F393264

General Info

Members Datasets Scaffolds Average Seq Length
296 217 283 73

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10003293|Ga0307508_1000329315
Length 72
Sequence LKRDIHPEYFETQVSCTCGASFTTRSTVSGNVRADICSECHPFYTGKQKILDTGGRVARFEARFGKNAGSKK

Samples

Sample ID Description Type Environment
1 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
2 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
3 2643221641 Nocardioides sp. Root122 Isolate Unclassified
4 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
5 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
6 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
7 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
8 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
9 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
102 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
103 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
104 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
130 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
131 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
132 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
133 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
203 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
206 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
207 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
208 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
215 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
216 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
217 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.43
Metatranscriptomes 13.18
Isolates 4.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.12
Nodule 0
Rhizoplane 6.42
Rhizosphere 78.38
Stem 0
Stem Tuber 0
Unclassified 6.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1045712 3300001977 Bacteria 612
2 JGI24737J22298_10153983 3300001990 Bacteria 678
3 JGI24751J29686_10121736 3300002459 Bacteria 549
4 Ga0006778J45830_1009446 3300003162 Bacteria 569
5 Ga0006759J45824_1005786 3300003163 Bacteria 600
6 JGI25406J46586_10008427 3300003203 Bacteria 4671
7 Ga0006777J48905_1019103 3300003308 Bacteria 690
8 JGI25160J50197_1029009 3300003354 Bacteria 1473
9 Ga0007429J51699_1008747 3300003579 Bacteria 1444
10 Ga0032354_1012264 3300003693 Bacteria 1057
11 Ga0058860_12178325 3300004801 Bacteria 539
12 Ga0070683_100440205 3300005329 Bacteria 1244
13 Ga0070683_100757020 3300005329 Bacteria 931
14 Ga0070682_100053449 3300005337 Bacteria 2531
15 Ga0068868_100460567 3300005338 Bacteria 1107
16 Ga0070689_100759052 3300005340 Bacteria 851
17 Ga0070687_100341967 3300005343 Bacteria 963
18 Ga0070668_100698013 3300005347 Bacteria 895
19 Ga0070659_100967616 3300005366 Bacteria 746
20 Ga0070714_101107274 3300005435 Bacteria 772
21 Ga0070663_101124113 3300005455 Bacteria 688
22 Ga0070685_11173272 3300005466 Bacteria 583
23 Ga0070706_100802086 3300005467 Bacteria 871
24 Ga0070707_100135645 3300005468 Bacteria 2394
25 Ga0070698_100298782 3300005471 Bacteria 1541
26 Ga0070684_100025778 3300005535 Bacteria 4945
27 Ga0070684_100070697 3300005535 Bacteria 3072
28 Ga0070665_101494131 3300005548 Bacteria 684
29 Ga0070664_100709089 3300005564 Bacteria 938
30 Ga0070664_100988616 3300005564 Bacteria 791
31 Ga0070664_101093560 3300005564 Bacteria 751
32 Ga0068857_100193268 3300005577 Bacteria 1854
33 Ga0068856_101526287 3300005614 Bacteria 682
34 Ga0070702_100585667 3300005615 Bacteria 834
35 Ga0068859_100613651 3300005617 Bacteria 1180
36 Ga0068861_101928148 3300005719 Bacteria 588
37 Ga0081539_10034690 3300005985 Bacteria 3045
38 Ga0075365_10928561 3300006038 Bacteria 613
39 Ga0075368_10082599 3300006042 Bacteria 1309
40 Ga0075363_100138768 3300006048 Bacteria 1367
41 Ga0075364_10316599 3300006051 Bacteria 1062
42 Ga0075364_10405374 3300006051 Bacteria 930
43 Ga0075362_10121013 3300006177 Bacteria 1239
44 Ga0075370_10015863 3300006353 Bacteria 4043
45 Ga0075370_10355419 3300006353 Bacteria 875
46 Ga0075428_100293160 3300006844 Bacteria 1750
47 Ga0075428_100345079 3300006844 Bacteria 1598
48 Ga0075434_100759013 3300006871 Bacteria 987
49 Ga0075429_100239730 3300006880 Bacteria 1588
50 Ga0097620_100613662 3300006931 Bacteria 1180
51 Ga0105245_10576949 3300009098 Bacteria 1149
52 Ga0114129_10156011 3300009147 Bacteria 3121
53 Ga0105243_10280569 3300009148 Bacteria 1500
54 Ga0105237_12546148 3300009545 Bacteria 522
55 Ga0105238_10770232 3300009551 Bacteria 977
56 Ga0105249_10391470 3300009553 Bacteria 1418
57 Ga0105239_11003159 3300010375 Bacteria 960
58 Ga0105246_10204619 3300011119 Bacteria 1537
59 Ga0157314_1033339 3300012500 Bacteria 590
60 Ga0157371_10548305 3300013102 Bacteria 857
61 Ga0157370_11272299 3300013104 Bacteria 663
62 Ga0157369_10669545 3300013105 Bacteria 1069
63 Ga0157375_11212826 3300013308 Bacteria 885
64 Ga0157375_12799994 3300013308 Bacteria 583
65 Ga0182008_10101197 3300014497 Bacteria 1424
66 Ga0157377_10107516 3300014745 Bacteria 1672
67 Ga0157379_11436631 3300014968 Bacteria 669
68 Ga0163161_10819201 3300017792 Bacteria 783
69 Ga0197907_10002146 3300020069 Bacteria 505
70 Ga0197907_11343455 3300020069 Bacteria 1418
71 Ga0197907_11383976 3300020069 Bacteria 1075
72 Ga0206356_10558516 3300020070 Bacteria 908
73 Ga0206356_10968120 3300020070 Bacteria 1389
74 Ga0206356_11296375 3300020070 Bacteria 1313
75 Ga0206349_1613634 3300020075 Bacteria 1093
76 Ga0206349_1807525 3300020075 Bacteria 1268
77 Ga0206355_1130621 3300020076 Bacteria 1822
78 Ga0206355_1502955 3300020076 Bacteria 673
79 Ga0206351_10556868 3300020077 Bacteria 1027
80 Ga0206350_10108509 3300020080 Bacteria 1231
81 Ga0206350_11321186 3300020080 Bacteria 952
82 Ga0206354_10432764 3300020081 Bacteria 3688
83 Ga0206354_10756231 3300020081 Bacteria 1267
84 Ga0206354_11460497 3300020081 Bacteria 800
85 Ga0206353_10140062 3300020082 Bacteria 596
86 Ga0206353_10543014 3300020082 Bacteria 1184
87 Ga0206353_10827258 3300020082 Bacteria 1283
88 Ga0206353_11359602 3300020082 Bacteria 3220
89 Ga0206353_11620169 3300020082 Bacteria 518
90 Ga0154015_1456046 3300020610 Bacteria 1153
91 Ga0224712_10000851 3300022467 Bacteria 6517
92 Ga0224712_10248146 3300022467 Bacteria 822
93 Ga0224712_10266616 3300022467 Bacteria 794
94 Ga0224712_10306001 3300022467 Bacteria 744
95 Ga0207426_1004031 3300025302 Bacteria 7441
96 Ga0207710_10624084 3300025900 Bacteria 564
97 Ga0207699_10544565 3300025906 Bacteria 841
98 Ga0207684_10906540 3300025910 Bacteria 741
99 Ga0207693_10767619 3300025915 Bacteria 744
100 Ga0207663_11093621 3300025916 Bacteria 641
101 Ga0207662_10447861 3300025918 Bacteria 882
102 Ga0207687_10462438 3300025927 Bacteria 1054
103 Ga0207700_10401007 3300025928 Bacteria 1202
104 Ga0207664_10745054 3300025929 Bacteria 881
105 Ga0207669_10211279 3300025937 Bacteria 1417
106 Ga0207661_10112472 3300025944 Bacteria 2305
107 Ga0207661_10330080 3300025944 Bacteria 1373
108 Ga0207661_10843701 3300025944 Bacteria 843
109 Ga0207661_11183470 3300025944 Bacteria 703
110 Ga0207679_10600139 3300025945 Bacteria 992
111 Ga0207679_11738906 3300025945 Bacteria 570
112 Ga0207712_10421330 3300025961 Bacteria 1126
113 Ga0207668_11859767 3300025972 Bacteria 543
114 Ga0207640_11362301 3300025981 Bacteria 635
115 Ga0207678_10407490 3300026067 Bacteria 1178
116 Ga0207702_10223651 3300026078 Bacteria 1755
117 Ga0207702_11170154 3300026078 Bacteria 763
118 Ga0207674_10382337 3300026116 Bacteria 1361
119 Ga0209983_1154156 3300027665 Bacteria 527
120 Ga0209974_10031163 3300027876 Bacteria 1765
121 Ga0316179_1037089 3300030734 Bacteria 2196
122 Ga0316183_1090040 3300030742 Bacteria 1113
123 Ga0316181_1176788 3300030744 Bacteria 989
124 Ga0316181_1292971 3300030744 Bacteria 744
125 Ga0316182_1114849 3300030745 Bacteria 793
126 Ga0307508_10003293 3300031616 Bacteria 16460
127 Ga0307405_10533454 3300031731 Bacteria 947
128 Ga0307405_12102903 3300031731 Bacteria 507
129 Ga0307413_11185945 3300031824 Bacteria 663
130 Ga0307410_10130782 3300031852 Bacteria 1844
131 Ga0307410_10549108 3300031852 Bacteria 957
132 Ga0307410_11987153 3300031852 Bacteria 519
133 Ga0326468_10038166 3300031889 Bacteria 673
134 Ga0307406_10302990 3300031901 Bacteria 1229
135 Ga0307407_10947598 3300031903 Bacteria 663
136 Ga0307409_100182589 3300031995 Bacteria 1859
137 Ga0307409_100275382 3300031995 Bacteria 1552
138 Ga0307416_101639802 3300032002 Bacteria 748
139 Ga0307416_103015600 3300032002 Bacteria 563
140 Ga0307411_12002443 3300032005 Bacteria 541
141 Ga0307411_12016758 3300032005 Bacteria 539
142 Ga0307415_100647380 3300032126 Bacteria 947
143 Ga0307415_100662251 3300032126 Bacteria 937
144 Ga0307415_101580444 3300032126 Bacteria 629
145 Ga0316593_10268462 3300032168 Bacteria 641
146 Ga0307507_10000001 3300033179 Bacteria 417520
147 Ga0373949_0176505 3300035090 Bacteria 631
148 Ga0373942_0031938 3300035207 Bacteria 1396
149 Ga0373961_0344002 3300035241 Bacteria 561
150 Ga0373931_0869508 3300035691 Bacteria 604
151 Ga0373937_1676395 3300036401 Bacteria 583
152 Ga0373925_0475475 3300037068 Bacteria 1025
153 Ga0395899_0534415 3300037312 Bacteria 756
154 Ga0395900_0010768 3300037418 Bacteria 9355
155 Ga0395900_0462579 3300037418 Bacteria 1223
156 Ga0395898_0041654 3300037466 Bacteria 4535
157 Ga0395898_0282559 3300037466 Bacteria 1583
158 Ga0436364_0789007 3300037853 Bacteria 1015
159 Ga0395901_0143970 3300038443 Bacteria 2505
160 Ga0395901_0337650 3300038443 Bacteria 1557
161 Ga0395901_1196009 3300038443 Bacteria 726
162 Ga0400488_23132 3300038741 Bacteria 14813
163 Ga0242420_019163 3300038996 Bacteria 1210
164 Ga0451797_0578273 3300041453 Bacteria 543
165 Ga0451800_0044868 3300041459 Bacteria 587
166 Ga0439458_0125511 3300042157 Bacteria 678
167 Ga0466972_0032299 3300044658 Bacteria 2571
168 Ga0466965_0010700 3300044683 Bacteria 4287
169 Ga0466965_0013886 3300044683 Bacteria 3806
170 Ga0466961_0291802 3300044693 Bacteria 997
171 Ga0466961_0843174 3300044693 Bacteria 546
172 Ga0466964_0881760 3300044706 Bacteria 511
173 Ga0466971_0060988 3300044719 Bacteria 1705
174 Ga0466971_0213625 3300044719 Bacteria 913
175 Ga0466968_0074536 3300044735 Bacteria 1482
176 Ga0466970_0019503 3300044765 Bacteria 3516
177 Ga0466970_0024596 3300044765 Bacteria 3150
178 Ga0466970_0844213 3300044765 Bacteria 537
179 Ga0466957_0001681 3300044842 Bacteria 11626
180 Ga0466957_0053651 3300044842 Bacteria 2458
181 Ga0466957_0142579 3300044842 Bacteria 1544
182 Ga0466960_0278462 3300044901 Bacteria 937
183 Ga0466960_0615916 3300044901 Bacteria 645
184 Ga0466959_0059006 3300045049 Bacteria 2795
185 Ga0466958_0024794 3300045836 Bacteria 3530
186 Ga0466967_0005579 3300045976 Bacteria 8745
187 Ga0466967_0239544 3300045976 Bacteria 1730
188 Ga0466967_1185349 3300045976 Bacteria 761
189 Ga0466967_2098548 3300045976 Bacteria 561
190 Ga0495630_0880907 3300046517 Bacteria 682
191 Ga0495676_0392003 3300047321 Bacteria 923
192 Ga0495602_0985592 3300048088 Bacteria 557
193 Ga0496100_0083745 3300048903 Bacteria 2160
194 Ga0496100_0835359 3300048903 Bacteria 722
195 Ga0496101_0084697 3300048904 Bacteria 2348
196 Ga0496102_0138922 3300048905 Bacteria 2277
197 Ga0496103_0113589 3300048906 Bacteria 1721
198 Ga0496105_0486448 3300048908 Bacteria 970
199 Ga0496106_0018995 3300048909 Bacteria 5094
200 Ga0496107_0090810 3300048910 Bacteria 2231
201 Ga0496107_0381001 3300048910 Bacteria 1049
202 Ga0496108_0343404 3300048911 Bacteria 1302
203 Ga0496109_0232484 3300048912 Bacteria 1734
204 Ga0496110_0061112 3300048913 Bacteria 3324
205 Ga0496111_0083126 3300048914 Bacteria 2339
206 Ga0496112_0322877 3300048915 Bacteria 1488
207 Ga0496113_1261922 3300048916 Bacteria 575
208 Ga0496114_0210975 3300048917 Bacteria 1703
209 Ga0496115_0717017 3300048918 Bacteria 785
210 Ga0496118_0028903 3300048921 Bacteria 4660
211 Ga0496119_0142917 3300048922 Bacteria 1290
212 Ga0496122_0000649 3300048925 Bacteria 70427
213 Ga0496123_0001992 3300048926 Bacteria 26411
214 Ga0496124_0000985 3300048927 Bacteria 45202
215 Ga0496125_0001181 3300048928 Bacteria 39507
216 Ga0501310_000002 3300049130 Bacteria 24441
217 Ga0501317_011236 3300049533 Bacteria 1085
218 Ga0501324_041104 3300049540 Bacteria 528
219 Ga0501031_0097498 3300049568 Bacteria 1919
220 Ga0501032_0155152 3300049569 Bacteria 1504
221 Ga0501032_0376623 3300049569 Bacteria 913
222 Ga0501033_0009940 3300049570 Bacteria 7304
223 Ga0501034_0116064 3300049571 Bacteria 2665
224 Ga0501034_0348638 3300049571 Bacteria 1409
225 Ga0501034_0895170 3300049571 Bacteria 776
226 Ga0501036_0031492 3300049572 Bacteria 4482
227 Ga0501036_0825614 3300049572 Bacteria 763
228 Ga0501040_0730231 3300049576 Bacteria 716
229 Ga0501043_0245382 3300049579 Bacteria 1380
230 Ga0501043_0469765 3300049579 Bacteria 943
231 Ga0501043_1241836 3300049579 Bacteria 522
232 Ga0501046_0003930 3300049580 Bacteria 13592
233 Ga0501046_0203639 3300049580 Bacteria 1472
234 Ga0501046_0913018 3300049580 Bacteria 612
235 Ga0501047_0000031 3300049581 Bacteria 215903
236 Ga0501067_0272298 3300049583 Bacteria 943
237 Ga0501067_0353165 3300049583 Bacteria 820
238 Ga0501067_0580071 3300049583 Bacteria 628
239 Ga0501068_0836758 3300049584 Bacteria 604
240 Ga0501069_0235185 3300049585 Bacteria 1067
241 Ga0501069_0883353 3300049585 Bacteria 543
242 Ga0501070_0168961 3300049586 Bacteria 1802
243 Ga0501074_0451983 3300049590 Bacteria 911
244 Ga0501075_0123483 3300049591 Bacteria 1971
245 Ga0501076_0607851 3300049592 Bacteria 902
246 Ga0501081_0570686 3300049743 Bacteria 846
247 Ga0501081_0739733 3300049743 Bacteria 739
248 Ga0501081_0815450 3300049743 Bacteria 703
249 Ga0501035_0053743 3300049822 Bacteria 3601
250 Ga0501035_0119434 3300049822 Bacteria 2305
251 Ga0501035_0312002 3300049822 Bacteria 1323
252 Ga0501035_0861633 3300049822 Bacteria 720
253 Ga0501044_0010470 3300049823 Bacteria 10063
254 Ga0501044_0311053 3300049823 Bacteria 1502
255 nmdc:mga03683_163867_c1 3300050489 Bacteria 1008
256 nmdc:mga00v17_218085_c2 3300050491 Bacteria 892
257 nmdc:mga00v17_400625_c1 3300050491 Bacteria 892
258 nmdc:mga00v17_509464_c1 3300050491 Bacteria 780
259 nmdc:mga00v17_539505_c1 3300050491 Bacteria 755
260 nmdc:mga0yw44_224798_c1 3300050492 Bacteria 1245
261 nmdc:mga0yw44_838240_c1 3300050492 Bacteria 624
262 nmdc:mga06z11_674291_c1 3300050494 Bacteria 630
263 nmdc:mga07m45_30877_c1 3300050496 Bacteria 2969
264 nmdc:mga06r32_459480_c1 3300050510 Bacteria 1252
265 nmdc:mga08y16_1398314_c1 3300050511 Bacteria 663
266 nmdc:mga08y16_1548051_c1 3300050511 Bacteria 622
267 nmdc:mga0n895_1075702_c1 3300050512 Bacteria 782
268 Ga0495595_0423432 3300053084 Bacteria 676
269 Ga0500566_0203357 3300053094 Bacteria 998
270 Ga0500556_0000284 3300053104 Bacteria 39641
271 Ga0500593_002613 3300053117 Bacteria 6648
272 Ga0500568_0006111 3300053139 Bacteria 6103
273 Ga0500568_0116505 3300053139 Bacteria 997
274 Ga0500620_142710 3300053155 Bacteria 836
275 Ga0500624_051229 3300053157 Bacteria 768
276 Ga0500637_0114841 3300053178 Bacteria 1562
277 Ga0587088_068184 3300059508 Bacteria 736
278 Ga0587090_173726 3300059510 Bacteria 501
279 Ga0587079_102929 3300059647 Bacteria 684
280 Ga0501082_1701464 3300060353 Bacteria 550
281 Ga0466962_0060447 3300061719 Bacteria 1809
282 Ga0466962_0409514 3300061719 Bacteria 679
283 Ga0530510_0093551 3300061734 Bacteria 2195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221641 2644230721 68
2 iso_pu_bacteria 2855386786 2855390674 68
3 3300005329 Ga0070683_100757020 Ga0070683_1007570202 69
4 3300005343 Ga0070687_100341967 Ga0070687_1003419671 69
5 3300005347 Ga0070668_100698013 Ga0070668_1006980131 69
6 3300013308 Ga0157375_11212826 Ga0157375_112128261 69
7 3300025918 Ga0207662_10447861 Ga0207662_104478611 69
8 3300025944 Ga0207661_11183470 Ga0207661_111834702 69
9 3300027876 Ga0209974_10031163 Ga0209974_100311632 69
10 3300037418 Ga0395900_0462579 Ga0395900_0462579_351_560 69
11 3300044765 Ga0466970_0024596 Ga0466970_0024596_2567_2776 69
12 3300045976 Ga0466967_1185349 Ga0466967_1185349_484_693 69
13 3300048921 Ga0496118_0028903 Ga0496118_0028903_1608_1826 69
14 3300048922 Ga0496119_0142917 Ga0496119_0142917_747_965 69
15 3300049130 Ga0501310_000002 Ga0501310_000002_15326_15535 69
16 3300049570 Ga0501033_0009940 Ga0501033_0009940_5020_5229 69
17 3300049571 Ga0501034_0895170 Ga0501034_0895170_417_626 69
18 3300049584 Ga0501068_0836758 Ga0501068_0836758_29_238 69
19 3300049586 Ga0501070_0168961 Ga0501070_0168961_741_950 69
20 3300049822 Ga0501035_0053743 Ga0501035_0053743_1460_1669 69
21 3300050491 nmdc:mga00v17_400625_c1 nmdc:mga00v17_400625_c1_556_774 69
22 3300053094 Ga0500566_0203357 Ga0500566_0203357_424_633 69
23 3300053155 Ga0500620_142710 Ga0500620_142710_33_242 69
24 3300053157 Ga0500624_051229 Ga0500624_051229_542_751 69
25 iso_pu_bacteria 2643221567 2643850935 69
26 iso_pu_bacteria 2643221624 2644134675 69
27 iso_pu_bacteria 2767802112 2768643045 69
28 iso_pu_bacteria 2811994917 2812478779 69
29 iso_pu_bacteria 2862507626 2862512703 69
30 iso_pu_bacteria 2912715099 2912717640 69
31 iso_pu_bacteria 2912757875 2912762723 69
32 iso_pu_bacteria 8008574985 8008577193 69
33 iso_pu_bacteria 8025478263 8025480765 69
34 iso_pu_bacteria 8025530807 8025531342 69
35 iso_pu_bacteria 8056829672 8056832174 69
36 3300005467 Ga0070706_100802086 Ga0070706_1008020861 70
37 3300005468 Ga0070707_100135645 Ga0070707_1001356451 70
38 3300005471 Ga0070698_100298782 Ga0070698_1002987822 70
39 3300009148 Ga0105243_10280569 Ga0105243_102805692 70
40 3300020069 Ga0197907_10002146 Ga0197907_100021461 70
41 3300020082 Ga0206353_10140062 Ga0206353_101400621 70
42 3300020082 Ga0206353_11620169 Ga0206353_116201691 70
43 3300025910 Ga0207684_10906540 Ga0207684_109065402 70
44 3300025944 Ga0207661_10330080 Ga0207661_103300802 70
45 3300027665 Ga0209983_1154156 Ga0209983_11541561 70
46 3300036401 Ga0373937_1676395 Ga0373937_1676395_46_258 70
47 3300037068 Ga0373925_0475475 Ga0373925_0475475_730_942 70
48 3300044683 Ga0466965_0010700 Ga0466965_0010700_1022_1234 70
49 3300044683 Ga0466965_0013886 Ga0466965_0013886_289_504 70
50 3300044706 Ga0466964_0881760 Ga0466964_0881760_205_417 70
51 3300044719 Ga0466971_0060988 Ga0466971_0060988_1185_1397 70
52 3300044719 Ga0466971_0213625 Ga0466971_0213625_246_458 70
53 3300044735 Ga0466968_0074536 Ga0466968_0074536_942_1154 70
54 3300044765 Ga0466970_0019503 Ga0466970_0019503_2303_2515 70
55 3300044842 Ga0466957_0001681 Ga0466957_0001681_7308_7520 70
56 3300044842 Ga0466957_0142579 Ga0466957_0142579_1144_1356 70
57 3300044901 Ga0466960_0278462 Ga0466960_0278462_311_523 70
58 3300044901 Ga0466960_0615916 Ga0466960_0615916_409_621 70
59 3300045836 Ga0466958_0024794 Ga0466958_0024794_208_420 70
60 3300045976 Ga0466967_0239544 Ga0466967_0239544_257_469 70
61 3300045976 Ga0466967_2098548 Ga0466967_2098548_305_517 70
62 3300046517 Ga0495630_0880907 Ga0495630_0880907_44_256 70
63 3300048088 Ga0495602_0985592 Ga0495602_0985592_286_498 70
64 3300048903 Ga0496100_0835359 Ga0496100_0835359_426_638 70
65 3300048910 Ga0496107_0381001 Ga0496107_0381001_596_808 70
66 3300048918 Ga0496115_0717017 Ga0496115_0717017_315_527 70
67 3300049580 Ga0501046_0913018 Ga0501046_0913018_372_584 70
68 3300049581 Ga0501047_0000031 Ga0501047_0000031_127063_127275 70
69 3300049592 Ga0501076_0607851 Ga0501076_0607851_657_872 70
70 3300049743 Ga0501081_0739733 Ga0501081_0739733_502_717 70
71 3300053084 Ga0495595_0423432 Ga0495595_0423432_397_609 70
72 3300061719 Ga0466962_0060447 Ga0466962_0060447_1125_1337 70
73 3300061719 Ga0466962_0409514 Ga0466962_0409514_79_291 70
74 3300005535 Ga0070684_100070697 Ga0070684_1000706972 71
75 3300005564 Ga0070664_101093560 Ga0070664_1010935602 71
76 3300005577 Ga0068857_100193268 Ga0068857_1001932682 71
77 3300025944 Ga0207661_10112472 Ga0207661_101124722 71
78 3300025945 Ga0207679_11738906 Ga0207679_117389062 71
79 3300026116 Ga0207674_10382337 Ga0207674_103823372 71
80 3300031824 Ga0307413_11185945 Ga0307413_111859452 71
81 3300031852 Ga0307410_11987153 Ga0307410_119871531 71
82 3300031995 Ga0307409_100182589 Ga0307409_1001825892 71
83 3300032168 Ga0316593_10268462 Ga0316593_102684622 71
84 3300037466 Ga0395898_0282559 Ga0395898_0282559_1296_1511 71
85 3300038443 Ga0395901_0337650 Ga0395901_0337650_293_508 71
86 3300038443 Ga0395901_1196009 Ga0395901_1196009_366_581 71
87 3300048925 Ga0496122_0000649 Ga0496122_0000649_47063_47278 71
88 3300048926 Ga0496123_0001992 Ga0496123_0001992_23180_23395 71
89 3300048927 Ga0496124_0000985 Ga0496124_0000985_12600_12815 71
90 3300048928 Ga0496125_0001181 Ga0496125_0001181_10829_11044 71
91 3300049569 Ga0501032_0376623 Ga0501032_0376623_226_441 71
92 3300049580 Ga0501046_0003930 Ga0501046_0003930_5998_6213 71
93 3300049583 Ga0501067_0353165 Ga0501067_0353165_491_706 71
94 3300049743 Ga0501081_0570686 Ga0501081_0570686_401_616 71
95 3300050511 nmdc:mga08y16_1548051_c1 nmdc:mga08y16_1548051_c1_370_588 71
96 3300059508 Ga0587088_068184 Ga0587088_068184_277_492 71
97 3300059647 Ga0587079_102929 Ga0587079_102929_68_325 71
98 3300003203 JGI25406J46586_10008427 JGI25406J46586_100084272 72
99 3300005435 Ga0070714_101107274 Ga0070714_1011072741 72
100 3300005985 Ga0081539_10034690 Ga0081539_100346903 72
101 3300006038 Ga0075365_10928561 Ga0075365_109285611 72
102 3300006051 Ga0075364_10316599 Ga0075364_103165992 72
103 3300006051 Ga0075364_10405374 Ga0075364_104053742 72
104 3300006177 Ga0075362_10121013 Ga0075362_101210132 72
105 3300006353 Ga0075370_10015863 Ga0075370_100158632 72
106 3300006353 Ga0075370_10355419 Ga0075370_103554192 72
107 3300006844 Ga0075428_100293160 Ga0075428_1002931602 72
108 3300006844 Ga0075428_100345079 Ga0075428_1003450792 72
109 3300006880 Ga0075429_100239730 Ga0075429_1002397302 72
110 3300009147 Ga0114129_10156011 Ga0114129_101560112 72
111 3300009545 Ga0105237_12546148 Ga0105237_125461481 72
112 3300013104 Ga0157370_11272299 Ga0157370_112722992 72
113 3300020070 Ga0206356_11296375 Ga0206356_112963751 72
114 3300020081 Ga0206354_10756231 Ga0206354_107562312 72
115 3300020082 Ga0206353_10827258 Ga0206353_108272582 72
116 3300022467 Ga0224712_10000851 Ga0224712_100008514 72
117 3300025906 Ga0207699_10544565 Ga0207699_105445652 72
118 3300025915 Ga0207693_10767619 Ga0207693_107676192 72
119 3300025916 Ga0207663_11093621 Ga0207663_110936211 72
120 3300025928 Ga0207700_10401007 Ga0207700_104010071 72
121 3300025981 Ga0207640_11362301 Ga0207640_113623012 72
122 3300030734 Ga0316179_1037089 Ga0316179_10370893 72
123 3300030742 Ga0316183_1090040 Ga0316183_10900402 72
124 3300030744 Ga0316181_1176788 Ga0316181_11767881 72
125 3300030744 Ga0316181_1292971 Ga0316181_12929712 72
126 3300030745 Ga0316182_1114849 Ga0316182_11148492 72
127 3300031616 Ga0307508_10003293 Ga0307508_1000329315 72
128 3300031731 Ga0307405_12102903 Ga0307405_121029031 72
129 3300031852 Ga0307410_10130782 Ga0307410_101307822 72
130 3300031901 Ga0307406_10302990 Ga0307406_103029902 72
131 3300031903 Ga0307407_10947598 Ga0307407_109475981 72
132 3300031995 Ga0307409_100275382 Ga0307409_1002753822 72
133 3300032002 Ga0307416_101639802 Ga0307416_1016398021 72
134 3300032002 Ga0307416_103015600 Ga0307416_1030156002 72
135 3300032005 Ga0307411_12002443 Ga0307411_120024432 72
136 3300032005 Ga0307411_12016758 Ga0307411_120167581 72
137 3300032126 Ga0307415_100647380 Ga0307415_1006473802 72
138 3300032126 Ga0307415_100662251 Ga0307415_1006622511 72
139 3300033179 Ga0307507_10000001 Ga0307507_1000000180 72
140 3300037312 Ga0395899_0534415 Ga0395899_0534415_495_716 72
141 3300037418 Ga0395900_0010768 Ga0395900_0010768_47_268 72
142 3300037466 Ga0395898_0041654 Ga0395898_0041654_3947_4168 72
143 3300037853 Ga0436364_0789007 Ga0436364_0789007_493_711 72
144 3300038443 Ga0395901_0143970 Ga0395901_0143970_21_242 72
145 3300038741 Ga0400488_23132 Ga0400488_23132_4720_4938 72
146 3300049571 Ga0501034_0348638 Ga0501034_0348638_659_877 72
147 3300049572 Ga0501036_0825614 Ga0501036_0825614_354_572 72
148 3300049579 Ga0501043_0469765 Ga0501043_0469765_399_620 72
149 3300049580 Ga0501046_0203639 Ga0501046_0203639_719_940 72
150 3300049583 Ga0501067_0272298 Ga0501067_0272298_46_267 72
151 3300049585 Ga0501069_0235185 Ga0501069_0235185_254_475 72
152 3300049822 Ga0501035_0312002 Ga0501035_0312002_1027_1245 72
153 3300049822 Ga0501035_0861633 Ga0501035_0861633_338_559 72
154 3300049823 Ga0501044_0010470 Ga0501044_0010470_9502_9720 72
155 3300050489 nmdc:mga03683_163867_c1 nmdc:mga03683_163867_c1_275_532 72
156 3300050491 nmdc:mga00v17_218085_c2 nmdc:mga00v17_218085_c2_428_673 72
157 3300050491 nmdc:mga00v17_509464_c1 nmdc:mga00v17_509464_c1_461_682 72
158 3300050491 nmdc:mga00v17_539505_c1 nmdc:mga00v17_539505_c1_116_373 72
159 3300050492 nmdc:mga0yw44_838240_c1 nmdc:mga0yw44_838240_c1_333_590 72
160 3300050496 nmdc:mga07m45_30877_c1 nmdc:mga07m45_30877_c1_2297_2554 72
161 3300050510 nmdc:mga06r32_459480_c1 nmdc:mga06r32_459480_c1_175_396 72
162 3300053139 Ga0500568_0006111 Ga0500568_0006111_5720_5938 72
163 3300053139 Ga0500568_0116505 Ga0500568_0116505_130_348 72
164 3300053178 Ga0500637_0114841 Ga0500637_0114841_457_675 72
165 3300059510 Ga0587090_173726 Ga0587090_173726_64_285 72
166 3300060353 Ga0501082_1701464 Ga0501082_1701464_68_286 72
167 3300001977 JGI24746J21847_1045712 JGI24746J21847_10457121 73
168 3300001990 JGI24737J22298_10153983 JGI24737J22298_101539832 73
169 3300002459 JGI24751J29686_10121736 JGI24751J29686_101217362 73
170 3300003162 Ga0006778J45830_1009446 Ga0006778J45830_10094461 73
171 3300003163 Ga0006759J45824_1005786 Ga0006759J45824_10057861 73
172 3300003308 Ga0006777J48905_1019103 Ga0006777J48905_10191031 73
173 3300003354 JGI25160J50197_1029009 JGI25160J50197_10290092 73
174 3300003579 Ga0007429J51699_1008747 Ga0007429J51699_10087471 73
175 3300003693 Ga0032354_1012264 Ga0032354_10122641 73
176 3300004801 Ga0058860_12178325 Ga0058860_121783252 73
177 3300005329 Ga0070683_100440205 Ga0070683_1004402051 73
178 3300005337 Ga0070682_100053449 Ga0070682_1000534492 73
179 3300005338 Ga0068868_100460567 Ga0068868_1004605672 73
180 3300005340 Ga0070689_100759052 Ga0070689_1007590522 73
181 3300005366 Ga0070659_100967616 Ga0070659_1009676162 73
182 3300005455 Ga0070663_101124113 Ga0070663_1011241131 73
183 3300005466 Ga0070685_11173272 Ga0070685_111732722 73
184 3300005535 Ga0070684_100025778 Ga0070684_1000257786 73
185 3300005548 Ga0070665_101494131 Ga0070665_1014941312 73
186 3300005564 Ga0070664_100709089 Ga0070664_1007090892 73
187 3300005564 Ga0070664_100988616 Ga0070664_1009886161 73
188 3300005614 Ga0068856_101526287 Ga0068856_1015262872 73
189 3300005615 Ga0070702_100585667 Ga0070702_1005856672 73
190 3300005617 Ga0068859_100613651 Ga0068859_1006136512 73
191 3300005719 Ga0068861_101928148 Ga0068861_1019281481 73
192 3300006042 Ga0075368_10082599 Ga0075368_100825992 73
193 3300006048 Ga0075363_100138768 Ga0075363_1001387682 73
194 3300006871 Ga0075434_100759013 Ga0075434_1007590132 73
195 3300006931 Ga0097620_100613662 Ga0097620_1006136622 73
196 3300009098 Ga0105245_10576949 Ga0105245_105769492 73
197 3300009551 Ga0105238_10770232 Ga0105238_107702322 73
198 3300009553 Ga0105249_10391470 Ga0105249_103914702 73
199 3300010375 Ga0105239_11003159 Ga0105239_110031592 73
200 3300011119 Ga0105246_10204619 Ga0105246_102046192 73
201 3300012500 Ga0157314_1033339 Ga0157314_10333391 73
202 3300013102 Ga0157371_10548305 Ga0157371_105483052 73
203 3300013105 Ga0157369_10669545 Ga0157369_106695452 73
204 3300013308 Ga0157375_12799994 Ga0157375_127999942 73
205 3300014497 Ga0182008_10101197 Ga0182008_101011972 73
206 3300014745 Ga0157377_10107516 Ga0157377_101075162 73
207 3300014968 Ga0157379_11436631 Ga0157379_114366312 73
208 3300017792 Ga0163161_10819201 Ga0163161_108192012 73
209 3300020069 Ga0197907_11343455 Ga0197907_113434552 73
210 3300020069 Ga0197907_11383976 Ga0197907_113839762 73
211 3300020070 Ga0206356_10558516 Ga0206356_105585162 73
212 3300020070 Ga0206356_10968120 Ga0206356_109681202 73
213 3300020075 Ga0206349_1613634 Ga0206349_16136342 73
214 3300020075 Ga0206349_1807525 Ga0206349_18075252 73
215 3300020076 Ga0206355_1130621 Ga0206355_11306212 73
216 3300020076 Ga0206355_1502955 Ga0206355_15029552 73
217 3300020077 Ga0206351_10556868 Ga0206351_105568682 73
218 3300020080 Ga0206350_10108509 Ga0206350_101085092 73
219 3300020080 Ga0206350_11321186 Ga0206350_113211862 73
220 3300020081 Ga0206354_10432764 Ga0206354_104327643 73
221 3300020081 Ga0206354_11460497 Ga0206354_114604972 73
222 3300020082 Ga0206353_10543014 Ga0206353_105430142 73
223 3300020082 Ga0206353_11359602 Ga0206353_113596022 73
224 3300020610 Ga0154015_1456046 Ga0154015_14560461 73
225 3300022467 Ga0224712_10248146 Ga0224712_102481462 73
226 3300022467 Ga0224712_10266616 Ga0224712_102666162 73
227 3300022467 Ga0224712_10306001 Ga0224712_103060012 73
228 3300025302 Ga0207426_1004031 Ga0207426_10040313 73
229 3300025900 Ga0207710_10624084 Ga0207710_106240842 73
230 3300025927 Ga0207687_10462438 Ga0207687_104624382 73
231 3300025929 Ga0207664_10745054 Ga0207664_107450541 73
232 3300025937 Ga0207669_10211279 Ga0207669_102112791 73
233 3300025944 Ga0207661_10843701 Ga0207661_108437012 73
234 3300025945 Ga0207679_10600139 Ga0207679_106001392 73
235 3300025961 Ga0207712_10421330 Ga0207712_104213302 73
236 3300025972 Ga0207668_11859767 Ga0207668_118597671 73
237 3300026067 Ga0207678_10407490 Ga0207678_104074902 73
238 3300026078 Ga0207702_10223651 Ga0207702_102236512 73
239 3300026078 Ga0207702_11170154 Ga0207702_111701541 73
240 3300031731 Ga0307405_10533454 Ga0307405_105334542 73
241 3300031852 Ga0307410_10549108 Ga0307410_105491081 73
242 3300031889 Ga0326468_10038166 Ga0326468_100381662 73
243 3300032126 Ga0307415_101580444 Ga0307415_1015804442 73
244 3300035090 Ga0373949_0176505 Ga0373949_0176505_387_614 73
245 3300035207 Ga0373942_0031938 Ga0373942_0031938_773_1000 73
246 3300035241 Ga0373961_0344002 Ga0373961_0344002_37_264 73
247 3300035691 Ga0373931_0869508 Ga0373931_0869508_59_286 73
248 3300038996 Ga0242420_019163 Ga0242420_019163_391_618 73
249 3300041453 Ga0451797_0578273 Ga0451797_0578273_159_383 73
250 3300041459 Ga0451800_0044868 Ga0451800_0044868_171_410 73
251 3300042157 Ga0439458_0125511 Ga0439458_0125511_25_246 73
252 3300044658 Ga0466972_0032299 Ga0466972_0032299_927_1151 73
253 3300044693 Ga0466961_0291802 Ga0466961_0291802_713_937 73
254 3300044693 Ga0466961_0843174 Ga0466961_0843174_145_366 73
255 3300044765 Ga0466970_0844213 Ga0466970_0844213_28_252 73
256 3300044842 Ga0466957_0053651 Ga0466957_0053651_1537_1779 73
257 3300045049 Ga0466959_0059006 Ga0466959_0059006_503_724 73
258 3300045976 Ga0466967_0005579 Ga0466967_0005579_7139_7363 73
259 3300047321 Ga0495676_0392003 Ga0495676_0392003_557_781 73
260 3300048903 Ga0496100_0083745 Ga0496100_0083745_508_735 73
261 3300048904 Ga0496101_0084697 Ga0496101_0084697_1609_1836 73
262 3300048905 Ga0496102_0138922 Ga0496102_0138922_1536_1763 73
263 3300048906 Ga0496103_0113589 Ga0496103_0113589_1322_1549 73
264 3300048908 Ga0496105_0486448 Ga0496105_0486448_17_244 73
265 3300048909 Ga0496106_0018995 Ga0496106_0018995_3204_3431 73
266 3300048910 Ga0496107_0090810 Ga0496107_0090810_1422_1649 73
267 3300048911 Ga0496108_0343404 Ga0496108_0343404_177_404 73
268 3300048912 Ga0496109_0232484 Ga0496109_0232484_402_629 73
269 3300048913 Ga0496110_0061112 Ga0496110_0061112_293_520 73
270 3300048914 Ga0496111_0083126 Ga0496111_0083126_1585_1812 73
271 3300048915 Ga0496112_0322877 Ga0496112_0322877_616_843 73
272 3300048916 Ga0496113_1261922 Ga0496113_1261922_173_400 73
273 3300048917 Ga0496114_0210975 Ga0496114_0210975_1352_1579 73
274 3300049533 Ga0501317_011236 Ga0501317_011236_781_1005 73
275 3300049540 Ga0501324_041104 Ga0501324_041104_291_515 73
276 3300049568 Ga0501031_0097498 Ga0501031_0097498_1504_1728 73
277 3300049569 Ga0501032_0155152 Ga0501032_0155152_1239_1463 73
278 3300049571 Ga0501034_0116064 Ga0501034_0116064_400_624 73
279 3300049572 Ga0501036_0031492 Ga0501036_0031492_4045_4269 73
280 3300049576 Ga0501040_0730231 Ga0501040_0730231_42_266 73
281 3300049579 Ga0501043_0245382 Ga0501043_0245382_138_362 73
282 3300049579 Ga0501043_1241836 Ga0501043_1241836_258_485 73
283 3300049583 Ga0501067_0580071 Ga0501067_0580071_75_302 73
284 3300049585 Ga0501069_0883353 Ga0501069_0883353_53_280 73
285 3300049590 Ga0501074_0451983 Ga0501074_0451983_493_726 73
286 3300049591 Ga0501075_0123483 Ga0501075_0123483_860_1093 73
287 3300049743 Ga0501081_0815450 Ga0501081_0815450_376_603 73
288 3300049822 Ga0501035_0119434 Ga0501035_0119434_215_439 73
289 3300049823 Ga0501044_0311053 Ga0501044_0311053_771_998 73
290 3300050492 nmdc:mga0yw44_224798_c1 nmdc:mga0yw44_224798_c1_751_975 73
291 3300050494 nmdc:mga06z11_674291_c1 nmdc:mga06z11_674291_c1_324_548 73
292 3300050511 nmdc:mga08y16_1398314_c1 nmdc:mga08y16_1398314_c1_180_407 73
293 3300050512 nmdc:mga0n895_1075702_c1 nmdc:mga0n895_1075702_c1_442_669 73
294 3300053104 Ga0500556_0000284 Ga0500556_0000284_26883_27110 73
295 3300053117 Ga0500593_002613 Ga0500593_002613_6290_6517 73
296 3300061734 Ga0530510_0093551 Ga0530510_0093551_1612_1839 73

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01197

Ribosomal_L31

Ribosomal protein L31

1

65

0.98

Feature Viewer

pLDDT pTM Quality
65.63 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map