433 3300049581 Bacteria 46523
198 Ga0501047_0015466 3300049581 Bacteria 7271
199 Ga0501047_0017322 3300049581 Bacteria 6899
200 Ga0501047_0025738 3300049581 Bacteria 5658
201 Ga0501047_0088709 3300049581 Bacteria 2969
202 Ga0501047_0526477 3300049581 Bacteria 1007
203 Ga0501048_0005335 3300049582 Bacteria 9783
204 Ga0501048_0006472 3300049582 Bacteria 8902
205 Ga0501048_0401188 3300049582 Bacteria 980
206 Ga0501067_0037494 3300049583 Bacteria 2692
207 Ga0501068_0010403 3300049584 Bacteria 5227
208 Ga0501069_0288119 3300049585 Bacteria 962
209 Ga0501070_0045325 3300049586 Bacteria 3657
210 Ga0501070_0329665 3300049586 Bacteria 1241
211 Ga0501070_0488328 3300049586 Bacteria 990
212 Ga0501072_0000482 3300049588 Bacteria 28669
213 Ga0501073_0088472 3300049589 Bacteria 2153
214 Ga0501074_0035956 3300049590 Bacteria 3589
215 Ga0501077_0016336 3300049593 Bacteria 4678
216 Ga0501080_0084686 3300049742 Bacteria 2945
217 Ga0501080_0141686 3300049742 Bacteria 2222
218 Ga0501080_0507589 3300049742 Bacteria 1077
219 Ga0501083_0046178 3300049744 Bacteria 2945
220 Ga0501282_013316 3300049778 Bacteria 890
221 Ga0501035_0000624 3300049822 Bacteria 38958
222 Ga0501035_0010380 3300049822 Bacteria 8637
223 Ga0501035_0027325 3300049822 Bacteria 5215
224 Ga0501035_0031918 3300049822 Bacteria 4796
225 Ga0501035_0035131 3300049822 Bacteria 4550
226 Ga0501035_0038095 3300049822 Bacteria 4353
227 Ga0501035_0169575 3300049822 Bacteria 1886
228 Ga0501044_0004307 3300049823 Bacteria 15958
229 Ga0501044_0054047 3300049823 Bacteria 4129
230 Ga0501044_0071393 3300049823 Bacteria 3530
231 Ga0501044_0072939 3300049823 Bacteria 3489
232 Ga0501044_0074723 3300049823 Bacteria 3442
233 Ga0501044_0079279 3300049823 Bacteria 3328
234 Ga0501044_0129781 3300049823 Bacteria 2515
235 Ga0501044_0343466 3300049823 Bacteria 1413
236 Ga0501044_0908541 3300049823 Bacteria 755
237 Ga0501045_0077076 3300049824 Bacteria 2456
238 Ga0501045_0168200 3300049824 Bacteria 1633
239 Ga0501045_0218415 3300049824 Bacteria 1420
240 Ga0495601_0004999 3300053077 Bacteria 7694
241 Ga0495655_0001375 3300053083 Bacteria 3735
242 Ga0495619_0045080 3300053085 Bacteria 2896
243 Ga0495619_0202230 3300053085 Bacteria 1375
244 Ga0500573_0058547 3300053140 Bacteria 2209
245 Ga0501084_0027405 3300054114 Bacteria 4760
246 Ga0501082_0035952 3300060353 Bacteria 4268
247 Ga0466962_0002344 3300061719 Bacteria 8983
248 Ga0530510_0005361 3300061734 Bacteria 8875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053083 Ga0495655_0001375 Ga0495655_0001375_1303_1902 182
2 3300049569 Ga0501032_0001525 Ga0501032_0001525_6821_7381 184
3 3300049573 Ga0501037_0004734 Ga0501037_0004734_703_1263 184
4 3300049574 Ga0501038_0000223 Ga0501038_0000223_9078_9638 184
5 3300049577 Ga0501041_0001283 Ga0501041_0001283_12452_13012 184
6 3300049578 Ga0501042_0021573 Ga0501042_0021573_3797_4357 184
7 3300049579 Ga0501043_0000513 Ga0501043_0000513_26564_27124 184
8 3300049588 Ga0501072_0000482 Ga0501072_0000482_2405_2965 184
9 3300049593 Ga0501077_0016336 Ga0501077_0016336_2581_3141 184
10 3300049823 Ga0501044_0004307 Ga0501044_0004307_8584_9144 184
11 iso_pu_bacteria 2935390628 2935395702 185
12 3300041498 Ga0451841_0011076 Ga0451841_0011076_20_583 187
13 3300049570 Ga0501033_0005395 Ga0501033_0005395_4004_4573 187
14 3300049571 Ga0501034_0004749 Ga0501034_0004749_6806_7375 187
15 3300049572 Ga0501036_0007960 Ga0501036_0007960_7030_7599 187
16 3300049576 Ga0501040_0124452 Ga0501040_0124452_35_604 187
17 3300049581 Ga0501047_0000433 Ga0501047_0000433_36878_37447 187
18 3300049583 Ga0501067_0037494 Ga0501067_0037494_790_1359 187
19 3300049584 Ga0501068_0010403 Ga0501068_0010403_35_604 187
20 3300049744 Ga0501083_0046178 Ga0501083_0046178_1092_1661 187
21 3300049822 Ga0501035_0000624 Ga0501035_0000624_25906_26475 187
22 3300054114 Ga0501084_0027405 Ga0501084_0027405_3116_3685 187
23 3300060353 Ga0501082_0035952 Ga0501082_0035952_2422_2991 187
24 3300061734 Ga0530510_0005361 Ga0530510_0005361_6989_7558 187
25 3300044693 Ga0466961_0022290 Ga0466961_0022290_2890_3468 188
26 3300049568 Ga0501031_0014595 Ga0501031_0014595_1940_2512 188
27 iso_pu_bacteria 2873151551 2873158389 188
28 iso_pu_bacteria 2891395885 2891397621 188
29 iso_pu_bacteria 2946045630 2946053001 188
30 3300003578 Ga0006562J51391_1081766 Ga0006562J51391_10817663 189
31 3300032004 Ga0307414_10115361 Ga0307414_101153612 189
32 3300045976 Ga0466967_0241700 Ga0466967_0241700_552_1124 189
33 3300048929 Ga0496126_0244349 Ga0496126_0244349_637_1209 189
34 3300049568 Ga0501031_0014154 Ga0501031_0014154_2360_2932 189
35 3300049569 Ga0501032_0006075 Ga0501032_0006075_6463_7035 189
36 3300049569 Ga0501032_0019196 Ga0501032_0019196_350_922 189
37 3300049569 Ga0501032_0228401 Ga0501032_0228401_427_996 189
38 3300049570 Ga0501033_0004102 Ga0501033_0004102_6569_7141 189
39 3300049570 Ga0501033_0058598 Ga0501033_0058598_2261_2833 189
40 3300049570 Ga0501033_0077030 Ga0501033_0077030_877_1449 189
41 3300049571 Ga0501034_0012425 Ga0501034_0012425_7764_8336 189
42 3300049572 Ga0501036_0014197 Ga0501036_0014197_902_1471 189
43 3300049572 Ga0501036_0025823 Ga0501036_0025823_2938_3510 189
44 3300049572 Ga0501036_0098773 Ga0501036_0098773_1436_2008 189
45 3300049572 Ga0501036_0363404 Ga0501036_0363404_376_948 189
46 3300049573 Ga0501037_0003715 Ga0501037_0003715_400_972 189
47 3300049573 Ga0501037_0020681 Ga0501037_0020681_474_1046 189
48 3300049574 Ga0501038_0057302 Ga0501038_0057302_1743_2315 189
49 3300049574 Ga0501038_0155567 Ga0501038_0155567_1193_1762 189
50 3300049574 Ga0501038_0232612 Ga0501038_0232612_725_1297 189
51 3300049575 Ga0501039_0073987 Ga0501039_0073987_1743_2315 189
52 3300049578 Ga0501042_0009601 Ga0501042_0009601_3524_4096 189
53 3300049579 Ga0501043_0044167 Ga0501043_0044167_1286_1858 189
54 3300049579 Ga0501043_0116340 Ga0501043_0116340_880_1452 189
55 3300049579 Ga0501043_0248005 Ga0501043_0248005_742_1311 189
56 3300049580 Ga0501046_0018357 Ga0501046_0018357_775_1347 189
57 3300049580 Ga0501046_0065526 Ga0501046_0065526_1944_2516 189
58 3300049580 Ga0501046_0275077 Ga0501046_0275077_281_853 189
59 3300049581 Ga0501047_0015466 Ga0501047_0015466_71_640 189
60 3300049581 Ga0501047_0017322 Ga0501047_0017322_752_1324 189
61 3300049581 Ga0501047_0088709 Ga0501047_0088709_1131_1703 189
62 3300049582 Ga0501048_0005335 Ga0501048_0005335_7765_8337 189
63 3300049586 Ga0501070_0045325 Ga0501070_0045325_336_908 189
64 3300049586 Ga0501070_0488328 Ga0501070_0488328_191_763 189
65 3300049589 Ga0501073_0088472 Ga0501073_0088472_1462_2034 189
66 3300049590 Ga0501074_0035956 Ga0501074_0035956_2267_2839 189
67 3300049742 Ga0501080_0084686 Ga0501080_0084686_446_1018 189
68 3300049742 Ga0501080_0141686 Ga0501080_0141686_557_1129 189
69 3300049822 Ga0501035_0010380 Ga0501035_0010380_5507_6079 189
70 3300049822 Ga0501035_0027325 Ga0501035_0027325_4056_4625 189
71 3300049822 Ga0501035_0031918 Ga0501035_0031918_1855_2427 189
72 3300049822 Ga0501035_0169575 Ga0501035_0169575_1068_1640 189
73 3300049823 Ga0501044_0054047 Ga0501044_0054047_3084_3656 189
74 3300049823 Ga0501044_0071393 Ga0501044_0071393_2559_3131 189
75 3300049823 Ga0501044_0074723 Ga0501044_0074723_984_1553 189
76 3300049823 Ga0501044_0129781 Ga0501044_0129781_302_874 189
77 3300049824 Ga0501045_0077076 Ga0501045_0077076_1723_2295 189
78 3300049824 Ga0501045_0168200 Ga0501045_0168200_668_1240 189
79 3300049824 Ga0501045_0218415 Ga0501045_0218415_266_835 189
80 iso_pu_bacteria 2918501144 2918502042 189
81 iso_pu_bacteria 8025530807 8025537874 189
82 3300046691 Ga0495670_0170862 Ga0495670_0170862_205_846 190
83 3300046794 Ga0495589_0024943 Ga0495589_0024943_1566_2207 190
84 3300047447 Ga0495685_003452 Ga0495685_003452_3419_4060 190
85 iso_pu_bacteria 2758568621 2760622179 190
86 iso_pu_bacteria 2867369537 2867370136 190
87 iso_pu_bacteria 2884693830 2884694684 190
88 iso_pu_bacteria 2895442618 2895447129 190
89 3300009986 Ga0105033_105160 Ga0105033_1051602 191
90 3300046665 Ga0495661_0081921 Ga0495661_0081921_336_983 191
91 3300049822 Ga0501035_0035131 Ga0501035_0035131_2071_2676 191
92 3300049823 Ga0501044_0343466 Ga0501044_0343466_654_1259 191
93 iso_pu_bacteria 2808606375 2808917273 191
94 iso_pu_bacteria 2862178590 2862180283 191
95 iso_pu_bacteria 8003314358 8003316052 191
96 iso_pu_bacteria 8056579771 8056580369 191
97 3300006844 Ga0075428_100344928 Ga0075428_1003449282 192
98 iso_pu_bacteria 2675903060 2676494186 192
99 iso_pu_bacteria 2802429296 2804849371 192
100 iso_pu_bacteria 2856741275 2856742359 192
101 iso_pu_bacteria 2891562705 2891569849 192
102 iso_pu_bacteria 8025413630 8025416023 192
103 iso_pu_bacteria 8048406513 8048407901 192
104 3300049778 Ga0501282_013316 Ga0501282_013316_238_825 193
105 iso_pu_bacteria 2547132111 2547412018 193
106 iso_pu_bacteria 2758568522 2760303885 193
107 iso_pu_bacteria 2808606448 2809236329 193
108 iso_pu_bacteria 2875391855 2875393649 193
109 iso_pu_bacteria 2919468124 2919474513 193
110 3300005356 Ga0070674_100084094 Ga0070674_1000840943 194
111 3300025937 Ga0207669_10019104 Ga0207669_100191043 194
112 3300030732 Ga0316176_1028947 Ga0316176_10289472 194
113 3300030744 Ga0316181_1062712 Ga0316181_10627122 194
114 3300049568 Ga0501031_0195141 Ga0501031_0195141_272_856 194
115 3300049571 Ga0501034_0236081 Ga0501034_0236081_622_1206 194
116 3300049572 Ga0501036_0445673 Ga0501036_0445673_191_775 194
117 3300049573 Ga0501037_0086628 Ga0501037_0086628_1627_2211 194
118 3300044656 Ga0466969_0001657 Ga0466969_0001657_10037_10633 195
119 3300044693 Ga0466961_0006413 Ga0466961_0006413_6058_6654 195
120 3300044719 Ga0466971_0015004 Ga0466971_0015004_2568_3164 195
121 3300044765 Ga0466970_0003927 Ga0466970_0003927_3284_3877 195
122 3300045049 Ga0466959_0004275 Ga0466959_0004275_7259_7855 195
123 3300045836 Ga0466958_0023356 Ga0466958_0023356_225_821 195
124 3300046455 Ga0495603_0107575 Ga0495603_0107575_839_1492 195
125 3300049569 Ga0501032_0096128 Ga0501032_0096128_386_973 195
126 3300049574 Ga0501038_0034470 Ga0501038_0034470_3452_4039 195
127 3300049575 Ga0501039_0102517 Ga0501039_0102517_280_867 195
128 3300049582 Ga0501048_0401188 Ga0501048_0401188_239_826 195
129 3300049585 Ga0501069_0288119 Ga0501069_0288119_278_865 195
130 3300049823 Ga0501044_0908541 Ga0501044_0908541_115_702 195
131 3300061719 Ga0466962_0002344 Ga0466962_0002344_1624_2220 195
132 iso_pu_bacteria 2643221578 2643903775 195
133 iso_pu_bacteria 2643221673 2644409938 195
134 iso_pu_bacteria 2643221678 2644443411 195
135 iso_pu_bacteria 2808606982 2811845893 195
136 iso_pu_bacteria 2867346516 2867350652 195
137 3300005435 Ga0070714_100138984 Ga0070714_1001389841 196
138 3300005981 Ga0081538_10023710 Ga0081538_100237103 196
139 3300025929 Ga0207664_10676599 Ga0207664_106765992 196
140 3300031548 Ga0307408_100399523 Ga0307408_1003995232 196
141 3300031824 Ga0307413_10378333 Ga0307413_103783332 196
142 3300032002 Ga0307416_101132582 Ga0307416_1011325822 196
143 3300032005 Ga0307411_10441476 Ga0307411_104414761 196
144 3300046455 Ga0495603_0000269 Ga0495603_0000269_7978_8583 196
145 3300046455 Ga0495603_0020671 Ga0495603_0020671_2515_3162 196
146 3300046459 Ga0495629_0000773 Ga0495629_0000773_19297_19902 196
147 3300046679 Ga0495623_0014472 Ga0495623_0014472_2237_2827 196
148 3300046689 Ga0495613_0004618 Ga0495613_0004618_8991_9596 196
149 3300047317 Ga0495604_0005085 Ga0495604_0005085_3959_4549 196
150 3300047321 Ga0495676_0026092 Ga0495676_0026092_1225_1830 196
151 3300048089 Ga0495614_0010104 Ga0495614_0010104_2902_3507 196
152 iso_pu_bacteria 2767802112 2768647702 196
153 iso_pu_bacteria 2784132148 2784592698 196
154 iso_pu_bacteria 2862574272 2862581711 196
155 iso_pu_bacteria 2966598605 2966605183 196
156 iso_pu_bacteria 8023623736 8023626685 196
157 3300037068 Ga0373925_0032111 Ga0373925_0032111_3046_3639 197
158 3300046454 Ga0495592_0009969 Ga0495592_0009969_3022_3615 197
159 3300046454 Ga0495592_0017442 Ga0495592_0017442_3069_3662 197
160 3300046455 Ga0495603_0020856 Ga0495603_0020856_579_1172 197
161 3300046455 Ga0495603_0076830 Ga0495603_0076830_202_795 197
162 3300046459 Ga0495629_0030686 Ga0495629_0030686_2621_3214 197
163 3300046459 Ga0495629_0034443 Ga0495629_0034443_257_850 197
164 3300046462 Ga0495651_0023149 Ga0495651_0023149_661_1254 197
165 3300046463 Ga0495653_0046009 Ga0495653_0046009_1216_1809 197
166 3300046474 Ga0495605_0001395 Ga0495605_0001395_3563_4156 197
167 3300046476 Ga0495662_0000478 Ga0495662_0000478_2976_3569 197
168 3300046477 Ga0495664_0034950 Ga0495664_0034950_1060_1653 197
169 3300046477 Ga0495664_0298702 Ga0495664_0298702_27_620 197
170 3300046499 Ga0495594_0017181 Ga0495594_0017181_2177_2770 197
171 3300046499 Ga0495594_0232184 Ga0495594_0232184_190_783 197
172 3300046506 Ga0495583_0031844 Ga0495583_0031844_1466_2059 197
173 3300046507 Ga0495606_0002438 Ga0495606_0002438_20754_21347 197
174 3300046511 Ga0495608_0016250 Ga0495608_0016250_3130_3723 197
175 3300046512 Ga0495610_0123576 Ga0495610_0123576_309_902 197
176 3300046513 Ga0495616_0013918 Ga0495616_0013918_2489_3082 197
177 3300046515 Ga0495620_0020747 Ga0495620_0020747_1059_1652 197
178 3300046516 Ga0495628_0029128 Ga0495628_0029128_814_1407 197
179 3300046516 Ga0495628_0155555 Ga0495628_0155555_546_1139 197
180 3300046517 Ga0495630_0060977 Ga0495630_0060977_1745_2338 197
181 3300046518 Ga0495631_0002604 Ga0495631_0002604_9166_9759 197
182 3300046526 Ga0495666_0003996 Ga0495666_0003996_3824_4417 197
183 3300046526 Ga0495666_0064544 Ga0495666_0064544_32_625 197
184 3300046531 Ga0495665_0035577 Ga0495665_0035577_1748_2341 197
185 3300046533 Ga0495640_0010651 Ga0495640_0010651_5232_5825 197
186 3300046542 Ga0495597_0131511 Ga0495597_0131511_235_828 197
187 3300046557 Ga0495622_0006187 Ga0495622_0006187_3839_4432 197
188 3300046557 Ga0495622_0108131 Ga0495622_0108131_256_849 197
189 3300046559 Ga0495667_0017881 Ga0495667_0017881_1737_2330 197
190 3300046616 Ga0495668_0011661 Ga0495668_0011661_2178_2771 197
191 3300046642 Ga0495634_0111887 Ga0495634_0111887_807_1400 197
192 3300046642 Ga0495634_0318887 Ga0495634_0318887_248_841 197
193 3300046660 Ga0495625_0027575 Ga0495625_0027575_2681_3274 197
194 3300046663 Ga0495635_0010935 Ga0495635_0010935_4000_4593 197
195 3300046665 Ga0495661_0086293 Ga0495661_0086293_23_616 197
196 3300046675 Ga0495657_0006227 Ga0495657_0006227_7794_8387 197
197 3300046678 Ga0495599_0051932 Ga0495599_0051932_202_795 197
198 3300046678 Ga0495599_0171923 Ga0495599_0171923_722_1315 197
199 3300046679 Ga0495623_0031941 Ga0495623_0031941_211_804 197
200 3300046680 Ga0495646_0000915 Ga0495646_0000915_5622_6215 197
201 3300046689 Ga0495613_0017056 Ga0495613_0017056_2354_2947 197
202 3300046690 Ga0495624_0010768 Ga0495624_0010768_5216_5809 197
203 3300046809 Ga0495600_0040336 Ga0495600_0040336_2293_2886 197
204 3300046810 Ga0495660_0041303 Ga0495660_0041303_570_1163 197
205 3300047315 Ga0495581_0089719 Ga0495581_0089719_372_965 197
206 3300047317 Ga0495604_0000185 Ga0495604_0000185_14432_15025 197
207 3300047317 Ga0495604_0054638 Ga0495604_0054638_1719_2312 197
208 3300047318 Ga0495636_0192654 Ga0495636_0192654_30_623 197
209 3300047319 Ga0495674_0072744 Ga0495674_0072744_1571_2164 197
210 3300047319 Ga0495674_0087336 Ga0495674_0087336_872_1465 197
211 3300047321 Ga0495676_0045283 Ga0495676_0045283_2404_2997 197
212 3300047321 Ga0495676_0082680 Ga0495676_0082680_47_640 197
213 3300047322 Ga0495680_0035681 Ga0495680_0035681_1987_2580 197
214 3300047444 Ga0495675_0031389 Ga0495675_0031389_2060_2653 197
215 3300047471 Ga0495684_0061595 Ga0495684_0061595_202_795 197
216 3300047472 Ga0495686_0023541 Ga0495686_0023541_2100_2693 197
217 3300047673 Ga0495593_0155792 Ga0495593_0155792_198_791 197
218 3300048088 Ga0495602_0301333 Ga0495602_0301333_537_1130 197
219 3300048089 Ga0495614_0351138 Ga0495614_0351138_34_627 197
220 3300049459 Ga0495678_018628 Ga0495678_018628_1895_2488 197
221 3300049574 Ga0501038_0599865 Ga0501038_0599865_111_704 197
222 3300049823 Ga0501044_0079279 Ga0501044_0079279_1513_2106 197
223 3300053077 Ga0495601_0004999 Ga0495601_0004999_5982_6575 197
224 3300053085 Ga0495619_0045080 Ga0495619_0045080_1078_1671 197
225 3300053085 Ga0495619_0202230 Ga0495619_0202230_634_1245 197
226 3300053140 Ga0500573_0058547 Ga0500573_0058547_547_1140 197
227 iso_pu_bacteria 2862290372 2862292951 197
228 iso_pu_bacteria 2891554331 2891557616 197
229 iso_pu_bacteria 2954721474 2954727406 197
230 iso_pu_bacteria 2954731030 2954740227 197
231 iso_pu_bacteria 2954740390 2954740505 197
232 iso_pu_bacteria 2954759201 2954766766 197
233 iso_pu_bacteria 8048127548 8048129178 197
234 iso_pu_bacteria 8048127548 8048131843 197
235 3300046506 Ga0495583_0047543 Ga0495583_0047543_540_1166 198
236 3300046507 Ga0495606_0067323 Ga0495606_0067323_190_816 198
237 3300046515 Ga0495620_0046154 Ga0495620_0046154_796_1422 198
238 3300046522 Ga0495643_0001987 Ga0495643_0001987_202_828 198
239 3300046524 Ga0495648_0056392 Ga0495648_0056392_370_996 198
240 3300046616 Ga0495668_0115146 Ga0495668_0115146_474_1100 198
241 3300046694 Ga0495649_0118457 Ga0495649_0118457_201_827 198
242 3300046810 Ga0495660_0045829 Ga0495660_0045829_1382_2008 198
243 3300047443 Ga0495687_064839 Ga0495687_064839_202_828 198
244 3300047447 Ga0495685_005537 Ga0495685_005537_1862_2488 198
245 3300044694 Ga0466963_0094005 Ga0466963_0094005_1334_1939 199
246 3300049571 Ga0501034_0028637 Ga0501034_0028637_4087_4695 199
247 3300049581 Ga0501047_0526477 Ga0501047_0526477_24_632 199
248 iso_pu_bacteria 2772190715 2772643731 199
249 iso_pu_bacteria 2808606359 2808846138 199
250 iso_pu_bacteria 2939582691 2939589430 199
251 3300031456 Ga0307513_10119116 Ga0307513_101191161 200
252 3300046459 Ga0495629_0006860 Ga0495629_0006860_5077_5718 200
253 3300046476 Ga0495662_0044991 Ga0495662_0044991_910_1512 200
254 3300046499 Ga0495594_0357698 Ga0495594_0357698_79_720 200
255 3300046501 Ga0495607_0246478 Ga0495607_0246478_68_679 200
256 3300046516 Ga0495628_0057859 Ga0495628_0057859_482_1123 200
257 3300046516 Ga0495628_0185787 Ga0495628_0185787_49_651 200
258 3300046518 Ga0495631_0103549 Ga0495631_0103549_502_1113 200
259 3300046529 Ga0495652_0208752 Ga0495652_0208752_518_1159 200
260 3300046533 Ga0495640_0004523 Ga0495640_0004523_4940_5542 200
261 3300046533 Ga0495640_0013219 Ga0495640_0013219_3126_3767 200
262 3300046675 Ga0495657_0005601 Ga0495657_0005601_4688_5290 200
263 3300046689 Ga0495613_0031619 Ga0495613_0031619_2759_3361 200
264 3300046689 Ga0495613_0041247 Ga0495613_0041247_2572_3213 200
265 3300046794 Ga0495589_0063809 Ga0495589_0063809_1119_1730 200
266 3300047317 Ga0495604_0005130 Ga0495604_0005130_5561_6163 200
267 3300047317 Ga0495604_0075994 Ga0495604_0075994_199_840 200
268 3300047318 Ga0495636_0267644 Ga0495636_0267644_145_756 200
269 3300047321 Ga0495676_0003953 Ga0495676_0003953_6049_6690 200
270 3300047443 Ga0495687_027622 Ga0495687_027622_608_1285 200
271 3300047447 Ga0495685_000922 Ga0495685_000922_1134_1745 200
272 3300047673 Ga0495593_0036172 Ga0495593_0036172_239_841 200
273 3300049568 Ga0501031_0006775 Ga0501031_0006775_3627_4232 200
274 3300049569 Ga0501032_0031492 Ga0501032_0031492_525_1130 200
275 3300049570 Ga0501033_0132220 Ga0501033_0132220_752_1357 200
276 3300049571 Ga0501034_0191593 Ga0501034_0191593_825_1430 200
277 3300049572 Ga0501036_0025072 Ga0501036_0025072_1944_2549 200
278 3300049573 Ga0501037_0044548 Ga0501037_0044548_1342_1947 200
279 3300049574 Ga0501038_0136367 Ga0501038_0136367_540_1145 200
280 3300049578 Ga0501042_0037129 Ga0501042_0037129_1901_2506 200
281 3300049579 Ga0501043_0002672 Ga0501043_0002672_7413_8018 200
282 3300049580 Ga0501046_0132665 Ga0501046_0132665_705_1310 200
283 3300049581 Ga0501047_0025738 Ga0501047_0025738_2481_3086 200
284 3300049582 Ga0501048_0006472 Ga0501048_0006472_2804_3409 200
285 3300049586 Ga0501070_0329665 Ga0501070_0329665_592_1197 200
286 3300049742 Ga0501080_0507589 Ga0501080_0507589_74_679 200
287 3300049822 Ga0501035_0038095 Ga0501035_0038095_451_1056 200
288 3300049823 Ga0501044_0072939 Ga0501044_0072939_451_1056 200
289 iso_pu_bacteria 2616644814 2616696145 200
290 3300005937 Ga0081455_10297314 Ga0081455_102973142 201
291 3300014497 Ga0182008_10001094 Ga0182008_100010943 201
292 3300031456 Ga0307513_10016190 Ga0307513_100161908 201
293 3300003322 rootL2_10050078 rootL2_100500784 204
294 3300003323 rootH1_10026394 rootH1_1002639411 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

44

98

0.98

PF13560

HTH_31

Helix-turn-helix domain

40

101

0.94

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

43

104

0.93

PF12844

HTH_19

Helix-turn-helix domain

42

103

0.92

PF07022

Phage_CI_repr

Bacteriophage CI repressor helix-turn-helix domain

42

103

0.88

PF07883

Cupin_2

Cupin domain

134

203

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.9416 12 73
6rnz-assembly2.cif.gz_B crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.9401 15 76
6rnx-assembly1.cif.gz_A crystal structure of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.9381 15 76
3vk0-assembly2.cif.gz_B crystal structure of hypothetical transcription factor nhtf from neisseria 0.9361 11 81
7nrd-assembly1.cif.gz_Sh structure of the yeast gcn1 bound to a colliding stalled 80s ribosome with mbf1, a/p-trna and p/e-trna 0.9301 13 66
ID Description Score Start End Superfamily
2b5aA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9416 12 73 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9375 12 73 1.10.260.40
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9358 12 73 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9295 14 76 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9293 16 67 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A652KMW9-F1-model_v4 Helix-turn-helix domain-containing protein 0.9676 4 75 GO:0003677
GO:0003700
GO:0005829
AF-A0A7U1EAQ7-F1-model_v4 deleted 0.9545 11 81
AF-A0A6B4TAR9-F1-model_v4 deleted 0.9431 14 77
AF-A0A0K9H0S0-F1-model_v4 DNA-binding protein 0.9414 11 79 GO:0003677
AF-A0A506U366-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9381 11 79 GO:0003677
GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
77.67 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map