F392287

General Info

Members Datasets Scaffolds Average Seq Length
294 181 283 196

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0072181|Ga0495686_0072181_493_1149
Length 218
Sequence MKTDYTKMKILVFDNYDSFTYNLVHLVEKIMHQKVDVYRNDQIPLEQVQEYDKIILSPGPGIPEEAGMLLPLIKEYASTKSILGVCLGHQAIGEAFGGKLVNLSTVYHGVATKIEMVKKKSEAGNQKSEGESPLFKGLPDELEVGRYHSWIVADEGFPKELEVTARDANNYIMALQHKKYDVQGVQFHPESVLTPDGESILRNWLTPKPLKGALGDLI

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
9 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
10 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
11 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
166 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
167 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
168 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
171 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
172 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
177 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
181 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.93
Nodule 0
Rhizoplane 0.68
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 6.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005751 3300001979 Bacteria 5210
2 JGI25158J39367_1007919 3300002739 Bacteria 1487
3 JGI25159J45721_1018729 3300002987 Bacteria 1385
4 rootH1_10114248 3300003316 Bacteria 1093
5 rootL2_10032237 3300003322 Bacteria 3650
6 rootL2_10032239 3300003322 Bacteria 2459
7 rootH1_10025440 3300003323 Bacteria 2938
8 rootH1_10269340 3300003323 Bacteria 1022
9 Ga0055535_1003449 3300003761 Bacteria 4482
10 Ga0055542_1002114 3300003762 Bacteria 7298
11 Ga0055526_1013667 3300003771 Bacteria 3412
12 Ga0055531_10000131 3300003794 Bacteria 85257
13 Ga0065165_1013969 3300005262 Bacteria 3147
14 Ga0065704_10077961 3300005289 Bacteria 4569
15 Ga0065712_10124065 3300005290 Bacteria 1631
16 Ga0070658_10213864 3300005327 Bacteria 1629
17 Ga0070658_10292397 3300005327 Bacteria 1388
18 Ga0070658_10312273 3300005327 Bacteria 1341
19 Ga0070658_10361981 3300005327 Bacteria 1242
20 Ga0070676_10651333 3300005328 Bacteria 765
21 Ga0070683_100010872 3300005329 Bacteria 7837
22 Ga0070683_100981378 3300005329 Bacteria 811
23 Ga0070690_100077058 3300005330 Bacteria 2176
24 Ga0070670_100060696 3300005331 Bacteria 3246
25 Ga0070666_10351683 3300005335 Bacteria 1054
26 Ga0070680_100610361 3300005336 Bacteria 936
27 Ga0068868_100021587 3300005338 Bacteria 4850
28 Ga0068868_100080631 3300005338 Bacteria 2608
29 Ga0068868_100432454 3300005338 Bacteria 1141
30 Ga0070689_100336521 3300005340 Bacteria 1263
31 Ga0070687_100021871 3300005343 Bacteria 3015
32 Ga0070692_10072452 3300005345 Bacteria 1838
33 Ga0070669_100432500 3300005353 Bacteria 1082
34 Ga0070673_100085452 3300005364 Bacteria 2568
35 Ga0070659_100033996 3300005366 Bacteria 3964
36 Ga0070659_100373613 3300005366 Bacteria 1200
37 Ga0070667_100026086 3300005367 Bacteria 4860
38 Ga0070667_100299102 3300005367 Bacteria 1449
39 Ga0070667_101158727 3300005367 Bacteria 723
40 Ga0070701_10045950 3300005438 Bacteria 2242
41 Ga0070700_100173093 3300005441 Bacteria 1496
42 Ga0070663_100068570 3300005455 Bacteria 2575
43 Ga0070663_100311643 3300005455 Bacteria 1263
44 Ga0070678_100023164 3300005456 Bacteria 4133
45 Ga0070681_10130995 3300005458 Bacteria 2440
46 Ga0070681_10363984 3300005458 Bacteria 1356
47 Ga0070698_100427113 3300005471 Bacteria 1260
48 Ga0070679_100000575 3300005530 Bacteria 31162
49 Ga0070679_100353739 3300005530 Bacteria 1416
50 Ga0070679_100354613 3300005530 Bacteria 1414
51 Ga0070679_100500314 3300005530 Unclassified 1159
52 Ga0068853_100052842 3300005539 Bacteria 3499
53 Ga0070696_100784328 3300005546 Unclassified 783
54 Ga0068855_100019632 3300005563 Bacteria 8119
55 Ga0068855_100053363 3300005563 Bacteria 4756
56 Ga0068855_100071309 3300005563 Bacteria 4040
57 Ga0068855_100493117 3300005563 Bacteria 1332
58 Ga0070664_100081841 3300005564 Bacteria 2783
59 Ga0068857_100001119 3300005577 Bacteria 20854
60 Ga0068857_100151523 3300005577 Bacteria 2101
61 Ga0068854_100088778 3300005578 Bacteria 2296
62 Ga0068856_100177558 3300005614 Bacteria 2142
63 Ga0070702_100141095 3300005615 Bacteria 1535
64 Ga0068852_100002006 3300005616 Bacteria 13883
65 Ga0068852_100033393 3300005616 Bacteria 4271
66 Ga0068852_100079002 3300005616 Bacteria 2913
67 Ga0068852_100815515 3300005616 Unclassified 948
68 Ga0068870_10383480 3300005840 Bacteria 910
69 Ga0068858_100128104 3300005842 Bacteria 2379
70 Ga0068860_100005408 3300005843 Bacteria 12959
71 Ga0081455_10573514 3300005937 Bacteria 741
72 Ga0105240_10000074 3300009093 Bacteria 199611
73 Ga0105240_10007062 3300009093 Bacteria 16373
74 Ga0105240_10085848 3300009093 Bacteria 3856
75 Ga0105240_10088622 3300009093 Bacteria 3786
76 Ga0105240_10570811 3300009093 Bacteria 1249
77 Ga0105247_10003751 3300009101 Bacteria 9849
78 Ga0105241_10000659 3300009174 Bacteria 25872
79 Ga0105241_10498843 3300009174 Bacteria 1085
80 Ga0105237_10004143 3300009545 Bacteria 16893
81 Ga0105237_10079863 3300009545 Bacteria 3261
82 Ga0105238_10255766 3300009551 Bacteria 1730
83 Ga0105238_10870412 3300009551 Bacteria 919
84 Ga0105239_10002752 3300010375 Bacteria 22079
85 Ga0105239_10075461 3300010375 Bacteria 3707
86 Ga0105239_11508169 3300010375 Bacteria 777
87 Ga0105246_10807683 3300011119 Bacteria 833
88 Ga0157373_10064152 3300013100 Bacteria 2600
89 Ga0157373_10135385 3300013100 Bacteria 1732
90 Ga0157371_10001082 3300013102 Bacteria 29495
91 Ga0157371_10021342 3300013102 Bacteria 4755
92 Ga0157371_10035941 3300013102 Bacteria 3548
93 Ga0157371_10171695 3300013102 Bacteria 1549
94 Ga0157371_10462238 3300013102 Bacteria 934
95 Ga0157370_10002385 3300013104 Bacteria 22662
96 Ga0157370_10066079 3300013104 Bacteria 3421
97 Ga0157369_10220360 3300013105 Bacteria 1986
98 Ga0157369_10364147 3300013105 Bacteria 1501
99 Ga0157374_11499529 3300013296 Bacteria 698
100 Ga0157378_10106642 3300013297 Bacteria 2563
101 Ga0163162_10701484 3300013306 Unclassified 1134
102 Ga0163162_10822086 3300013306 Unclassified 1045
103 Ga0163162_11978660 3300013306 Bacteria 668
104 Ga0157372_10000921 3300013307 Bacteria 32008
105 Ga0157372_10056972 3300013307 Bacteria 4368
106 Ga0157372_10089982 3300013307 Bacteria 3488
107 Ga0157372_10176871 3300013307 Bacteria 2470
108 Ga0157372_10238497 3300013307 Bacteria 2110
109 Ga0157372_10274278 3300013307 Bacteria 1960
110 Ga0157372_10447919 3300013307 Bacteria 1505
111 Ga0157372_10504853 3300013307 Bacteria 1410
112 Ga0157372_10641996 3300013307 Bacteria 1236
113 Ga0157372_10715974 3300013307 Bacteria 1164
114 Ga0157372_10738026 3300013307 Bacteria 1145
115 Ga0157375_11514862 3300013308 Bacteria 792
116 Ga0157375_11935643 3300013308 Bacteria 700
117 Ga0157380_10358460 3300014326 Bacteria 1367
118 Ga0157377_10007378 3300014745 Bacteria 5305
119 Ga0157376_11848894 3300014969 Bacteria 640
120 Ga0182005_1000263 3300015265 Bacteria 33328
121 Ga0163161_10684808 3300017792 Bacteria 852
122 Ga0163161_10714296 3300017792 Bacteria 836
123 Ga0209436_100493 3300025208 Bacteria 17414
124 Ga0209436_110061 3300025208 Bacteria 1755
125 Ga0209258_100151 3300025242 Bacteria 160444
126 Ga0209646_1000823 3300025246 Bacteria 10466
127 Ga0209148_1000154 3300025254 Bacteria 145214
128 Ga0209130_1003361 3300025284 Bacteria 6880
129 Ga0207426_1000051 3300025302 Bacteria 391700
130 Ga0207426_1006084 3300025302 Bacteria 5323
131 Ga0209257_1000001 3300025304 Bacteria 2274655
132 Ga0207688_10469257 3300025901 Bacteria 786
133 Ga0207680_10310472 3300025903 Bacteria 1101
134 Ga0207647_10018104 3300025904 Bacteria 4774
135 Ga0207645_10547594 3300025907 Bacteria 785
136 Ga0207705_10001328 3300025909 Bacteria 19794
137 Ga0207705_10122042 3300025909 Bacteria 1934
138 Ga0207705_10189925 3300025909 Bacteria 1553
139 Ga0207705_10242843 3300025909 Bacteria 1372
140 Ga0207707_10183589 3300025912 Bacteria 1826
141 Ga0207707_10327833 3300025912 Bacteria 1321
142 Ga0207695_10004602 3300025913 Bacteria 18731
143 Ga0207695_10201654 3300025913 Bacteria 1903
144 Ga0207695_10307382 3300025913 Bacteria 1476
145 Ga0207695_10334283 3300025913 Bacteria 1403
146 Ga0207671_10003904 3300025914 Bacteria 14529
147 Ga0207671_10008744 3300025914 Bacteria 8532
148 Ga0207660_10063225 3300025917 Bacteria 2668
149 Ga0207657_10027751 3300025919 Bacteria 5179
150 Ga0207657_10054235 3300025919 Bacteria 3468
151 Ga0207657_10255994 3300025919 Bacteria 1394
152 Ga0207657_10751463 3300025919 Unclassified 756
153 Ga0207652_10000051 3300025921 Bacteria 120327
154 Ga0207652_10001600 3300025921 Bacteria 19940
155 Ga0207652_10045752 3300025921 Bacteria 3731
156 Ga0207681_10471660 3300025923 Bacteria 1024
157 Ga0207694_10041538 3300025924 Bacteria 3544
158 Ga0207694_10121183 3300025924 Bacteria 2089
159 Ga0207650_10004151 3300025925 Bacteria 9903
160 Ga0207650_10044181 3300025925 Bacteria 3273
161 Ga0207690_10040579 3300025932 Bacteria 3044
162 Ga0207691_10011421 3300025940 Bacteria 8521
163 Ga0207691_10278548 3300025940 Bacteria 1439
164 Ga0207691_10437781 3300025940 Bacteria 1113
165 Ga0207691_10664846 3300025940 Bacteria 880
166 Ga0207661_10907350 3300025944 Bacteria 811
167 Ga0207667_10000222 3300025949 Bacteria 79873
168 Ga0207667_10015290 3300025949 Bacteria 8725
169 Ga0207667_10085943 3300025949 Bacteria 3256
170 Ga0207667_10162018 3300025949 Bacteria 2300
171 Ga0207667_10396610 3300025949 Bacteria 1405
172 Ga0207651_10148905 3300025960 Bacteria 1819
173 Ga0207640_10011602 3300025981 Bacteria 4993
174 Ga0207640_10099462 3300025981 Bacteria 2036
175 Ga0207658_11116686 3300025986 Bacteria 720
176 Ga0207677_10180206 3300026023 Bacteria 1661
177 Ga0207703_10192734 3300026035 Bacteria 1806
178 Ga0207639_10038837 3300026041 Bacteria 3544
179 Ga0207678_10316402 3300026067 Bacteria 1342
180 Ga0207674_10000672 3300026116 Bacteria 44419
181 Ga0207674_10140593 3300026116 Bacteria 2373
182 Ga0207683_10134950 3300026121 Bacteria 2221
183 Ga0207698_10001082 3300026142 Bacteria 15843
184 Ga0207698_10022184 3300026142 Bacteria 4406
185 Ga0207698_10299104 3300026142 Bacteria 1497
186 Ga0207698_10495989 3300026142 Bacteria 1187
187 Ga0268264_10003860 3300028381 Bacteria 12861
188 Ga0268264_10331372 3300028381 Bacteria 1443
189 Ga0307512_10230171 3300030522 Bacteria 954
190 Ga0307513_10272734 3300031456 Bacteria 1474
191 Ga0307509_10175070 3300031507 Bacteria 2019
192 Ga0307516_10246081 3300031730 Bacteria 1485
193 Ga0307416_100225160 3300032002 Bacteria 1803
194 Ga0307411_10656224 3300032005 Bacteria 909
195 Ga0395899_0011416 3300037312 Bacteria 6800
196 Ga0395899_0076882 3300037312 Bacteria 2436
197 Ga0395899_0100820 3300037312 Bacteria 2084
198 Ga0395900_0020025 3300037418 Bacteria 6822
199 Ga0395900_0053699 3300037418 Bacteria 4147
200 Ga0395900_0053727 3300037418 Bacteria 4146
201 Ga0395900_0210378 3300037418 Bacteria 1964
202 Ga0395900_0288574 3300037418 Bacteria 1630
203 Ga0395900_0487421 3300037418 Bacteria 1184
204 Ga0395898_0001447 3300037466 Bacteria 33615
205 Ga0395898_0191015 3300037466 Bacteria 1956
206 Ga0395898_0368321 3300037466 Bacteria 1370
207 Ga0395898_0672481 3300037466 Bacteria 977
208 Ga0395905_0118595 3300037471 Bacteria 2487
209 Ga0395901_0001349 3300038443 Bacteria 25743
210 Ga0395901_0078098 3300038443 Bacteria 3456
211 Ga0395901_0126737 3300038443 Bacteria 2683
212 Ga0395901_0352159 3300038443 Bacteria 1519
213 Ga0395901_1384734 3300038443 Bacteria 662
214 Ga0439436_0014348 3300041404 Bacteria 2393
215 Ga0451807_2242610 3300041486 Bacteria 706
216 Ga0439431_0001706 3300041997 Bacteria 4842
217 Ga0439445_0017984 3300042004 Bacteria 1751
218 Ga0439449_0016210 3300042007 Bacteria 2802
219 Ga0439457_004462 3300042014 Bacteria 3638
220 Ga0439457_011739 3300042014 Bacteria 1985
221 Ga0439462_0010946 3300042015 Bacteria 2305
222 Ga0466969_0314795 3300044656 Bacteria 708
223 Ga0466972_0000207 3300044658 Bacteria 42277
224 Ga0466972_0007800 3300044658 Bacteria 5371
225 Ga0466972_0094761 3300044658 Bacteria 1414
226 Ga0466965_0237987 3300044683 Bacteria 974
227 Ga0466966_0230345 3300044684 Bacteria 1118
228 Ga0466959_0063184 3300045049 Bacteria 2689
229 Ga0495606_0019321 3300046507 Bacteria 5075
230 Ga0495622_0149156 3300046557 Bacteria 1059
231 Ga0495687_144804 3300047443 Bacteria 821
232 Ga0495686_0011430 3300047472 Bacteria 6255
233 Ga0495686_0072181 3300047472 Bacteria 2123
234 Ga0496114_1252154 3300048917 Bacteria 628
235 Ga0496121_0000020 3300048924 Bacteria 498732
236 Ga0496126_0028741 3300048929 Bacteria 5293
237 Ga0501032_0678552 3300049569 Bacteria 654
238 Ga0501033_0106340 3300049570 Bacteria 2044
239 Ga0501033_0441054 3300049570 Bacteria 905
240 Ga0501034_0053271 3300049571 Bacteria 4075
241 Ga0501034_0077642 3300049571 Bacteria 3326
242 Ga0501034_0195101 3300049571 Bacteria 1985
243 Ga0501036_0019980 3300049572 Bacteria 5623
244 Ga0501038_0122962 3300049574 Bacteria 2138
245 Ga0501038_0237751 3300049574 Bacteria 1447
246 Ga0501043_0157429 3300049579 Bacteria 1776
247 Ga0501046_0075579 3300049580 Bacteria 2611
248 Ga0501047_0027231 3300049581 Bacteria 5506
249 Ga0501047_0108655 3300049581 Bacteria 2656
250 Ga0501047_0161519 3300049581 Bacteria 2112
251 Ga0501073_0006166 3300049589 Bacteria 8948
252 Ga0501249_120450 3300049679 Viruses 640
253 Ga0501256_025654 3300049685 Viruses 641
254 Ga0501080_0665333 3300049742 Bacteria 920
255 Ga0501083_0055458 3300049744 Bacteria 2657
256 Ga0501241_000031 3300049758 Bacteria 52001
257 Ga0501035_0326279 3300049822 Bacteria 1289
258 Ga0501044_0058135 3300049823 Bacteria 3967
259 Ga0501044_0864186 3300049823 Bacteria 781
260 Ga0501045_0552480 3300049824 Bacteria 854
261 nmdc:mga0k408_166493_c1 3300050493 Bacteria 1313
262 Ga0500578_0217519 3300053086 Bacteria 1163
263 Ga0500644_0000283 3300053088 Bacteria 28078
264 Ga0500646_0035984 3300053090 Bacteria 1378
265 Ga0500646_0061877 3300053090 Bacteria 1103
266 Ga0500583_0000059 3300053092 Bacteria 68222
267 Ga0500651_0340926 3300053093 Bacteria 852
268 Ga0500562_000050 3300053108 Bacteria 60058
269 Ga0500569_047184 3300053109 Bacteria 1286
270 Ga0500607_018370 3300053121 Bacteria 3972
271 Ga0500607_116814 3300053121 Bacteria 1298
272 Ga0500658_0006060 3300053134 Bacteria 4494
273 Ga0500559_0063746 3300053136 Bacteria 1648
274 Ga0500559_0128800 3300053136 Bacteria 1181
275 Ga0500568_0001626 3300053139 Bacteria 14158
276 Ga0500577_0020859 3300053142 Bacteria 2150
277 Ga0500589_089139 3300053147 Bacteria 1362
278 Ga0500589_175587 3300053147 Bacteria 847
279 Ga0500616_0009033 3300053153 Bacteria 6104
280 Ga0500622_0000777 3300053156 Bacteria 27709
281 Ga0500622_0040916 3300053156 Bacteria 2413
282 Ga0500634_0017283 3300053161 Bacteria 3862
283 Ga0500661_002180 3300055283 Bacteria 3697

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100033393 Ga0068852_1000333932 170
2 3300013306 Ga0163162_10701484 Ga0163162_107014842 170
3 3300044656 Ga0466969_0314795 Ga0466969_0314795_30_542 170
4 3300048917 Ga0496114_1252154 Ga0496114_1252154_92_613 173
5 3300003322 rootL2_10032237 rootL2_100322374 177
6 3300047472 Ga0495686_0011430 Ga0495686_0011430_4293_4922 180
7 3300050493 nmdc:mga0k408_166493_c1 nmdc:mga0k408_166493_c1_250_891 180
8 3300032005 Ga0307411_10656224 Ga0307411_106562242 184
9 3300046507 Ga0495606_0019321 Ga0495606_0019321_3711_4280 184
10 3300009093 Ga0105240_10007062 Ga0105240_1000706210 185
11 3300009174 Ga0105241_10498843 Ga0105241_104988432 185
12 3300009545 Ga0105237_10079863 Ga0105237_100798632 185
13 3300013306 Ga0163162_10822086 Ga0163162_108220862 185
14 3300013308 Ga0157375_11935643 Ga0157375_119356431 185
15 3300014969 Ga0157376_11848894 Ga0157376_118488941 185
16 3300025913 Ga0207695_10334283 Ga0207695_103342832 185
17 3300025914 Ga0207671_10008744 Ga0207671_100087447 185
18 3300053093 Ga0500651_0340926 Ga0500651_0340926_285_842 185
19 iso_pu_bacteria 2818991442 2819573628 185
20 iso_pu_bacteria 2818991460 2819680872 185
21 iso_pu_bacteria 2821136567 2821136962 185
22 iso_pu_bacteria 2883068021 2883072584 185
23 iso_pu_bacteria 2884791551 2884795629 185
24 iso_pu_bacteria 2896109856 2896112543 185
25 iso_pu_bacteria 2904467357 2904468296 185
26 iso_pu_bacteria 2929177148 2929178800 185
27 iso_pu_bacteria 2929239360 2929241243 185
28 iso_pu_bacteria 2945977869 2945981204 185
29 iso_pu_bacteria 2946013367 2946019395 185
30 3300005329 Ga0070683_100981378 Ga0070683_1009813782 186
31 3300005578 Ga0068854_100088778 Ga0068854_1000887782 186
32 3300025919 Ga0207657_10054235 Ga0207657_100542352 186
33 3300025940 Ga0207691_10278548 Ga0207691_102785483 186
34 3300025981 Ga0207640_10099462 Ga0207640_100994622 186
35 3300031730 Ga0307516_10246081 Ga0307516_102460812 186
36 3300049579 Ga0501043_0157429 Ga0501043_0157429_1188_1766 186
37 3300053090 Ga0500646_0061877 Ga0500646_0061877_49_729 186
38 3300053147 Ga0500589_089139 Ga0500589_089139_354_1034 186
39 3300005327 Ga0070658_10213864 Ga0070658_102138642 187
40 3300005367 Ga0070667_100026086 Ga0070667_1000260863 187
41 3300013307 Ga0157372_10238497 Ga0157372_102384972 187
42 3300025246 Ga0209646_1000823 Ga0209646_10008238 187
43 3300005328 Ga0070676_10651333 Ga0070676_106513331 188
44 3300005330 Ga0070690_100077058 Ga0070690_1000770581 188
45 3300005331 Ga0070670_100060696 Ga0070670_1000606962 188
46 3300005338 Ga0068868_100021587 Ga0068868_1000215872 188
47 3300005340 Ga0070689_100336521 Ga0070689_1003365212 188
48 3300005343 Ga0070687_100021871 Ga0070687_1000218713 188
49 3300005353 Ga0070669_100432500 Ga0070669_1004325002 188
50 3300005364 Ga0070673_100085452 Ga0070673_1000854521 188
51 3300005366 Ga0070659_100373613 Ga0070659_1003736131 188
52 3300005438 Ga0070701_10045950 Ga0070701_100459503 188
53 3300005441 Ga0070700_100173093 Ga0070700_1001730932 188
54 3300005455 Ga0070663_100311643 Ga0070663_1003116431 188
55 3300005456 Ga0070678_100023164 Ga0070678_1000231641 188
56 3300005471 Ga0070698_100427113 Ga0070698_1004271131 188
57 3300005564 Ga0070664_100081841 Ga0070664_1000818413 188
58 3300005615 Ga0070702_100141095 Ga0070702_1001410952 188
59 3300005842 Ga0068858_100128104 Ga0068858_1001281042 188
60 3300013296 Ga0157374_11499529 Ga0157374_114995291 188
61 3300013297 Ga0157378_10106642 Ga0157378_101066422 188
62 3300013307 Ga0157372_10715974 Ga0157372_107159742 188
63 3300014745 Ga0157377_10007378 Ga0157377_100073782 188
64 3300017792 Ga0163161_10714296 Ga0163161_107142961 188
65 3300025901 Ga0207688_10469257 Ga0207688_104692571 188
66 3300025907 Ga0207645_10547594 Ga0207645_105475941 188
67 3300025923 Ga0207681_10471660 Ga0207681_104716602 188
68 3300025925 Ga0207650_10044181 Ga0207650_100441813 188
69 3300025940 Ga0207691_10011421 Ga0207691_100114219 188
70 3300025960 Ga0207651_10148905 Ga0207651_101489051 188
71 3300026035 Ga0207703_10192734 Ga0207703_101927341 188
72 3300026121 Ga0207683_10134950 Ga0207683_101349502 188
73 3300026142 Ga0207698_10495989 Ga0207698_104959892 188
74 3300028381 Ga0268264_10331372 Ga0268264_103313722 188
75 3300030522 Ga0307512_10230171 Ga0307512_102301712 188
76 3300031456 Ga0307513_10272734 Ga0307513_102727342 188
77 3300031507 Ga0307509_10175070 Ga0307509_101750703 188
78 3300041404 Ga0439436_0014348 Ga0439436_0014348_223_879 188
79 3300042014 Ga0439457_004462 Ga0439457_004462_2620_3276 188
80 3300042015 Ga0439462_0010946 Ga0439462_0010946_379_1041 188
81 3300044658 Ga0466972_0000207 Ga0466972_0000207_23311_23985 188
82 3300044658 Ga0466972_0007800 Ga0466972_0007800_1696_2373 188
83 3300049581 Ga0501047_0161519 Ga0501047_0161519_359_1015 188
84 3300049824 Ga0501045_0552480 Ga0501045_0552480_169_825 188
85 3300053086 Ga0500578_0217519 Ga0500578_0217519_31_714 188
86 3300053156 Ga0500622_0040916 Ga0500622_0040916_202_915 188
87 3300001979 JGI24740J21852_10005751 JGI24740J21852_100057516 189
88 3300002739 JGI25158J39367_1007919 JGI25158J39367_10079192 189
89 3300002987 JGI25159J45721_1018729 JGI25159J45721_10187291 189
90 3300003316 rootH1_10114248 rootH1_101142482 189
91 3300003322 rootL2_10032239 rootL2_100322393 189
92 3300003323 rootH1_10025440 rootH1_100254402 189
93 3300003323 rootH1_10269340 rootH1_102693401 189
94 3300003761 Ga0055535_1003449 Ga0055535_10034492 189
95 3300003762 Ga0055542_1002114 Ga0055542_10021148 189
96 3300003771 Ga0055526_1013667 Ga0055526_10136674 189
97 3300003794 Ga0055531_10000131 Ga0055531_1000013146 189
98 3300005262 Ga0065165_1013969 Ga0065165_10139692 189
99 3300005289 Ga0065704_10077961 Ga0065704_100779614 189
100 3300005290 Ga0065712_10124065 Ga0065712_101240652 189
101 3300005327 Ga0070658_10292397 Ga0070658_102923972 189
102 3300005327 Ga0070658_10312273 Ga0070658_103122732 189
103 3300005327 Ga0070658_10361981 Ga0070658_103619811 189
104 3300005329 Ga0070683_100010872 Ga0070683_1000108722 189
105 3300005335 Ga0070666_10351683 Ga0070666_103516832 189
106 3300005336 Ga0070680_100610361 Ga0070680_1006103611 189
107 3300005338 Ga0068868_100080631 Ga0068868_1000806312 189
108 3300005338 Ga0068868_100432454 Ga0068868_1004324542 189
109 3300005345 Ga0070692_10072452 Ga0070692_100724522 189
110 3300005366 Ga0070659_100033996 Ga0070659_1000339963 189
111 3300005367 Ga0070667_100299102 Ga0070667_1002991021 189
112 3300005367 Ga0070667_101158727 Ga0070667_1011587271 189
113 3300005455 Ga0070663_100068570 Ga0070663_1000685701 189
114 3300005458 Ga0070681_10130995 Ga0070681_101309952 189
115 3300005458 Ga0070681_10363984 Ga0070681_103639842 189
116 3300005530 Ga0070679_100000575 Ga0070679_1000005759 189
117 3300005530 Ga0070679_100353739 Ga0070679_1003537392 189
118 3300005530 Ga0070679_100354613 Ga0070679_1003546132 189
119 3300005530 Ga0070679_100500314 Ga0070679_1005003142 189
120 3300005539 Ga0068853_100052842 Ga0068853_1000528423 189
121 3300005546 Ga0070696_100784328 Ga0070696_1007843282 189
122 3300005563 Ga0068855_100019632 Ga0068855_1000196324 189
123 3300005563 Ga0068855_100053363 Ga0068855_1000533634 189
124 3300005563 Ga0068855_100071309 Ga0068855_1000713092 189
125 3300005563 Ga0068855_100493117 Ga0068855_1004931171 189
126 3300005577 Ga0068857_100001119 Ga0068857_10000111923 189
127 3300005577 Ga0068857_100151523 Ga0068857_1001515233 189
128 3300005614 Ga0068856_100177558 Ga0068856_1001775582 189
129 3300005616 Ga0068852_100002006 Ga0068852_1000020062 189
130 3300005616 Ga0068852_100079002 Ga0068852_1000790022 189
131 3300005616 Ga0068852_100815515 Ga0068852_1008155151 189
132 3300005840 Ga0068870_10383480 Ga0068870_103834801 189
133 3300005843 Ga0068860_100005408 Ga0068860_1000054089 189
134 3300005937 Ga0081455_10573514 Ga0081455_105735141 189
135 3300009093 Ga0105240_10000074 Ga0105240_10000074131 189
136 3300009093 Ga0105240_10085848 Ga0105240_100858483 189
137 3300009093 Ga0105240_10088622 Ga0105240_100886222 189
138 3300009093 Ga0105240_10570811 Ga0105240_105708112 189
139 3300009101 Ga0105247_10003751 Ga0105247_100037512 189
140 3300009174 Ga0105241_10000659 Ga0105241_1000065919 189
141 3300009545 Ga0105237_10004143 Ga0105237_100041433 189
142 3300009551 Ga0105238_10255766 Ga0105238_102557662 189
143 3300009551 Ga0105238_10870412 Ga0105238_108704122 189
144 3300010375 Ga0105239_10002752 Ga0105239_100027522 189
145 3300010375 Ga0105239_10075461 Ga0105239_100754614 189
146 3300010375 Ga0105239_11508169 Ga0105239_115081691 189
147 3300011119 Ga0105246_10807683 Ga0105246_108076832 189
148 3300013100 Ga0157373_10064152 Ga0157373_100641523 189
149 3300013100 Ga0157373_10135385 Ga0157373_101353852 189
150 3300013102 Ga0157371_10001082 Ga0157371_100010821 189
151 3300013102 Ga0157371_10021342 Ga0157371_100213422 189
152 3300013102 Ga0157371_10035941 Ga0157371_100359413 189
153 3300013102 Ga0157371_10171695 Ga0157371_101716952 189
154 3300013102 Ga0157371_10462238 Ga0157371_104622382 189
155 3300013104 Ga0157370_10002385 Ga0157370_1000238516 189
156 3300013104 Ga0157370_10066079 Ga0157370_100660792 189
157 3300013105 Ga0157369_10220360 Ga0157369_102203602 189
158 3300013105 Ga0157369_10364147 Ga0157369_103641472 189
159 3300013306 Ga0163162_11978660 Ga0163162_119786601 189
160 3300013307 Ga0157372_10000921 Ga0157372_1000092117 189
161 3300013307 Ga0157372_10056972 Ga0157372_100569725 189
162 3300013307 Ga0157372_10089982 Ga0157372_100899824 189
163 3300013307 Ga0157372_10176871 Ga0157372_101768712 189
164 3300013307 Ga0157372_10274278 Ga0157372_102742782 189
165 3300013307 Ga0157372_10447919 Ga0157372_104479191 189
166 3300013307 Ga0157372_10504853 Ga0157372_105048532 189
167 3300013307 Ga0157372_10641996 Ga0157372_106419962 189
168 3300013307 Ga0157372_10738026 Ga0157372_107380262 189
169 3300013308 Ga0157375_11514862 Ga0157375_115148621 189
170 3300014326 Ga0157380_10358460 Ga0157380_103584602 189
171 3300015265 Ga0182005_1000263 Ga0182005_10002633 189
172 3300017792 Ga0163161_10684808 Ga0163161_106848082 189
173 3300025208 Ga0209436_100493 Ga0209436_10049316 189
174 3300025208 Ga0209436_110061 Ga0209436_1100612 189
175 3300025242 Ga0209258_100151 Ga0209258_10015160 189
176 3300025254 Ga0209148_1000154 Ga0209148_100015442 189
177 3300025284 Ga0209130_1003361 Ga0209130_10033618 189
178 3300025302 Ga0207426_1000051 Ga0207426_1000051334 189
179 3300025302 Ga0207426_1006084 Ga0207426_10060844 189
180 3300025304 Ga0209257_1000001 Ga0209257_10000011445 189
181 3300025903 Ga0207680_10310472 Ga0207680_103104722 189
182 3300025904 Ga0207647_10018104 Ga0207647_100181042 189
183 3300025909 Ga0207705_10001328 Ga0207705_1000132817 189
184 3300025909 Ga0207705_10122042 Ga0207705_101220422 189
185 3300025909 Ga0207705_10189925 Ga0207705_101899252 189
186 3300025909 Ga0207705_10242843 Ga0207705_102428432 189
187 3300025912 Ga0207707_10183589 Ga0207707_101835892 189
188 3300025912 Ga0207707_10327833 Ga0207707_103278332 189
189 3300025913 Ga0207695_10004602 Ga0207695_1000460215 189
190 3300025913 Ga0207695_10201654 Ga0207695_102016542 189
191 3300025913 Ga0207695_10307382 Ga0207695_103073822 189
192 3300025914 Ga0207671_10003904 Ga0207671_1000390415 189
193 3300025917 Ga0207660_10063225 Ga0207660_100632251 189
194 3300025919 Ga0207657_10027751 Ga0207657_100277517 189
195 3300025919 Ga0207657_10255994 Ga0207657_102559942 189
196 3300025919 Ga0207657_10751463 Ga0207657_107514631 189
197 3300025921 Ga0207652_10000051 Ga0207652_1000005178 189
198 3300025921 Ga0207652_10001600 Ga0207652_100016002 189
199 3300025921 Ga0207652_10045752 Ga0207652_100457525 189
200 3300025924 Ga0207694_10041538 Ga0207694_100415383 189
201 3300025924 Ga0207694_10121183 Ga0207694_101211832 189
202 3300025925 Ga0207650_10004151 Ga0207650_100041518 189
203 3300025932 Ga0207690_10040579 Ga0207690_100405792 189
204 3300025940 Ga0207691_10437781 Ga0207691_104377812 189
205 3300025940 Ga0207691_10664846 Ga0207691_106648462 189
206 3300025944 Ga0207661_10907350 Ga0207661_109073502 189
207 3300025949 Ga0207667_10000222 Ga0207667_1000022223 189
208 3300025949 Ga0207667_10015290 Ga0207667_100152903 189
209 3300025949 Ga0207667_10085943 Ga0207667_100859432 189
210 3300025949 Ga0207667_10162018 Ga0207667_101620182 189
211 3300025949 Ga0207667_10396610 Ga0207667_103966102 189
212 3300025981 Ga0207640_10011602 Ga0207640_100116023 189
213 3300025986 Ga0207658_11116686 Ga0207658_111166861 189
214 3300026023 Ga0207677_10180206 Ga0207677_101802061 189
215 3300026041 Ga0207639_10038837 Ga0207639_100388372 189
216 3300026067 Ga0207678_10316402 Ga0207678_103164022 189
217 3300026116 Ga0207674_10000672 Ga0207674_1000067216 189
218 3300026116 Ga0207674_10140593 Ga0207674_101405932 189
219 3300026142 Ga0207698_10001082 Ga0207698_1000108211 189
220 3300026142 Ga0207698_10022184 Ga0207698_100221842 189
221 3300026142 Ga0207698_10299104 Ga0207698_102991042 189
222 3300028381 Ga0268264_10003860 Ga0268264_100038609 189
223 3300032002 Ga0307416_100225160 Ga0307416_1002251602 189
224 3300037312 Ga0395899_0011416 Ga0395899_0011416_5201_5782 189
225 3300037312 Ga0395899_0076882 Ga0395899_0076882_191_772 189
226 3300037312 Ga0395899_0100820 Ga0395899_0100820_1028_1609 189
227 3300037418 Ga0395900_0020025 Ga0395900_0020025_1149_1730 189
228 3300037418 Ga0395900_0053699 Ga0395900_0053699_905_1486 189
229 3300037418 Ga0395900_0053727 Ga0395900_0053727_3150_3731 189
230 3300037418 Ga0395900_0210378 Ga0395900_0210378_834_1415 189
231 3300037418 Ga0395900_0288574 Ga0395900_0288574_176_757 189
232 3300037418 Ga0395900_0487421 Ga0395900_0487421_476_1057 189
233 3300037466 Ga0395898_0001447 Ga0395898_0001447_3150_3731 189
234 3300037466 Ga0395898_0191015 Ga0395898_0191015_900_1481 189
235 3300037466 Ga0395898_0368321 Ga0395898_0368321_243_824 189
236 3300037466 Ga0395898_0672481 Ga0395898_0672481_211_792 189
237 3300037471 Ga0395905_0118595 Ga0395905_0118595_127_708 189
238 3300038443 Ga0395901_0001349 Ga0395901_0001349_2155_2736 189
239 3300038443 Ga0395901_0078098 Ga0395901_0078098_1864_2445 189
240 3300038443 Ga0395901_0126737 Ga0395901_0126737_1535_2116 189
241 3300038443 Ga0395901_0352159 Ga0395901_0352159_109_690 189
242 3300038443 Ga0395901_1384734 Ga0395901_1384734_34_615 189
243 3300041486 Ga0451807_2242610 Ga0451807_2242610_19_615 189
244 3300041997 Ga0439431_0001706 Ga0439431_0001706_2335_2904 189
245 3300042004 Ga0439445_0017984 Ga0439445_0017984_471_1040 189
246 3300042007 Ga0439449_0016210 Ga0439449_0016210_1959_2528 189
247 3300042014 Ga0439457_011739 Ga0439457_011739_1263_1856 189
248 3300044658 Ga0466972_0094761 Ga0466972_0094761_518_1087 189
249 3300044683 Ga0466965_0237987 Ga0466965_0237987_52_621 189
250 3300044684 Ga0466966_0230345 Ga0466966_0230345_160_732 189
251 3300045049 Ga0466959_0063184 Ga0466959_0063184_399_968 189
252 3300046557 Ga0495622_0149156 Ga0495622_0149156_149_718 189
253 3300047443 Ga0495687_144804 Ga0495687_144804_106_675 189
254 3300047472 Ga0495686_0072181 Ga0495686_0072181_493_1149 189
255 3300048924 Ga0496121_0000020 Ga0496121_0000020_496485_497054 189
256 3300048929 Ga0496126_0028741 Ga0496126_0028741_852_1421 189
257 3300049569 Ga0501032_0678552 Ga0501032_0678552_46_615 189
258 3300049570 Ga0501033_0106340 Ga0501033_0106340_1023_1604 189
259 3300049570 Ga0501033_0441054 Ga0501033_0441054_200_769 189
260 3300049571 Ga0501034_0053271 Ga0501034_0053271_2511_3092 189
261 3300049571 Ga0501034_0077642 Ga0501034_0077642_1489_2070 189
262 3300049571 Ga0501034_0195101 Ga0501034_0195101_552_1121 189
263 3300049572 Ga0501036_0019980 Ga0501036_0019980_2847_3434 189
264 3300049574 Ga0501038_0122962 Ga0501038_0122962_345_914 189
265 3300049574 Ga0501038_0237751 Ga0501038_0237751_321_908 189
266 3300049580 Ga0501046_0075579 Ga0501046_0075579_1292_1879 189
267 3300049581 Ga0501047_0027231 Ga0501047_0027231_4448_5017 189
268 3300049581 Ga0501047_0108655 Ga0501047_0108655_1118_1705 189
269 3300049589 Ga0501073_0006166 Ga0501073_0006166_340_927 189
270 3300049679 Ga0501249_120450 Ga0501249_120450_23_595 189
271 3300049685 Ga0501256_025654 Ga0501256_025654_25_597 189
272 3300049742 Ga0501080_0665333 Ga0501080_0665333_63_650 189
273 3300049744 Ga0501083_0055458 Ga0501083_0055458_1766_2353 189
274 3300049758 Ga0501241_000031 Ga0501241_000031_19224_19793 189
275 3300049822 Ga0501035_0326279 Ga0501035_0326279_544_1125 189
276 3300049823 Ga0501044_0058135 Ga0501044_0058135_2758_3327 189
277 3300049823 Ga0501044_0864186 Ga0501044_0864186_92_673 189
278 3300053088 Ga0500644_0000283 Ga0500644_0000283_14834_15403 189
279 3300053090 Ga0500646_0035984 Ga0500646_0035984_406_975 189
280 3300053092 Ga0500583_0000059 Ga0500583_0000059_23716_24390 189
281 3300053108 Ga0500562_000050 Ga0500562_000050_36956_37543 189
282 3300053109 Ga0500569_047184 Ga0500569_047184_596_1165 189
283 3300053121 Ga0500607_018370 Ga0500607_018370_2149_2718 189
284 3300053121 Ga0500607_116814 Ga0500607_116814_49_618 189
285 3300053134 Ga0500658_0006060 Ga0500658_0006060_3766_4335 189
286 3300053136 Ga0500559_0063746 Ga0500559_0063746_334_903 189
287 3300053136 Ga0500559_0128800 Ga0500559_0128800_274_996 189
288 3300053139 Ga0500568_0001626 Ga0500568_0001626_9077_9658 189
289 3300053142 Ga0500577_0020859 Ga0500577_0020859_1367_1936 189
290 3300053147 Ga0500589_175587 Ga0500589_175587_181_750 189
291 3300053153 Ga0500616_0009033 Ga0500616_0009033_2959_3528 189
292 3300053156 Ga0500622_0000777 Ga0500622_0000777_12949_13518 189
293 3300053161 Ga0500634_0017283 Ga0500634_0017283_124_693 189
294 3300055283 Ga0500661_002180 Ga0500661_002180_389_976 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

11

207

0.88

PF07722

Peptidase_C26

Peptidase C26

40

190

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.921 1 187
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9072 3 189
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.907 1 187
8gr1-assembly4.cif.gz_D crystal structure of d110v/k151l mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.8945 3 188
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.8935 3 189
ID Description Score Start End Superfamily
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9357 3 188 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9342 3 189 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9271 1 188 3.40.50.880
af_Q2FYR8_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9268 3 188 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9266 1 189 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A519L8G0-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9856 1 105 GO:0000162
GO:0004049
GO:0005829
AF-A0A3D6CJ94-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.981 1 128 GO:0000162
GO:0004049
GO:0005829
AF-A0A1Q3M6T0-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9806 1 155 GO:0000162
GO:0004049
GO:0005829
AF-A0A4Q3SID1-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9774 1 105 GO:0000162
GO:0004049
GO:0005829
AF-A0A2D6V3V0-F1-model_v4 deleted 0.976 2 136

Feature Viewer

pLDDT pTM Quality
93.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map