F392841

General Info

Members Datasets Scaffolds Average Seq Length
295 234 146 429

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0029825|Ga0496102_0029825_209_1549
Length 446
Sequence MEIISNFNGGDHMKDCISIGLLGLGTVGSGVVKIVEDHQDRLAHQIGCSVQVKKVLVKDLEKERSISIQKDLLTTDAYEILNDAEVDVVVEVMGGIEDARQYILHALRNKKHVVTANKDLMALYGTELLRVANENNCDLFYEASVAGGIPIIRSLVDGLASDRVTKLMGIVNGTTNFILTKMSNEGKAYEDVLKEAQELGFAEADPTSDVEGLDAARKMTILAKLGFSMDVELEDVQVRGISSVSSEDIDFAKYFGYTMKLIGYAKRNDNRIEVSVGPTLIAHNHPLASVSNEFNAVYVYGEAVGETMFYGPGAGSLPTATAIVSDLVAVMKNMRLGVNGTSAVLPQYPKELKEDHEIYFKSFFRFTVKDQLGSFAEITSIFTESDISFEKIIQVPLKHKGLAEIILVTHHASHSAYNKVIGSLETSEVVDEVRSYYRIAGEDCDV

Samples

Sample ID Description Type Environment
1 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
2 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
3 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
4 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
5 2554235283 Bacillus safensis VK Isolate Rhizosphere
6 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
7 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
8 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
9 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
10 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
11 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
12 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
13 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
14 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
15 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
16 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
17 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
18 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
19 2643221729 Bacillus sp. Root11 Isolate Unclassified
20 2643221730 Bacillus sp. Root131 Isolate Unclassified
21 2643221731 Bacillus sp. Root147 Isolate Unclassified
22 2643221732 Bacillus sp. Root239 Isolate Unclassified
23 2643221735 Bacillus sp. Root920 Isolate Unclassified
24 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
25 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
26 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
27 2684622632 Bacillus cereus 905 Isolate Unclassified
28 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
29 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
30 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
31 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
32 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
33 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
34 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
35 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
36 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
37 2738541295 Bacillus sp. OK085 Isolate Unclassified
38 2738541358 Bacillus sp. OV752 Isolate Unclassified
39 2738543006 Bacillus sp. OK077 Isolate Unclassified
40 2738543010 Bacillus sp. YR335 Isolate Unclassified
41 2738543017 Bacillus sp. OV186 Isolate Unclassified
42 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
43 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
44 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
45 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
46 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
47 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
48 2811994870 Bacillus sp. JB4 Isolate Unclassified
49 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
50 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
51 2818991441 Niallia circulans 3243 Isolate Rhizosphere
52 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
53 2818991459 Paenibacillus sp. 597 Isolate Unclassified
54 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
55 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
56 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
57 2842682962 Bacillus sp. R-72492 Isolate Unclassified
58 2842882022 Bacillus sp. R-71893 Isolate Unclassified
59 2849139964 Bacillus sp. R-71875 Isolate Unclassified
60 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
61 2857581216 Bacillus sp. R-71922 Isolate Unclassified
62 2857586860 Bacillus sp. R-71935 Isolate Unclassified
63 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
64 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
65 2860837431 Bacillus sp. WR11 Isolate Unclassified
66 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
67 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
68 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
69 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
70 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
71 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
72 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
73 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
74 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
75 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
76 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
77 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
78 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
79 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
80 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
81 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
82 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
83 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
84 2919720352 Priestia megaterium 4340 Isolate Unclassified
85 2919726948 Bacillus pumilus 4489 Isolate Unclassified
86 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
87 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
88 2929004312 Priestia megaterium 1104 Isolate Unclassified
89 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
90 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
91 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
92 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
93 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
94 2938917290 Bacillus sp. CR71 Isolate Unclassified
95 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
96 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
97 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
98 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
99 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
100 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
101 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
102 2965761152 Bacillus sp. COPE52 Isolate Unclassified
103 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
104 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
105 2969141011 Bacillus velezensis MH25 Isolate Unclassified
106 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
107 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
108 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
109 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
110 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
111 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
112 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
113 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
114 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
115 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
116 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
117 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
118 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
119 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
120 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
121 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
122 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
123 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
124 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
125 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
126 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
127 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
128 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
129 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
130 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
131 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
132 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
133 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
134 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
135 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
136 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
137 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
138 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
166 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
217 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
218 8022653035 Bacillus sp. Rc4 Isolate Unclassified
219 8022792930 Bacillus sp. Xin Isolate Rhizosphere
220 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
221 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
222 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
223 8023438354 Bacillus sp. BH2 Isolate Unclassified
224 8023444577 Bacillus sp. BH32 Isolate Unclassified
225 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
226 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
227 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
228 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
229 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
230 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
231 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
232 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
233 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
234 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 44.07
Metatranscriptomes 5.42
Isolates 50.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.68
Bulb 0
Endosphere 11.53
Nodule 0
Rhizoplane 6.1
Rhizosphere 46.44
Stem 0
Stem Tuber 0
Unclassified 35.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006189 3300002987 Bacteria 3622
2 JGI25151J46595_10000037 3300003187 Bacteria 183297
3 JGI25151J46595_10000589 3300003187 Bacteria 32239
4 JGI25151J46595_10001501 3300003187 Bacteria 15656
5 JGI25151J46595_10005790 3300003187 Bacteria 6326
6 JGI25151J46595_10014839 3300003187 Bacteria 3457
7 JGI25151J46595_10023722 3300003187 Bacteria 2521
8 JGI25151J46595_10031722 3300003187 Bacteria 2059
9 rootH1_10001505 3300003316 Bacteria 52069
10 rootL2_10010347 3300003322 Bacteria 37669
11 Ga0006562J51391_1001020 3300003578 Bacteria 5902
12 Ga0006562J51391_1001696 3300003578 Bacteria 10160
13 Ga0006562J51391_1003778 3300003578 Bacteria 2927
14 Ga0055532_1000038 3300003758 Bacteria 198387
15 Ga0055528_1007641 3300003790 Bacteria 4747
16 Ga0055541_1000141 3300003841 Bacteria 37253
17 Ga0070669_100187182 3300005353 Bacteria 1622
18 Ga0105251_10004824 3300009011 Bacteria 9017
19 Ga0105251_10009934 3300009011 Bacteria 5569
20 Ga0105244_10006890 3300009036 Bacteria 7290
21 Ga0105244_10023455 3300009036 Bacteria 3382
22 Ga0105244_10031142 3300009036 Bacteria 2832
23 Ga0105250_10003552 3300009092 Bacteria 7346
24 Ga0105245_10090431 3300009098 Bacteria 2815
25 Ga0105247_10021164 3300009101 Bacteria 3913
26 Ga0105243_10000533 3300009148 Bacteria 38676
27 Ga0105243_10203735 3300009148 Bacteria 1737
28 Ga0105242_10001446 3300009176 Bacteria 18676
29 Ga0105249_10028188 3300009553 Bacteria 5070
30 Ga0105239_10259885 3300010375 Bacteria 1951
31 Ga0105246_10002622 3300011119 Bacteria 10885
32 Ga0105246_10026882 3300011119 Bacteria 3765
33 Ga0157378_10001856 3300013297 Bacteria 18966
34 Ga0209784_100038 3300025224 Bacteria 253212
35 Ga0209566_100077 3300025225 Bacteria 160414
36 Ga0209566_100420 3300025225 Bacteria 32807
37 Ga0209147_100081 3300025229 Bacteria 195314
38 Ga0209147_100382 3300025229 Bacteria 30814
39 Ga0209147_101901 3300025229 Bacteria 6303
40 Ga0209673_1002115 3300025273 Bacteria 14881
41 Ga0209130_1000355 3300025284 Bacteria 52430
42 Ga0209130_1002424 3300025284 Bacteria 9387
43 Ga0209130_1002923 3300025284 Bacteria 7826
44 Ga0209676_1000471 3300025292 Bacteria 67223
45 Ga0209676_1010989 3300025292 Bacteria 3702
46 Ga0209025_1000011 3300025294 Bacteria 976387
47 Ga0209025_1000107 3300025294 Bacteria 222387
48 Ga0209025_1000331 3300025294 Bacteria 104721
49 Ga0209025_1000565 3300025294 Bacteria 67929
50 Ga0209025_1000680 3300025294 Bacteria 58342
51 Ga0209025_1001330 3300025294 Bacteria 33454
52 Ga0209025_1002589 3300025294 Bacteria 18713
53 Ga0209025_1003368 3300025294 Bacteria 15291
54 Ga0209025_1004025 3300025294 Bacteria 13178
55 Ga0209025_1004469 3300025294 Bacteria 12133
56 Ga0209025_1023236 3300025294 Bacteria 3248
57 Ga0207696_1000796 3300025711 Bacteria 20503
58 Ga0207696_1000882 3300025711 Bacteria 18695
59 Ga0207696_1003685 3300025711 Bacteria 6883
60 Ga0207696_1010151 3300025711 Bacteria 3468
61 Ga0207655_1004266 3300025728 Bacteria 10233
62 Ga0207655_1022498 3300025728 Bacteria 3158
63 Ga0207655_1022772 3300025728 Bacteria 3126
64 Ga0207713_1000472 3300025735 Bacteria 41917
65 Ga0207713_1007400 3300025735 Bacteria 6484
66 Ga0207713_1031566 3300025735 Bacteria 2339
67 Ga0207710_10024786 3300025900 Bacteria 2586
68 Ga0207644_10042174 3300025931 Bacteria 3232
69 Ga0207686_10004911 3300025934 Bacteria 7194
70 Ga0207709_10071088 3300025935 Bacteria 2208
71 Ga0209371_1003122 3300027312 Bacteria 8440
72 Ga0237817_10027 3300030083 Bacteria 56757
73 Ga0237817_10046 3300030083 Bacteria 42105
74 Ga0268256_1003986 3300030500 Bacteria 6361
75 Ga0307408_100016577 3300031548 Bacteria 4920
76 Ga0307405_10020408 3300031731 Bacteria 3702
77 Ga0307409_100008562 3300031995 Bacteria 6219
78 Ga0307416_100011242 3300032002 Bacteria 5952
79 Ga0307416_100196807 3300032002 Bacteria 1907
80 Ga0237819_00023 3300038705 Bacteria 52093
81 Ga0237819_00351 3300038705 Bacteria 16505
82 Ga0439439_0000057 3300041406 Bacteria 14221
83 Ga0439433_0000137 3300041999 Bacteria 10929
84 Ga0439433_0017206 3300041999 Bacteria 1604
85 Ga0439449_0001832 3300042007 Bacteria 8364
86 Ga0439449_0007691 3300042007 Bacteria 4092
87 Ga0439462_0012827 3300042015 Bacteria 2144
88 Ga0466969_0000558 3300044656 Bacteria 20450
89 Ga0466959_0041453 3300045049 Bacteria 3398
90 Ga0466967_0000081 3300045976 Bacteria 34669
91 Ga0495603_0021175 3300046455 Bacteria 3936
92 Ga0495622_0077098 3300046557 Bacteria 1536
93 Ga0495622_0082688 3300046557 Bacteria 1477
94 Ga0495661_0050762 3300046665 Bacteria 2509
95 Ga0495660_0044644 3300046810 Bacteria 2437
96 Ga0495683_0004683 3300047323 Bacteria 7706
97 Ga0496100_0001783 3300048903 Bacteria 10741
98 Ga0496102_0007847 3300048905 Bacteria 9118
99 Ga0496102_0029825 3300048905 Bacteria 4881
100 Ga0496104_0004651 3300048907 Bacteria 11943
101 Ga0496105_0000841 3300048908 Bacteria 20902
102 Ga0496106_0001697 3300048909 Bacteria 16467
103 Ga0496107_0000385 3300048910 Bacteria 24002
104 Ga0496108_0003740 3300048911 Bacteria 12203
105 Ga0496109_0003067 3300048912 Bacteria 13926
106 Ga0496109_0057591 3300048912 Bacteria 3548
107 Ga0496110_0021715 3300048913 Bacteria 5439
108 Ga0496111_0003619 3300048914 Bacteria 9581
109 Ga0496111_0186133 3300048914 Bacteria 1544
110 Ga0496112_0019702 3300048915 Bacteria 6375
111 Ga0496112_0048938 3300048915 Bacteria 4142
112 Ga0496113_0043513 3300048916 Bacteria 3324
113 Ga0496116_0007970 3300048919 Bacteria 9279
114 Ga0496116_0012493 3300048919 Bacteria 6935
115 Ga0496116_0052628 3300048919 Bacteria 2696
116 Ga0496117_0015425 3300048920 Bacteria 6516
117 Ga0496117_0039049 3300048920 Bacteria 3509
118 Ga0496119_0000433 3300048922 Bacteria 57394
119 Ga0496119_0001639 3300048922 Bacteria 26359
120 Ga0496120_0000396 3300048923 Bacteria 70231
121 Ga0496120_0046023 3300048923 Bacteria 2524
122 Ga0496122_0005389 3300048925 Bacteria 15269
123 Ga0496122_0005820 3300048925 Bacteria 14489
124 Ga0496122_0034429 3300048925 Bacteria 4145
125 Ga0496123_0025897 3300048926 Bacteria 4408
126 Ga0496123_0026994 3300048926 Bacteria 4287
127 Ga0496124_0000949 3300048927 Bacteria 46304
128 Ga0496124_0002046 3300048927 Bacteria 27402
129 Ga0496125_0001538 3300048928 Bacteria 33061
130 Ga0496125_0003495 3300048928 Bacteria 18980
131 Ga0496126_0002110 3300048929 Bacteria 27839
132 Ga0496126_0005366 3300048929 Bacteria 14651
133 Ga0496126_0029251 3300048929 Bacteria 5235
134 Ga0501309_001924 3300049129 Bacteria 2152
135 Ga0501343_000165 3300049132 Bacteria 3269
136 Ga0501343_002143 3300049132 Bacteria 1394
137 Ga0501311_004827 3300049527 Bacteria 1452
138 Ga0501312_000475 3300049528 Bacteria 3249
139 Ga0501312_001035 3300049528 Bacteria 2586
140 Ga0501315_001349 3300049531 Bacteria 2074
141 Ga0501316_000260 3300049532 Bacteria 3292
142 Ga0501323_001156 3300049539 Bacteria 2252
143 Ga0501332_00111 3300049548 Bacteria 2657
144 Ga0501333_000074 3300049549 Bacteria 3142
145 Ga0501335_002481 3300049551 Bacteria 1501
146 Ga0501340_000107 3300049556 Bacteria 2701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049129 Ga0501309_001924 Ga0501309_001924_936_2126 396
2 3300049539 Ga0501323_001156 Ga0501323_001156_903_2114 402
3 3300003187 JGI25151J46595_10005790 JGI25151J46595_100057903 410
4 3300025292 Ga0209676_1000471 Ga0209676_100047154 410
5 3300025294 Ga0209025_1000680 Ga0209025_100068058 410
6 3300025294 Ga0209025_1003368 Ga0209025_10033684 410
7 3300032002 Ga0307416_100196807 Ga0307416_1001968072 416
8 3300048912 Ga0496109_0057591 Ga0496109_0057591_1888_3186 416
9 3300048913 Ga0496110_0021715 Ga0496110_0021715_2868_4229 416
10 3300048925 Ga0496122_0005389 Ga0496122_0005389_1355_2620 421
11 iso_pu_bacteria 2524023129 2524186835 424
12 iso_pu_bacteria 2554235469 2556063364 424
13 iso_pu_bacteria 2563366752 2563929999 424
14 iso_pu_bacteria 2571042143 2571530360 424
15 iso_pu_bacteria 2571042588 2573036507 424
16 iso_pu_bacteria 2576861424 2578338177 424
17 iso_pu_bacteria 2579778775 2580933456 424
18 iso_pu_bacteria 2585428059 2587740454 424
19 iso_pu_bacteria 2600255286 2601640532 424
20 iso_pu_bacteria 2619619294 2621276593 424
21 iso_pu_bacteria 2643221676 2644426648 424
22 iso_pu_bacteria 2711768088 2712197244 424
23 iso_pu_bacteria 2728368933 2728530430 424
24 iso_pu_bacteria 2791355222 2793182726 424
25 iso_pu_bacteria 2818991459 2819672873 424
26 iso_pu_bacteria 2857453340 2857456603 424
27 iso_pu_bacteria 2881636855 2881640387 424
28 iso_pu_bacteria 2888578766 2888582914 424
29 iso_pu_bacteria 2889049205 2889054886 424
30 iso_pu_bacteria 2904113452 2904117316 424
31 iso_pu_bacteria 2904755435 2904756251 424
32 iso_pu_bacteria 2907202186 2907207377 424
33 iso_pu_bacteria 2919425241 2919428805 424
34 iso_pu_bacteria 2925326138 2925330770 424
35 iso_pu_bacteria 2938649242 2938653677 424
36 iso_pu_bacteria 2968558590 2968562463 424
37 iso_pu_bacteria 2971410472 2971414090 424
38 iso_pu_bacteria 2971511577 2971515802 424
39 iso_pu_bacteria 2980176882 2980178351 424
40 iso_pu_bacteria 2980182181 2980185161 424
41 iso_pu_bacteria 2988225383 2988229975 424
42 iso_pu_bacteria 2996632988 2996637039 424
43 iso_pu_bacteria 8054465665 8054470447 424
44 iso_pu_bacteria 8055632911 8055637579 424
45 iso_pu_bacteria 8056533031 8056539169 424
46 iso_pu_bacteria 8057473075 8057473459 424
47 iso_pu_bacteria 8057473075 8057475909 424
48 iso_pu_bacteria 8057733483 8057737292 424
49 iso_pu_bacteria 8057977335 8057977613 424
50 iso_pu_bacteria 2919414237 2919419554 425
51 iso_pu_bacteria 2929297113 2929299024 425
52 iso_pu_bacteria 2936361878 2936362302 425
53 iso_pu_bacteria 2984527788 2984530712 425
54 iso_pu_bacteria 2984532647 2984536820 425
55 3300044656 Ga0466969_0000558 Ga0466969_0000558_18321_19601 426
56 3300045049 Ga0466959_0041453 Ga0466959_0041453_1701_2981 426
57 iso_pu_bacteria 2540341094 2540608133 427
58 iso_pu_bacteria 2545555800 2545559399 427
59 iso_pu_bacteria 2551306519 2553391293 427
60 iso_pu_bacteria 2554235283 2555468135 427
61 iso_pu_bacteria 2576861599 2578930353 427
62 iso_pu_bacteria 2630968484 2631985204 427
63 iso_pu_bacteria 2643221729 2644702523 427
64 iso_pu_bacteria 2643221730 2644715153 427
65 iso_pu_bacteria 2643221735 2644739043 427
66 iso_pu_bacteria 2648501850 2651530559 427
67 iso_pu_bacteria 2671180330 2672338407 427
68 iso_pu_bacteria 2671180844 2674422126 427
69 iso_pu_bacteria 2684622632 2685153361 427
70 iso_pu_bacteria 2684623153 2686998300 427
71 iso_pu_bacteria 2687453109 2687499577 427
72 iso_pu_bacteria 2695420354 2695628899 427
73 iso_pu_bacteria 2695420987 2698319827 427
74 iso_pu_bacteria 2703719227 2705997274 427
75 iso_pu_bacteria 2716884898 2717915413 427
76 iso_pu_bacteria 2718218445 2721508523 427
77 iso_pu_bacteria 2738541295 2738816881 427
78 iso_pu_bacteria 2738541358 2739156835 427
79 iso_pu_bacteria 2738543006 2739209415 427
80 iso_pu_bacteria 2738543010 2739233156 427
81 iso_pu_bacteria 2738543017 2739268127 427
82 iso_pu_bacteria 2808606364 2808867067 427
83 iso_pu_bacteria 2808606399 2809053263 427
84 iso_pu_bacteria 2811994870 2812317424 427
85 iso_pu_bacteria 2816332186 2816865665 427
86 iso_pu_bacteria 2816332295 2817481527 427
87 iso_pu_bacteria 2818991441 2819570597 427
88 iso_pu_bacteria 2818991443 2819583701 427
89 iso_pu_bacteria 2818991468 2819722484 427
90 iso_pu_bacteria 2823526263 2823529394 427
91 iso_pu_bacteria 2842682962 2842686371 427
92 iso_pu_bacteria 2849139964 2849143244 427
93 iso_pu_bacteria 2857581216 2857583466 427
94 iso_pu_bacteria 2857586860 2857588194 427
95 iso_pu_bacteria 2860837431 2860840924 427
96 iso_pu_bacteria 2877768649 2877771823 427
97 iso_pu_bacteria 2880169592 2880172665 427
98 iso_pu_bacteria 2897109615 2897112933 427
99 iso_pu_bacteria 2904560550 2904563809 427
100 iso_pu_bacteria 2908665501 2908666763 427
101 iso_pu_bacteria 2919093281 2919095219 427
102 iso_pu_bacteria 2919726948 2919727782 427
103 iso_pu_bacteria 2929233124 2929239071 427
104 iso_pu_bacteria 2938917290 2938923296 427
105 iso_pu_bacteria 2947426588 2947432165 427
106 iso_pu_bacteria 2954773129 2954777068 427
107 iso_pu_bacteria 2956897341 2956902302 427
108 iso_pu_bacteria 2962290636 2962294151 427
109 iso_pu_bacteria 2965761152 2965766690 427
110 iso_pu_bacteria 2969136845 2969140132 427
111 iso_pu_bacteria 2969141011 2969144377 427
112 iso_pu_bacteria 2969765954 2969769108 427
113 iso_pu_bacteria 2969770375 2969771422 427
114 iso_pu_bacteria 2971893375 2971896489 427
115 iso_pu_bacteria 2977254563 2977256121 427
116 iso_pu_bacteria 2979083700 2979089051 427
117 iso_pu_bacteria 2980492589 2980495920 427
118 iso_pu_bacteria 2990275345 2990277003 427
119 iso_pu_bacteria 3001892409 3001895393 427
120 iso_pu_bacteria 3006826541 3006829611 427
121 iso_pu_bacteria 3006858327 3006861953 427
122 iso_pu_bacteria 3006978542 3006981179 427
123 iso_pu_bacteria 8022621104 8022626888 427
124 iso_pu_bacteria 8022630665 8022633088 427
125 iso_pu_bacteria 8022653035 8022655799 427
126 iso_pu_bacteria 8022792930 8022793687 427
127 iso_pu_bacteria 8023438354 8023441544 427
128 iso_pu_bacteria 8023444577 8023449065 427
129 iso_pu_bacteria 8051952484 8051954564 427
130 iso_pu_bacteria 8052174270 8052175355 427
131 iso_pu_bacteria 8057582654 8057587819 427
132 iso_pu_bacteria 8057632132 8057636097 427
133 3300003841 Ga0055541_1000141 Ga0055541_100014132 428
134 3300025224 Ga0209784_100038 Ga0209784_100038229 428
135 3300025225 Ga0209566_100077 Ga0209566_100077139 428
136 3300025225 Ga0209566_100420 Ga0209566_10042026 428
137 3300025292 Ga0209676_1010989 Ga0209676_10109893 428
138 3300041406 Ga0439439_0000057 Ga0439439_0000057_1019_2305 428
139 3300041999 Ga0439433_0000137 Ga0439433_0000137_5768_7054 428
140 3300041999 Ga0439433_0017206 Ga0439433_0017206_28_1314 428
141 3300042007 Ga0439449_0001832 Ga0439449_0001832_1579_2865 428
142 3300042007 Ga0439449_0007691 Ga0439449_0007691_1088_2374 428
143 3300042015 Ga0439462_0012827 Ga0439462_0012827_287_1573 428
144 3300046665 Ga0495661_0050762 Ga0495661_0050762_1130_2416 428
145 3300048919 Ga0496116_0012493 Ga0496116_0012493_5171_6457 428
146 3300048919 Ga0496116_0052628 Ga0496116_0052628_1253_2539 428
147 3300048920 Ga0496117_0015425 Ga0496117_0015425_187_1473 428
148 3300048922 Ga0496119_0000433 Ga0496119_0000433_51012_52298 428
149 3300048923 Ga0496120_0000396 Ga0496120_0000396_5097_6383 428
150 3300048925 Ga0496122_0034429 Ga0496122_0034429_496_1782 428
151 3300048926 Ga0496123_0025897 Ga0496123_0025897_2109_3395 428
152 3300048927 Ga0496124_0000949 Ga0496124_0000949_39956_41242 428
153 3300048927 Ga0496124_0002046 Ga0496124_0002046_3922_5208 428
154 3300048928 Ga0496125_0001538 Ga0496125_0001538_12653_13939 428
155 3300048929 Ga0496126_0002110 Ga0496126_0002110_21457_22743 428
156 3300048929 Ga0496126_0029251 Ga0496126_0029251_577_1863 428
157 iso_pu_bacteria 2593339131 2595088354 428
158 iso_pu_bacteria 2643221731 2644720259 428
159 iso_pu_bacteria 2643221732 2644726661 428
160 iso_pu_bacteria 2757320391 2757565536 428
161 iso_pu_bacteria 2775507177 2777762963 428
162 iso_pu_bacteria 2775507192 2777838487 428
163 iso_pu_bacteria 2818991465 2819711246 428
164 iso_pu_bacteria 2842882022 2842886195 428
165 iso_pu_bacteria 2857604169 2857604509 428
166 iso_pu_bacteria 2857609550 2857611124 428
167 iso_pu_bacteria 2881644220 2881647239 428
168 iso_pu_bacteria 2904524088 2904528609 428
169 iso_pu_bacteria 2919143609 2919148240 428
170 iso_pu_bacteria 2919517244 2919521993 428
171 iso_pu_bacteria 2919720352 2919725127 428
172 iso_pu_bacteria 2928093941 2928098421 428
173 iso_pu_bacteria 2929004312 2929007851 428
174 iso_pu_bacteria 2936340661 2936342979 428
175 iso_pu_bacteria 2960319331 2960321173 428
176 iso_pu_bacteria 2960375949 2960378444 428
177 iso_pu_bacteria 2964375228 2964376442 428
178 iso_pu_bacteria 3001267043 3001271396 428
179 iso_pu_bacteria 3001272096 3001272336 428
180 iso_pu_bacteria 3006984091 3006987942 428
181 iso_pu_bacteria 3006988479 3006992491 428
182 iso_pu_bacteria 8022893055 8022894223 428
183 iso_pu_bacteria 8022914991 8022918666 428
184 iso_pu_bacteria 8022948649 8022953233 428
185 3300009036 Ga0105244_10023455 Ga0105244_100234552 430
186 3300038705 Ga0237819_00351 Ga0237819_00351_14907_16199 430
187 3300002987 JGI25159J45721_1006189 JGI25159J45721_10061892 431
188 3300003187 JGI25151J46595_10000037 JGI25151J46595_1000003746 431
189 3300003187 JGI25151J46595_10000589 JGI25151J46595_100005896 431
190 3300003187 JGI25151J46595_10001501 JGI25151J46595_100015017 431
191 3300003187 JGI25151J46595_10014839 JGI25151J46595_100148391 431
192 3300003187 JGI25151J46595_10023722 JGI25151J46595_100237222 431
193 3300003187 JGI25151J46595_10031722 JGI25151J46595_100317222 431
194 3300003316 rootH1_10001505 rootH1_1000150560 431
195 3300003322 rootL2_10010347 rootL2_1001034743 431
196 3300003578 Ga0006562J51391_1001020 Ga0006562J51391_10010203 431
197 3300003578 Ga0006562J51391_1001696 Ga0006562J51391_10016967 431
198 3300003578 Ga0006562J51391_1003778 Ga0006562J51391_10037781 431
199 3300003758 Ga0055532_1000038 Ga0055532_1000038185 431
200 3300003790 Ga0055528_1007641 Ga0055528_10076415 431
201 3300005353 Ga0070669_100187182 Ga0070669_1001871821 431
202 3300009011 Ga0105251_10004824 Ga0105251_100048247 431
203 3300009011 Ga0105251_10009934 Ga0105251_100099341 431
204 3300009036 Ga0105244_10006890 Ga0105244_100068902 431
205 3300009036 Ga0105244_10031142 Ga0105244_100311422 431
206 3300009092 Ga0105250_10003552 Ga0105250_100035527 431
207 3300009098 Ga0105245_10090431 Ga0105245_100904312 431
208 3300009101 Ga0105247_10021164 Ga0105247_100211642 431
209 3300009148 Ga0105243_10000533 Ga0105243_1000053336 431
210 3300009148 Ga0105243_10203735 Ga0105243_102037352 431
211 3300009176 Ga0105242_10001446 Ga0105242_1000144610 431
212 3300009553 Ga0105249_10028188 Ga0105249_100281884 431
213 3300010375 Ga0105239_10259885 Ga0105239_102598852 431
214 3300011119 Ga0105246_10002622 Ga0105246_100026223 431
215 3300011119 Ga0105246_10026882 Ga0105246_100268822 431
216 3300013297 Ga0157378_10001856 Ga0157378_100018569 431
217 3300025229 Ga0209147_100081 Ga0209147_10008111 431
218 3300025229 Ga0209147_100382 Ga0209147_10038232 431
219 3300025229 Ga0209147_101901 Ga0209147_1019012 431
220 3300025273 Ga0209673_1002115 Ga0209673_10021159 431
221 3300025284 Ga0209130_1000355 Ga0209130_100035529 431
222 3300025284 Ga0209130_1002424 Ga0209130_10024249 431
223 3300025284 Ga0209130_1002923 Ga0209130_10029233 431
224 3300025294 Ga0209025_1000011 Ga0209025_1000011842 431
225 3300025294 Ga0209025_1000107 Ga0209025_1000107137 431
226 3300025294 Ga0209025_1000331 Ga0209025_100033167 431
227 3300025294 Ga0209025_1000565 Ga0209025_10005656 431
228 3300025294 Ga0209025_1001330 Ga0209025_100133022 431
229 3300025294 Ga0209025_1002589 Ga0209025_100258915 431
230 3300025294 Ga0209025_1004025 Ga0209025_10040257 431
231 3300025294 Ga0209025_1004469 Ga0209025_10044699 431
232 3300025294 Ga0209025_1023236 Ga0209025_10232363 431
233 3300025711 Ga0207696_1000796 Ga0207696_100079610 431
234 3300025711 Ga0207696_1000882 Ga0207696_10008825 431
235 3300025711 Ga0207696_1003685 Ga0207696_10036851 431
236 3300025711 Ga0207696_1010151 Ga0207696_10101513 431
237 3300025728 Ga0207655_1004266 Ga0207655_100426611 431
238 3300025728 Ga0207655_1022498 Ga0207655_10224982 431
239 3300025728 Ga0207655_1022772 Ga0207655_10227723 431
240 3300025735 Ga0207713_1000472 Ga0207713_100047214 431
241 3300025735 Ga0207713_1007400 Ga0207713_10074006 431
242 3300025735 Ga0207713_1031566 Ga0207713_10315662 431
243 3300025900 Ga0207710_10024786 Ga0207710_100247862 431
244 3300025931 Ga0207644_10042174 Ga0207644_100421743 431
245 3300025934 Ga0207686_10004911 Ga0207686_100049112 431
246 3300025935 Ga0207709_10071088 Ga0207709_100710882 431
247 3300027312 Ga0209371_1003122 Ga0209371_10031226 431
248 3300030083 Ga0237817_10027 Ga0237817_1002746 431
249 3300030083 Ga0237817_10046 Ga0237817_1004633 431
250 3300030500 Ga0268256_1003986 Ga0268256_10039863 431
251 3300031548 Ga0307408_100016577 Ga0307408_1000165773 431
252 3300031731 Ga0307405_10020408 Ga0307405_100204082 431
253 3300031995 Ga0307409_100008562 Ga0307409_1000085624 431
254 3300032002 Ga0307416_100011242 Ga0307416_1000112422 431
255 3300038705 Ga0237819_00023 Ga0237819_00023_37257_38552 431
256 3300045976 Ga0466967_0000081 Ga0466967_0000081_15557_16852 431
257 3300046455 Ga0495603_0021175 Ga0495603_0021175_761_2062 431
258 3300046557 Ga0495622_0077098 Ga0495622_0077098_82_1383 431
259 3300046557 Ga0495622_0082688 Ga0495622_0082688_138_1454 431
260 3300046810 Ga0495660_0044644 Ga0495660_0044644_654_1949 431
261 3300047323 Ga0495683_0004683 Ga0495683_0004683_251_1552 431
262 3300048903 Ga0496100_0001783 Ga0496100_0001783_5151_6452 431
263 3300048905 Ga0496102_0007847 Ga0496102_0007847_7286_8587 431
264 3300048905 Ga0496102_0029825 Ga0496102_0029825_209_1549 431
265 3300048907 Ga0496104_0004651 Ga0496104_0004651_10112_11413 431
266 3300048908 Ga0496105_0000841 Ga0496105_0000841_10071_11372 431
267 3300048909 Ga0496106_0001697 Ga0496106_0001697_10144_11445 431
268 3300048910 Ga0496107_0000385 Ga0496107_0000385_6318_7619 431
269 3300048911 Ga0496108_0003740 Ga0496108_0003740_6324_7625 431
270 3300048912 Ga0496109_0003067 Ga0496109_0003067_4046_5347 431
271 3300048914 Ga0496111_0003619 Ga0496111_0003619_404_1705 431
272 3300048914 Ga0496111_0186133 Ga0496111_0186133_73_1368 431
273 3300048915 Ga0496112_0019702 Ga0496112_0019702_3200_4501 431
274 3300048915 Ga0496112_0048938 Ga0496112_0048938_812_2107 431
275 3300048916 Ga0496113_0043513 Ga0496113_0043513_704_1999 431
276 3300048919 Ga0496116_0007970 Ga0496116_0007970_5516_6817 431
277 3300048920 Ga0496117_0039049 Ga0496117_0039049_518_1819 431
278 3300048922 Ga0496119_0001639 Ga0496119_0001639_10779_12080 431
279 3300048923 Ga0496120_0046023 Ga0496120_0046023_1140_2441 431
280 3300048925 Ga0496122_0005820 Ga0496122_0005820_7177_8478 431
281 3300048926 Ga0496123_0026994 Ga0496123_0026994_2664_3965 431
282 3300048928 Ga0496125_0003495 Ga0496125_0003495_16597_17898 431
283 3300048929 Ga0496126_0005366 Ga0496126_0005366_3803_5104 431
284 3300049132 Ga0501343_000165 Ga0501343_000165_1731_3026 431
285 3300049132 Ga0501343_002143 Ga0501343_002143_73_1371 431
286 3300049527 Ga0501311_004827 Ga0501311_004827_47_1345 431
287 3300049528 Ga0501312_000475 Ga0501312_000475_1894_3189 431
288 3300049528 Ga0501312_001035 Ga0501312_001035_196_1494 431
289 3300049531 Ga0501315_001349 Ga0501315_001349_63_1358 431
290 3300049532 Ga0501316_000260 Ga0501316_000260_63_1358 431
291 3300049548 Ga0501332_00111 Ga0501332_00111_1330_2625 431
292 3300049549 Ga0501333_000074 Ga0501333_000074_1731_3026 431
293 3300049551 Ga0501335_002481 Ga0501335_002481_42_1340 431
294 3300049556 Ga0501340_000107 Ga0501340_000107_53_1348 431
295 iso_pu_bacteria 3006879489 3006882644 431

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00742

Homoserine_dh

Homoserine dehydrogenase

150

328

0.99

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

23

142

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dzs-assembly1.cif.gz_A mycobacterial homoserine dehydrogenase thra in complex with nadp 0.9376 3 428
6wo1-assembly1.cif.gz_B hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit 0.9349 344 419
6dzs-assembly1.cif.gz_A mycobacterial homoserine dehydrogenase thra in complex with nadp 0.9271 3 428
6dzs-assembly2.cif.gz_D mycobacterial homoserine dehydrogenase thra in complex with nadp 0.923 2 428
6dzs-assembly2.cif.gz_D mycobacterial homoserine dehydrogenase thra in complex with nadp 0.9209 2 428
ID Description Score Start End Superfamily
af_Q2FYV4_151_297_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9838 151 296 3.30.360.10
af_Q2FYV4_151_297_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9706 151 296 3.30.360.10
af_P9WPX1_6_138_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9552 2 134 3.40.50.720
af_P9WPX1_139_304_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9492 137 296 3.30.360.10
3do5A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9402 151 297 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A3R8MCS4-F1-model_v4 deleted 0.9848 1 89
AF-C7IRN3-F1-model_v4 deleted 0.9791 2 124
AF-A0A496JWF6-F1-model_v4 deleted 0.9784 198 297
AF-A0A3R8MCS4-F1-model_v4 deleted 0.974 1 89
AF-A0A3D2NV86-F1-model_v4 deleted 0.9711 1 80

Feature Viewer

pLDDT pTM Quality
90.72 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map